Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides
Abstract
1. Introduction

2. Cell-Surface Interactions on Arginine-Rich CPPs Allow for Internalization
2.1. Binding to Anionic Groups to Promote Uptake
2.1.1. Binding to Phosphate Anionic Groups
2.1.2. Binding to Carboxylate Anionic Groups
2.1.3. Binding to Sulfate Anionic Groups
2.2. Participate in Membrane Penetration by Partitioning the Lipid Glycerol Regions
3. Peptide Design of the Arginine-Rich CPPs
3.1. Primary Sequence Design of the Arginine-Rich CPPs
3.1.1. Number of Arginine Residues in the Peptide Sequences
3.1.2. Arginine Optical Isomers in the Peptide Sequence
3.1.3. Position of the Arginine Residues in the Primary Sequence
3.2. Secondary Structure of the Arginine-Rich CPPs
3.3. Ternary Structure of the Arginine-Rich Peptides
3.4. Modification of the Arginine-Rich CPPs
3.4.1. Improve the Transmembrane Capacities of Arginine-Rich CPPs via Hydrophobic Elements

3.4.2. Modification of the Arginine-Rich Peptides via Other Amino Acids
4. Applications of Arginine-Rich Peptides in Biomedicine
4.1. Application of Arginine-Rich Peptides in Drug Delivery
4.1.1. siRNA Delivery
4.1.2. Anti-Cancer Drugs Delivery
4.1.3. Targeted Delivery Properties
4.2. Application of Arginine-Rich Peptides in Biosensors
4.3. Application of Arginine-Rich Peptides in Antimicrobial
4.4. Application of Arginine-Rich Peptides in Blood-Brain-Barrier Transport

5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Misra, S. Human gene therapy: A brief overview of the genetic revolution. J. Assoc. Physicians India 2013, 61, 127–133. [Google Scholar]
- Giacca, M.; Zacchigna, S. Virus-mediated gene delivery for human gene therapy. J. Control. Release 2012, 161, 377–388. [Google Scholar] [CrossRef] [Scilit]
- Haddad, A.F.; Young, J.S.; Aghi, M.K. Using viral vectors to deliver local immunotherapy to glioblastoma. Neurosurg. Focus 2021, 50, E4. [Google Scholar] [CrossRef] [Scilit]
- Luo, D.; Saltzman, W.M. Synthetic DNA delivery systems. Nat. Biotechnol. 2000, 18, 33–37. [Google Scholar] [CrossRef] [Scilit]
- Ibraheem, D.; Elaissari, A.; Fessi, H. Gene therapy and DNA delivery systems. Int. J. Pharm. 2014, 459, 70–83. [Google Scholar] [CrossRef] [Scilit]
- Shi, B.; Zheng, M.; Tao, W.; Chung, R.; Jin, D.; Ghaffari, D.; Farokhzad, O.C. Challenges in DNA delivery and recent advances in multifunctional polymeric DNA delivery systems. Biomacromolecules 2017, 18, 2231–2246. [Google Scholar] [CrossRef] [Scilit]
- Cao, Y.; Ma, E.; Cestellos-Blanco, S.; Zhang, B.; Qiu, R.; Su, Y.; Doudna, J.A.; Yang, P. Nontoxic nanopore electroporation for effective intracellular delivery of biological macromolecules. Proc. Natl. Acad. Sci. USA 2019, 116, 7899–7904. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pinheiro, D.H.; Taylor, C.E.; Wu, K.; Siegfried, B.D. Delivery of gene-specific dsRNA by microinjection and feeding induces RNAi response in Sri Lanka weevil, Myllocerus undecimpustulatus undatus Marshall. Pest Manag. Sci. 2020, 76, 936–943. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kube, S.; Hersch, N.; Naumovska, E.; Gensch, T.; Hendriks, J.; Franzen, A.; Landvogt, L.; Siebrasse, J.-P.; Kubitscheck, U.; Hoffmann, B. Fusogenic liposomes as nanocarriers for the delivery of intracellular proteins. Langmuir 2017, 33, 1051–1059. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Copolovici, D.M.; Langel, K.; Eriste, E.; Langel, U. Cell-penetrating peptides: Design, synthesis, and applications. ACS Nano 2014, 8, 1972–1994. [Google Scholar] [CrossRef] [Scilit]
- Koren, E.; Torchilin, V.P. Cell-penetrating peptides: Breaking through to the other side. Trends Mol. Med. 2012, 18, 385–393. [Google Scholar] [CrossRef] [Scilit]
- Yamada, T.; Das Gupta, T.K.; Beattie, C.W. p28, an anionic cell-penetrating peptide, increases the activity of wild type and mutated p53 without altering its conformation. Mol. Pharm. 2013, 10, 3375–3383. [Google Scholar] [CrossRef] [Scilit]
- Guidotti, G.; Brambilla, L.; Rossi, D. Cell-penetrating peptides: From basic research to clinics. Trends Pharmacol. Sci. 2017, 38, 406–424. [Google Scholar] [CrossRef] [Scilit]
- Kim, S.W.; Kim, N.Y.; Choi, Y.B.; Park, S.H.; Yang, J.M.; Shin, S. RNA interference in vitro and in vivo using an arginine peptide/siRNA complex system. J. Control. Release 2010, 143, 335–343. [Google Scholar] [CrossRef] [Scilit]
- Jafari, M.; Chen, P. Peptide mediated siRNA delivery. Curr. Top. Med. Chem. 2009, 9, 1088–1097. [Google Scholar] [CrossRef] [Scilit]
- El-Sayed, A.; Futaki, S.; Harashima, H. Delivery of macromolecules using arginine-rich cell-penetrating peptides: Ways to overcome endosomal entrapment. AAPS J. 2009, 11, 13–22. [Google Scholar] [CrossRef] [Scilit]
- Wender, P.A.; Galliher, W.C.; Goun, E.A.; Jones, L.R.; Pillow, T.H. The design of guanidinium-rich transporters and their internalization mechanisms. Adv. Drug Deliv. Rev. 2008, 60, 452–472. [Google Scholar] [CrossRef] [Scilit]
- Futaki, S.; Nakase, I. Cell-surface interactions on arginine-rich cell-penetrating peptides allow for multiplex modes of internalization. Acc. Chem. Res. 2017, 50, 2449–2456. [Google Scholar] [CrossRef] [Scilit]
- Kanazawa, T.; Kaneko, M.; Niide, T.; Akiyama, F.; Kakizaki, S.; Ibaraki, H.; Shiraishi, S.; Takashima, Y.; Suzuki, T.; Seta, Y. Enhancement of nose-to-brain delivery of hydrophilic macromolecules with stearate-or polyethylene glycol-modified arginine-rich peptide. Int. J. Pharm. 2017, 530, 195–200. [Google Scholar] [CrossRef] [Scilit]
- Fawell, S.; Seery, J.; Daikh, Y.; Moore, C.; Chen, L.L.; Pepinsky, B.; Barsoum, J. Tat-mediated delivery of heterologous proteins into cells. Proc. Natl. Acad. Sci. USA 1994, 91, 664–668. [Google Scholar] [CrossRef] [Scilit]
- Watson, K.; Edwards, R.J. HIV-1 trans-activating (Tat) protein: Both a target and a tool in therapeutic approaches. Biochem. Pharmacol. 1999, 58, 1521–1528. [Google Scholar] [CrossRef] [Scilit]
- Kadkhodayan, S.; Bolhassani, A.; Mehdi Sadat, S.; Irani, S.; Fotouhi, F. The efficiency of Tat cell penetrating peptide for intracellular uptake of HIV-1 Nef expressed in E. coli and mammalian cell. Curr. Drug Deliv. 2017, 14, 536–542. [Google Scholar] [CrossRef] [Scilit]
- Jin, L.H.; Bahn, J.H.; Eum, W.S.; Kwon, H.Y.; Jang, S.H.; Han, K.H.; Kang, T.-C.; Won, M.H.; Kang, J.H.; Cho, S.-W. Transduction of human catalase mediated by an HIV-1 TAT protein basic domain and arginine-rich peptides into mammalian cells. Free Radic. Biol. Med. 2001, 31, 1509–1519. [Google Scholar] [CrossRef] [Scilit]
- Kwon, H.Y.; Eum, W.S.; Jang, H.W.; Kang, J.H.; Ryu, J.; Ryong Lee, B.; Jin, L.H.; Park, J.; Choi, S.Y. Transduction of Cu, Zn-superoxide dismutase mediated by an HIV-1 Tat protein basic domain into mammalian cells. FEBS Lett. 2000, 485, 163–167. [Google Scholar] [CrossRef] [Scilit]
- Nagahara, H.; Vocero-Akbani, A.M.; Snyder, E.L.; Ho, A.; Latham, D.G.; Lissy, N.A.; Becker-Hapak, M.; Ezhevsky, S.A.; Dowdy, S.F. Transduction of full-length TAT fusion proteins into mammalian cells: TAT-p27Kip1 induces cell migration. Nat. Med. 1998, 4, 1449–1452. [Google Scholar] [CrossRef] [Scilit]
- Park, J.; Ryu, J.; Kim, K.-A.; Lee, H.J.; Bahn, J.H.; Han, K.; Choi, E.Y.; Lee, K.S.; Kwon, H.Y.; Choi, S.Y. Mutational analysis of a human immunodeficiency virus type 1 Tat protein transduction domain which is required for delivery of an exogenous protein into mammalian cells. J. Gen. Virol. 2002, 83, 1173–1181. [Google Scholar] [CrossRef] [Scilit]
- Tashima, T. Intelligent substance delivery into cells using cell-penetrating peptides. Bioorganic Med. Chem. Lett. 2017, 27, 121–130. [Google Scholar] [CrossRef] [Scilit]
- Reissmann, S. Cell penetration: Scope and limitations by the application of cell-penetrating peptides. J. Pept. Sci. 2014, 20, 760–784. [Google Scholar] [CrossRef] [Scilit]
- Pärnaste, L.; Arukuusk, P.; Zagato, E.; Braeckmans, K.; Langel, Ü. Methods to follow intracellular trafficking of cell-penetrating peptides. J. Drug Target. 2016, 24, 508–519. [Google Scholar] [CrossRef] [Scilit]
- Hu, G.; Zheng, W.; Li, A.; Mu, Y.; Shi, M.; Li, T.; Zou, H.; Shao, H.; Qin, A.; Ye, J. A novel CAV derived cell-penetrating peptide efficiently delivers exogenous molecules through caveolae-mediated endocytosis. Vet. Res. 2018, 49, 1–9. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wei, Y.; Ma, L.; Zhang, L.; Xu, X. Noncovalent interaction-assisted drug delivery system with highly efficient uptake and release of paclitaxel for anticancer therapy. Int. J. Nanomed. 2017, 12, 7039. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Walrant, A.; Cardon, S.; Burlina, F.; Sagan, S. Membrane Crossing and Membranotropic Activity of Cell-Penetrating Peptides: Dangerous Liaisons? Acc. Chem. Res. 2017, 50, 2968. [Google Scholar] [CrossRef] [Scilit]
- Liu, B.R.; Chiou, S.-H.; Huang, Y.-W.; Lee, H.-J. Bio-Membrane Internalization Mechanisms of Arginine-Rich Cell-Penetrating Peptides in Various Species. Membranes 2022, 12, 88. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Böhmová, E.; Machová, D.; Pechar, M.; Pola, R.; Venclíková, K.; Janoušková, O.; Etrych, T. Cell-penetrating peptides: A useful tool for the delivery of various cargoes into cells. Physiol. Res. 2018, 67, S267–S279. [Google Scholar] [CrossRef] [Scilit]
- Kardani, K.; Milani, A.; Shabani, S.H.; Bolhassani, A. Cell penetrating peptides: The potent multi-cargo intracellular carriers. Expert Opin. Drug Deliv. 2019, 16, 1227–1258. [Google Scholar] [CrossRef] [Scilit]
- Zhang, L.; Xu, J.; Wang, F.; Ding, Y.; Wang, T.; Jin, G.; Martz, M.; Gui, Z.; Ouyang, P.; Chen, P. Histidine-rich cell-penetrating peptide for cancer drug delivery and its uptake mechanism. Langmuir 2019, 35, 3513–3523. [Google Scholar] [CrossRef] [Scilit]
- Ikuhiko, N.; Yoshimasa, K.; Motoyoshi, N.; Shiroh, F. Cellular Uptake of Arginine-Rich Cell-Penetrating Peptides and the Contribution of Membrane-Associated Proteoglycans. Tigg 2015, 27, 81–88. [Google Scholar]
- Stanzl, E.G.; Trantow, B.M.; Vargas, J.R.; Wender, P.A. Fifteen years of cell-penetrating, guanidinium-rich molecular transporters: Basic science, research tools, and clinical applications. Acc. Chem. Res. 2013, 46, 2944–2954. [Google Scholar] [CrossRef] [Scilit]
- Su, Y.; Waring, A.J.; Ruchala, P.; Hong, M. Membrane-bound dynamic structure of an arginine-rich cell-penetrating peptide, the protein transduction domain of HIV TAT, from solid-state NMR. Biochemistry 2010, 49, 6009–6020. [Google Scholar] [CrossRef] [Scilit]
- Herce, H.D.; Garcia, A.E.; Cardoso, M.C. Fundamental Molecular Mechanism for the Cellular Uptake of Guanidinium-Rich Molecules. J. Am. Chem. Soc. 2014, 136, 17459–17467. [Google Scholar] [CrossRef] [Scilit]
- Takechi-Haraya, Y.; Aki, K.; Tohyama, Y.; Harano, Y.; Kawakami, T.; Saito, H.; Okamura, E. Glycosaminoglycan Binding and Non-Endocytic Membrane Translocation of Cell-Permeable Octaarginine Monitored by Real-Time In-Cell NMR Spectroscopy. Pharmaceuticals 2017, 10, 42. [Google Scholar] [CrossRef] [Scilit]
- Wallbrecher, R.; Verdurmen, W.P.; Schmidt, S.; Bovee-Geurts, P.H.; Broecker, F.; Reinhardt, A.; van Kuppevelt, T.H.; Seeberger, P.H.; Brock, R. The stoichiometry of peptide-heparan sulfate binding as a determinant of uptake efficiency of cell-penetrating peptides. Cell. Mol. Life Sci. 2014, 71, 2717–2729. [Google Scholar] [CrossRef] [Scilit]
- Chen, X.; Liu, S.; Deme, B.; Cristiglio, V.; Marquardt, D.; Weller, R.; Rao, P.; Wang, Y.; Bradshaw, J. Efficient internalization of TAT peptide in zwitterionic DOPC phospholipid membrane revealed by neutron diffraction. Biochim. Biophys. Acta (BBA)-Biomembr. 2017, 1859, 910–916. [Google Scholar] [CrossRef] [Scilit]
- Jobin, M.-L.; Vamparys, L.; Deniau, R.; Grélard, A.; Mackereth, C.D.; Fuchs, P.F.; Alves, I.D. Biophysical insight on the membrane insertion of an arginine-rich cell-penetrating peptide. Int. J. Mol. Sci. 2019, 20, 4441. [Google Scholar] [CrossRef] [Scilit]
- Takechi-Haraya, Y.; Saito, H. Current Understanding of Physicochemical Mechanisms for Cell Membrane Penetration of Arginine-rich Cell Penetrating Peptides: Role of Glycosaminoglycan Interactions. Curr. Protein Pept. Sci. 2018, 19, 623–630. [Google Scholar] [CrossRef] [Scilit]
- Zhu, P.; Jin, L. Cell Penetrating Peptides: A Promising Tool for the Cellular Uptake of Macromolecular Drugs. Curr. Protein Pept. Sci. 2018, 19, 211–220. [Google Scholar] [CrossRef] [Scilit]
- Rádis-Baptista, G.; Campelo, I.S.; Morlighem, J.-É.R.; Melo, L.M.; Freitas, V.J. Cell-penetrating peptides (CPPs): From delivery of nucleic acids and antigens to transduction of engineered nucleases for application in transgenesis. J. Biotechnol. 2017, 252, 15–26. [Google Scholar] [CrossRef] [Scilit]
- Takechi-Haraya, Y.; Nadai, R.; Kimura, H.; Nishitsuji, K.; Uchimura, K.; Sakai-Kato, K.; Kawakami, K.; Shigenaga, A.; Kawakami, T.; Otaka, A. Enthalpy-driven interactions with sulfated glycosaminoglycans promote cell membrane penetration of arginine peptides. Biochim Biophys Acta 2016, 1858, 1339–1349. [Google Scholar] [CrossRef] [Scilit]
- Letoha, T.; Keller-Pintér, A.; Kusz, E.; Kolozsi, C.; Bozsó, Z.; Oacute, Z.; Tóth, G.; Vizler, C.; Oláh, Z. Cell-penetrating peptide exploited syndecans. BBA-Biomembr. 2010, 1798, 2258–2265. [Google Scholar] [CrossRef] [Scilit]
- Gerbal-Chaloin, S.; Gondeau, C.; Aldrian-Herrada, G.; Heitz, F.; Gauthier-Rouvière, C.; Divita, G. First step of the cell-penetrating peptide mechanism involves Rac1 GTPase-dependent actin-network remodelling. Biol. Cell 2007, 99, 223–238. [Google Scholar] [CrossRef] [Scilit]
- Kawaguchi, Y.; Takeuchi, T.; Kuwata, K.; Chiba, J.; Hatanaka, Y.; Nakase, I.; Futaki, S. Syndecan-4 is a receptor for clathrin-mediated endocytosis of arginine-rich cell-penetrating peptides. Bioconjugate Chem. 2016, 27, 1119–1130. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zuconelli, C.R.; Schmidt, S.; Wallbrecher, R.; Oostrum, J.V.; Adjobo-Hermans, M. Modulation of Orai1 by cationic peptides triggers their direct cytosolic uptake. Biochim. Biophys. Acta (BBA)-Biomembr. 1862, 3, 183155. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Verdurmen, W.P.; Wallbrecher, R.; Schmidt, S.; Eilander, J.; Bovee-Geurts, P.; Fanghänel, S.; Bürck, J.; Wadhwani, P.; Ulrich, A.S.; Brock, R. Cell surface clustering of heparan sulfate proteoglycans by amphipathic cell-penetrating peptides does not contribute to uptake. J. Control. Release 2013, 170, 83–91. [Google Scholar] [CrossRef] [Scilit]
- Nakase, I. Biofunctional peptide-modified extracellular vesicles enable effective intracellular delivery via the induction of macropinocytosis. Processes 2021, 9, 224. [Google Scholar] [CrossRef] [Scilit]
- Sun, D.; Forsman, J.; Lund, M.; Woodward, C.E. Effect of arginine-rich cell penetrating peptides on membrane pore formation and life-times: A molecular simulation study. Phys. Chem. Chem. Phys. 2014, 16, 20785–20795. [Google Scholar] [CrossRef] [Scilit]
- Pourmousa, M.; Karttunen, M. Early stages of interactions of cell-penetrating peptide penetratin with a DPPC bilayer. Chem. Phys. Lipids 2013, 169, 85–94. [Google Scholar] [CrossRef] [Scilit]
- Goun, E.A.; Pillow, T.H.; Jones, L.R.; Rothbard, J.B.; Wender, P.A. Molecular transporters: Synthesis of oligoguanidinium transporters and their application to drug delivery and real-time imaging. ChemBioChem 2006, 7, 1497–1515. [Google Scholar] [CrossRef] [Scilit]
- Kosuge, M.; Takeuchi, T.; Nakase, I.; Jones, A.T.; Futaki, S. Cellular internalization and distribution of arginine-rich peptides as a function of extracellular peptide concentration, serum, and plasma membrane associated proteoglycans. Bioconjug. Chem. 2008, 19, 656–664. [Google Scholar] [CrossRef] [Scilit]
- Mitchell, D.J.; Steinman, L.; Kim, D.; Fathman, C.; Rothbard, J. Polyarginine enters cells more efficiently than other polycationic homopolymers. J. Pept. Res. 2000, 56, 318–325. [Google Scholar] [CrossRef] [Scilit]
- Nakase, I.; Noguchi, K.; Aoki, A.; Takatani-Nakase, T.; Fujii, I.; Futaki, S. Arginine-rich cell-penetrating peptide-modified extracellular vesicles for active macropinocytosis induction and efficient intracellular delivery. Sci. Rep. 2017, 7, 1991. [Google Scholar] [CrossRef] [Scilit]
- Chu, D.; Xu, W.; Pan, R.; Ding, Y.; Sui, W.; Chen, P. Rational modification of oligoarginine for highly efficient siRNA delivery: Structure-Activity relationship and mechanism of intracellular trafficking of siRNA. Nanomed. Nanotechnol. Biol. Med. 2015, 11, 435–446. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ryu, D.W.; Kim, H.A.; Ryu, J.H.; Lee, D.Y.; Lee, M. Amphiphilic peptides with arginine and valine residues as siRNA carriers. J. Cell. Biochem. 2012, 113, 619–628. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Najjar, K.; Erazo-Oliveras, A.; Mosior, J.W.; Whitlock, M.J.; Rostane, I.; Cinclair, J.M.; Pellois, J.-P. Unlocking endosomal entrapment with supercharged arginine-rich peptides. Bioconjug. Chem. 2017, 28, 2932–2941. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vaithiyanathan, M.; Hymel, H.C.; Safa, N.; Sanchez, O.M.; Pettigrew, J.H.; Kirkpatrick, C.S.; Gauthier, T.J.; Melvin, A.T. Kinetic analysis of cellular internalization and expulsion of unstructured D-chirality cell penetrating peptides. AIChE J. 2021, 67, e17087. [Google Scholar] [CrossRef] [Scilit]
- Yamada, T.; Signorelli, S.; Cannistraro, S.; Beattie, C.W.; Bizzarri, A.R. Chirality switching within an anionic cell-penetrating peptide inhibits translocation without affecting preferential entry. Mol. Pharm. 2015, 12, 140–149. [Google Scholar] [CrossRef] [Scilit]
- Ueda, Y.; Wei, F.-Y.; Hide, T.-i.; Michiue, H.; Takayama, K.; Kaitsuka, T.; Nakamura, H.; Makino, K.; Kuratsu, J.-i.; Futaki, S. Induction of autophagic cell death of glioma-initiating cells by cell-penetrating D-isomer peptides consisting of Pas and the p53 C-terminus. Biomaterials 2012, 33, 9061–9069. [Google Scholar] [CrossRef] [Scilit]
- Yamashita, H.; Kato, T.; Oba, M.; Misawa, T.; Hattori, T.; Ohoka, N.; Tanaka, M.; Naito, M.; Kurihara, M.; Demizu, Y. Development of a cell-penetrating peptide that exhibits responsive changes in its secondary structure in the cellular environment. Sci. Rep. 2016, 6, 33003. [Google Scholar] [CrossRef] [Scilit]
- Tai, W.; Gao, X. Functional peptides for siRNA delivery. Adv. Drug Deliv. Rev. 2017, 110, 157–168. [Google Scholar] [CrossRef] [Scilit]
- Verdurmen, W.P.; Bovee-Geurts, P.H.; Wadhwani, P.; Ulrich, A.S.; Hällbrink, M.; van Kuppevelt, T.H.; Brock, R. Preferential uptake of L-versus D-amino acid cell-penetrating peptides in a cell type-dependent manner. Chem. Biol. 2011, 18, 1000–1010. [Google Scholar] [CrossRef] [Scilit]
- Ma, Y.; Gong, C.; Ma, Y.; Fan, F.; Luo, M.; Yang, F.; Zhang, Y.-H. Direct cytosolic delivery of cargoes in vivo by a chimera consisting of D-and L-arginine residues. J. Control. Release 2012, 162, 286–294. [Google Scholar] [CrossRef] [Scilit]
- Behzadi, M.; Eghtedardoost, M.; Bagheri, M. Endocytosis Involved d-Oligopeptide of Tryptophan and Arginine Displays Ordered Nanostructures and Cancer Cell Stereoselective Toxicity by Autophagy. ACS Appl. Mater. Interfaces 2022, 14, 14928–14943. [Google Scholar] [CrossRef] [Scilit]
- Komin, A.; Bogorad, M.I.; Lin, R.; Cui, H.; Searson, P.C.; Hristova, K. A peptide for transcellular cargo delivery: Structure-function relationship and mechanism of action. J. Control. Release 2020, 324, 633–643. [Google Scholar] [CrossRef] [Scilit]
- Ohgita, T.; Takechi-Haraya, Y.; Nadai, R.; Kotani, M.; Tamura, Y.; Nishikiori, K.; Nishitsuji, K.; Uchimura, K.; Hasegawa, K.; Sakai-Kato, K. A novel amphipathic cell-penetrating peptide based on the N-terminal glycosaminoglycan binding region of human apolipoprotein E. Biochim. Biophys. Acta (BBA)-Biomembranes 2019, 1861, 541–549. [Google Scholar] [CrossRef] [Scilit]
- Zhang, L.; Sheng, Y.; Yazdi, A.Z.; Sarikhani, K.; Wang, F.; Jiang, Y.; Liu, J.; Zheng, T.; Wang, W.; Ouyang, P. Surface-assisted assembly of a histidine-rich lipidated peptide for simultaneous exfoliation of graphite and functionalization of graphene nanosheets. Nanoscale 2019, 11, 2999–3012. [Google Scholar] [CrossRef] [Scilit]
- Cantini, L.; Attaway, C.C.; Butler, B.; Andino, L.M.; Sokolosky, M.L.; Jakymiw, A. Fusogenic-oligoarginine peptide-mediated delivery of siRNAs targeting the CIP2A oncogene into oral cancer cells. PLoS ONE 2013, 8, e73348. [Google Scholar] [CrossRef] [Scilit]
- Wang, Y.; Xuan, J.; Zhao, W.; Ding, Z.; Zhang, L.; Du, R.; Zhang, A.; Wang, Y.; Li, D.; Cao, M. Smart and selective cancer-killing peptides with cell penetrating sequence and dual-targeting mechanism. Colloids Surf. A Physicochem. Eng. Asp. 2020, 586, 124185. [Google Scholar] [CrossRef] [Scilit]
- Rousselle, C.; Clair, P.; Lefauconnier, J.-M.; Kaczorek, M.; Scherrmann, J.-M.; Temsamani, J. New advances in the transport of doxorubicin through the blood-brain barrier by a peptide vector-mediated strategy. Mol. Pharmacol. 2000, 57, 679–686. [Google Scholar] [CrossRef] [Scilit]
- Kravchenko, S.V.; Domnin, P.A.; Grishin, S.Y.; Panfilov, A.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Glyakina, A.V. Multiple Antimicrobial Effects of Hybrid Peptides Synthesized Based on the Sequence of Ribosomal S1 Protein from Staphylococcus aureus. Int. J. Mol. Sci. 2022, 23, 524. [Google Scholar] [CrossRef] [Scilit]
- Konate, K.; Josse, E.; Tasic, M.; Redjatti, K.; Aldrian, G.; Deshayes, S.; Boisguérin, P.; Vivès, E. WRAP-based nanoparticles for siRNA delivery: A SAR study and a comparison with lipid-based transfection reagents. J. Nanobiotechnol. 2021, 19, 1–18. [Google Scholar] [CrossRef] [Scilit]
- Fuselier, T.; Wimley, W.C. Spontaneous membrane translocating peptides: The role of leucine-arginine consensus motifs. Biophys. J. 2017, 113, 835–846. [Google Scholar] [CrossRef] [Scilit]
- Oba, M.; Nagano, Y.; Kato, T.; Tanaka, M. Secondary structures and cell-penetrating abilities of arginine-rich peptide foldamers. Sci. Rep. 2019, 9, 1349. [Google Scholar] [CrossRef] [Scilit]
- Kato, T.; Kita, Y.; Iwanari, K.; Asano, A.; Oba, M.; Tanaka, M.; Doi, M. Synthesis of six-membered carbocyclic ring α, α-disubstituted amino acids and arginine-rich peptides to investigate the effect of ring size on the properties of the peptide. Bioorganic Med. Chem. 2021, 38, 116111. [Google Scholar] [CrossRef] [Scilit]
- Almeida, P.F.; Ladokhin, A.S.; White, S.H. Hydrogen-bond energetics drive helix formation in membrane interfaces. Biochim. Biophys. Acta (BBA)-Biomembr. 2012, 1818, 178–182. [Google Scholar] [CrossRef] [Scilit]
- Ladokhin, A.S.; White, S.H. Folding of amphipathic α-helices on membranes: Energetics of helix formation by melittin. J. Mol. Biol. 1999, 285, 1363–1369. [Google Scholar] [CrossRef] [Scilit]
- Yamashita, H.; Oba, M.; Misawa, T.; Tanaka, M.; Hattori, T.; Naito, M.; Kurihara, M.; Demizu, Y. A helix-stabilized cell-penetrating peptide as an intracellular delivery tool. ChemBioChem 2016, 17, 137–140. [Google Scholar] [CrossRef] [Scilit]
- Chen, B.; Xu, W.; Pan, R.; Chen, P. Design and characterization of a new peptide vector for short interfering RNA delivery. J. Nanobiotechnology 2015, 13, 1–10. [Google Scholar] [CrossRef] [Scilit]
- Neree, A.T.; Nguyen, P.T.; Chatenet, D.; Fournier, A.; Bourgault, S. Secondary conformational conversion is involved in glycosaminoglycans-mediated cellular uptake of the cationic cell-penetrating peptide PACAP. FEBS Lett. 2014, 588, 4590–4596. [Google Scholar] [CrossRef] [Scilit]
- Fillon, Y.A.; Anderson, J.P.; Chmielewski, J. Cell penetrating agents based on a polyproline helix scaffold. J. Am. Chem. Soc. 2005, 127, 11798–11803. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Shinde, A.; Feher, K.M.; Hu, C.; Slowinska, K. Peptide internalization enabled by folding: Triple helical cell-penetrating peptides. J. Pept. Sci. 2015, 21, 77–84. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Oba, M.; Ito, Y.; Umeno, T.; Kato, T.; Tanaka, M. Plasmid DNA delivery using cell-penetrating peptide foldamers composed of Arg-Arg-Aib repeating sequences. ACS Biomater. Sci. Eng. 2019, 5, 5660–5668. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yoo, J.; Lee, D.; Gujrati, V.; Rejinold, N.S.; Lekshmi, K.M.; Uthaman, S.; Jeong, C.; Park, I.-K.; Jon, S.; Kim, Y.-C. Bioreducible branched poly (modified nona-arginine) cell-penetrating peptide as a novel gene delivery platform. J. Control. Release 2017, 246, 142–154. [Google Scholar] [CrossRef] [Scilit]
- Pisa, M.D.; Chassaing, G.; Swiecicki, J.M. When cationic cell-penetrating peptides meet hydrocarbons to enhance in-cell cargo delivery. J. Pept. Sci. 2015, 21, 356–369. [Google Scholar] [CrossRef] [Scilit]
- Di Pisa, M.; Chassaing, G.; Swiecicki, J.-M. Translocation mechanism (s) of cell-penetrating peptides: Biophysical studies using artificial membrane bilayers. Biochemistry 2015, 54, 194–207. [Google Scholar] [CrossRef] [Scilit]
- Ziegler, A. Thermodynamic studies and binding mechanisms of cell-penetrating peptides with lipids and glycosaminoglycans. Adv. Drug Deliv. Rev. 2008, 60, 580–597. [Google Scholar] [CrossRef] [Scilit]
- Gupta, A.; Mandal, D.; Ahmadibeni, Y.; Parang, K.; Bothun, G. Hydrophobicity drives the cellular uptake of short cationic peptide ligands. Eur. Biophys. J. 2011, 40, 727–736. [Google Scholar] [CrossRef] [Scilit]
- Mishra, A.; Lai, G.H.; Schmidt, N.W.; Sun, V.Z.; Rodriguez, A.R.; Tong, R.; Tang, L.; Cheng, J.; Deming, T.J.; Kamei, D.T. Translocation of HIV TAT peptide and analogues induced by multiplexed membrane and cytoskeletal interactions. Proc. Natl. Acad. Sci. USA 2011, 108, 16883–16888. [Google Scholar] [CrossRef] [Scilit]
- Takeuchi, T.; Kosuge, M.; Tadokoro, A.; Sugiura, Y.; Nishi, M.; Kawata, M.; Sakai, N.; Matile, S.; Futaki, S. Direct and rapid cytosolic delivery using cell-penetrating peptides mediated by pyrenebutyrate. ACS Chem. Biol. 2006, 1, 299–303. [Google Scholar] [CrossRef] [Scilit]
- Perret, F.; Nishihara, M.; Takeuchi, T.; Futaki, S.; Lazar, A.N.; Coleman, A.W.; Sakai, N.; Matile, S. Anionic fullerenes, calixarenes, coronenes, and pyrenes as activators of oligo/polyarginines in model membranes and live cells. J. Am. Chem. Soc. 2005, 127, 1114–1115. [Google Scholar] [CrossRef] [Scilit]
- Katayama, S.; Nakase, I.; Yano, Y.; Murayama, T.; Nakata, Y.; Matsuzaki, K.; Futaki, S. Effects of pyrenebutyrate on the translocation of arginine-rich cell-penetrating peptides through artificial membranes: Recruiting peptides to the membranes, dissipating liquid-ordered phases, and inducing curvature. Biochim. Biophys. Acta (BBA)-Biomembr. 2013, 1828, 2134–2142. [Google Scholar] [CrossRef] [Scilit]
- Lehto, T.; Abes, R.; Oskolkov, N.; Suhorutšenko, J.; Copolovici, D.-M.; Mäger, I.; Viola, J.R.; Simonson, O.E.; Ezzat, K.; Guterstam, P. Delivery of nucleic acids with a stearylated (RxR) 4 peptide using a non-covalent co-incubation strategy. J. Control. Release 2010, 141, 42–51. [Google Scholar] [CrossRef] [Scilit]
- Takayama, K.; Hirose, H.; Tanaka, G.; Pujals, S.; Katayama, S.; Nakase, I.; Futaki, S. Effect of the attachment of a penetration accelerating sequence and the influence of hydrophobicity on octaarginine-mediated intracellular delivery. Mol. Pharm. 2012, 9, 1222–1230. [Google Scholar] [CrossRef] [Scilit]
- Oh, D.; Nasrolahi Shirazi, A.; Northup, K.; Sullivan, B.; Tiwari, R.K.; Bisoffi, M.; Parang, K. Enhanced cellular uptake of short polyarginine peptides through fatty acylation and cyclization. Mol. Pharm. 2014, 11, 2845–2854. [Google Scholar] [CrossRef] [Scilit]
- Swiecicki, J.-M.; Di Pisa, M.; Lippi, F.; Chwetzoff, S.; Mansuy, C.; Trugnan, G.; Chassaing, G.; Lavielle, S.; Burlina, F. Unsaturated acyl chains dramatically enhanced cellular uptake by direct translocation of a minimalist oligo-arginine lipopeptide. Chem. Commun. 2015, 51, 14656–14659. [Google Scholar] [CrossRef] [Scilit]
- Mandal, S.; Mann, G.; Satish, G.; Brik, A. Enhanced Live-Cell Delivery of Synthetic Proteins Assisted by Cell-Penetrating Peptides Fused to DABCYL. Angew. Chem. Int. Ed. 2021, 60, 7333–7343. [Google Scholar] [CrossRef] [Scilit]
- Szabó, I.; Illien, F.; Dókus, L.E.; Yousef, M.a.; Baranyai, Z.; Bősze, S.; Ise, S.; Kawano, K.; Sagan, S.; Futaki, S. Influence of the Dabcyl group on the cellular uptake of cationic peptides: Short oligoarginines as efficient cell-penetrating peptides. Amino Acids 2021, 53, 1033–1049. [Google Scholar] [CrossRef] [Scilit]
- Yousef, M.a.; Szabó, I.; Biri-Kovács, B.; Szeder, B.; Illien, F.; Sagan, S.; Bánóczi, Z. Modification of Short Non-Permeable Peptides to Increase Cellular Uptake and Cytostatic Activity of Their Conjugates. Chem. Sel. 2021, 6, 10111–10120. [Google Scholar] [CrossRef] [Scilit]
- Walrant, A.; Bauzá, A.; Girardet, C.; Alves, I.D.; Lecomte, S.; Illien, F.; Cardon, S.; Chaianantakul, N.; Pallerla, M.; Burlina, F. Ionpair-π interactions favor cell penetration of arginine/tryptophan-rich cell-penetrating peptides. Biochim. Biophys. Acta (BBA)-Biomembr. 2020, 1862, 183098. [Google Scholar] [CrossRef] [Scilit]
- Almeida, C.; Maniti, O.; Di Pisa, M.; Swiecicki, J.-M.; Ayala-Sanmartin, J. Cholesterol re-organisation and lipid de-packing by arginine-rich cell penetrating peptides: Role in membrane translocation. PLoS ONE 2019, 14, e0210985. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rydberg, H.A.; Matson, M.; Åmand, H.L.; Esbjorner, E.K.; Nordén, B. Effects of tryptophan content and backbone spacing on the uptake efficiency of cell-penetrating peptides. Biochemistry 2012, 51, 5531–5539. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Djemaa, S.B.; David, S.; Hervé-Aubert, K.; Falanga, A.; Galdiero, S.; Allard-Vannier, E.; Chourpa, I.; Munnier, E. Formulation and in vitro evaluation of a siRNA delivery nanosystem decorated with gH625 peptide for triple negative breast cancer theranosis. Eur. J. Pharm. Biopharm. 2018, 131, 99–108. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhang, L.; Bennett, W.D.; Zheng, T.; Ouyang, P.-K.; Ouyang, X.; Qiu, X.; Luo, A.; Karttunen, M.; Chen, P. Effect of cholesterol on cellular uptake of cancer drugs pirarubicin and ellipticine. J. Phys. Chem. B 2016, 120, 3148–3156. [Google Scholar] [CrossRef] [Scilit]
- Zhang, L.; Zhao, L.; Ouyang, P.-K.; Chen, P. Insight into the role of cholesterol in modulation of morphology and mechanical properties of CHO-K1 cells: An in situ AFM study. Front. Chem. Sci. Eng. 2019, 13, 98–107. [Google Scholar] [CrossRef] [Scilit]
- Deshpande, P.; Jhaveri, A.; Pattni, B.; Biswas, S.; Torchilin, V. Transferrin and octaarginine modified dual-functional liposomes with improved cancer cell targeting and enhanced intracellular delivery for the treatment of ovarian cancer. Drug Deliv. 2018, 25, 517–532. [Google Scholar] [CrossRef] [Scilit]
- Zhang, X.; Xu, X.; Li, Y.; Hu, C.; Zhang, Z.; Gu, Z. Virion-like membrane-breaking nanoparticles with tumor-activated cell-and-tissue dual-penetration conquer impermeable cancer. Adv. Mater. 2018, 30, 1707240. [Google Scholar] [CrossRef] [Scilit]
- Peng, Y.-Y.; Hu, H.; Diaz-Dussan, D.; Zhao, J.; Hao, X.; Narain, R. Glycopolymer—Cell-Penetrating Peptide (CPP) Conjugates for Efficient Epidermal Growth Factor Receptor (EGFR) Silencing. ACS Macro Lett. 2022, 11, 580–587. [Google Scholar] [CrossRef] [Scilit]
- Ser, J.; Lee, J.Y.; Kim, Y.H.; Cho, H. Enhanced Efficacy of Photodynamic Therapy by Coupling a Cell-Penetrating Peptide with Methylene Blue. Int. J. Nanomed. 2020, 15, 5803. [Google Scholar] [CrossRef] [Scilit]
- Lollo, G.; Gonzalez-Paredes, A.; Garcia-Fuentes, M.; Calvo, P.; Torres, D.; Alonso, M.J. Polyarginine nanocapsules as a potential oral peptide delivery carrier. J. Pharm. Sci. 2017, 106, 611–618. [Google Scholar] [CrossRef] [Scilit]
- Niazi, M.; Zakeri-Milani, P.; Soleymani-Goloujeh, M.; Mohammadi, A.; Sarfraz, M.; Löbenberg, R.; Najafi-Hajivar, S.; Shahbazi-Mojarrad, J.; Farshbaf, M.; Valizadeh, H. Effects of self-assembled cell-penetrating peptides and their nano-complexes on ABCB1 expression and activity. Iran. J. Basic Med. Sci. 2021, 24, 383. [Google Scholar]
- Biswas, S.; Deshpande, P.P.; Perche, F.; Dodwadkar, N.S.; Sane, S.D.; Torchilin, V.P. Octa-arginine-modified pegylated liposomal doxorubicin: An effective treatment strategy for non-small cell lung cancer. Cancer Lett. 2013, 335, 191–200. [Google Scholar] [CrossRef] [Scilit]
- Wu, M.; Huang, T.; Wang, J.; Chen, P.; Mi, W.; Ying, Y.; Wang, H.; Zhao, D.; Huang, S. Antilung cancer effect of ergosterol and cisplatin-loaded liposomes modified with cyclic arginine-glycine-aspartic acid and octa-arginine peptides. Medicine 2018, 97, e11916. [Google Scholar] [CrossRef] [Scilit]
- Alhakamy, N.A.; Dhar, P.; Berkland, C.J. Charge type, charge spacing, and hydrophobicity of arginine-rich cell-penetrating peptides dictate gene transfection. Mol. Pharm. 2016, 13, 1047–1057. [Google Scholar] [CrossRef] [Scilit]
- Li, M.; Liu, P.; Gao, G.; Deng, J.; Pan, Z.; Wu, X.; Xie, G.; Yue, C.; Cho, C.H.; Ma, Y. Smac therapeutic peptide nanoparticles inducing apoptosis of cancer cells for combination chemotherapy with doxorubicin. ACS Appl. Mater. Interfaces 2015, 7, 8005–8012. [Google Scholar] [CrossRef] [Scilit]
- Li, J.-F.; Huang, Y.; Chen, R.-L.; Lee, H.-J. Induction of apoptosis by gene transfer of human TRAIL mediated by arginine-rich intracellular delivery peptides. Anticancer Res. 2010, 30, 2193–2202. [Google Scholar]
- Takenobu, T.; Tomizawa, K.; Matsushita, M.; Li, S.-T.; Moriwaki, A.; Lu, Y.-F.; Matsui, H. Development of p53 protein transduction therapy using membrane-permeable peptides and the application to oral cancer cells. Mol. Cancer Ther. 2002, 1, 1043–1049. [Google Scholar]
- Takata, H.; Tomizawa, K.; Matsushita, M.; Matsui, H. 2-methoxyestradiol enhances p53 protein transduction therapy-associated inhibition of the proliferation of oral cancer cells through the suppression of NFkappaB activity. Acta Med. Okayama 2004, 58, 181–187. [Google Scholar]
- Yue, G.; Wang, C.; Liu, B.; Wu, M.; Huang, Y.; Guo, Y.; Ma, Q. Liposomes co-delivery system of doxorubicin and astragaloside IV co-modified by folate ligand and octa-arginine polypeptide for anti-breast cancer. RSC Adv. 2020, 10, 11573–11581. [Google Scholar] [CrossRef] [Scilit]
- Bjorge, J.D.; Pang, A.; Fujita, D.J. Delivery of gene targeting siRNAs to breast cancer cells using a multifunctional peptide complex that promotes both targeted delivery and endosomal release. PLoS ONE 2017, 12, e0180578. [Google Scholar] [CrossRef] [Scilit]
- Chen, J.; Li, S.; Shen, Q. Folic acid and cell-penetrating peptide conjugated PLGA-PEG bifunctional nanoparticles for vincristine sulfate delivery. Eur. J. Pharm. Sci. 2012, 47, 430–443. [Google Scholar] [CrossRef] [Scilit]
- Zhang, P.; Lock, L.L.; Cheetham, A.G.; Cui, H. Enhanced cellular entry and efficacy of tat conjugates by rational design of the auxiliary segment. Mol. Pharm. 2014, 11, 964–973. [Google Scholar] [CrossRef] [Scilit]
- Cheung, C.H.A.; Sun, X.; Kanwar, J.R.; Bai, J.-Z.; Cheng, L.; Krissansen, G.W. A cell-permeable dominant-negative survivin protein induces apoptosis and sensitizes prostate cancer cells to TNF-α therapy. Cancer Cell Int. 2010, 10, 1–11. [Google Scholar]
- Goun, E.A.; Shinde, R.; Dehnert, K.W.; Adams-Bond, A.; Wender, P.A.; Contag, C.H.; Franc, B.L. Intracellular cargo delivery by an octaarginine transporter adapted to target prostate cancer cells through cell surface protease activation. Bioconjug. Chem. 2006, 17, 787–796. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, C.; Liu, X.; Rocchi, P.; Qu, F.; Iovanna, J.L.; Peng, L. Arginine-terminated generation 4 PAMAM dendrimer as an effective nanovector for functional siRNA delivery in vitro and in vivo. Bioconjug. Chem. 2014, 25, 521–532. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhou, J.; Liu, W.; Pong, R.-C.; Hao, G.; Sun, X.; Hsieh, J.-T. Analysis of oligo-arginine cell-permeable peptides uptake by prostate cells. Amino Acids 2012, 42, 1253–1260. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Okada, H. Depot Microcapsules Containing Biologic Nanoparticles and Cytoplasm-Responsive Nanocarriers for Nucleotides. In Nanomaterials in Pharmacology; Springer: Berlin/Heidelberg, Germany, 2016; pp. 311–332. [Google Scholar]
- Zhong, G.; Xu, Z.; Yang, R.; Zhang, S.; Li, L.; Wu, M.; Liu, H.; Zhen, Y. An arginine-rich cell penetrating peptide contained anti-gelatinase scFv-LDM fusion protein shows potent antitumor efficacy in pancreatic cancer. J. Cancer 2018, 9, 674. [Google Scholar] [CrossRef] [Scilit]
- Takara, K.; Hatakeyama, H.; Kibria, G.; Ohga, N.; Hida, K.; Harashima, H. Size-controlled, dual-ligand modified liposomes that target the tumor vasculature show promise for use in drug-resistant cancer therapy. J. Control. Release 2012, 162, 225–232. [Google Scholar] [CrossRef] [Scilit]
- Togashi, Y.; Shitara, K.; Nishikawa, H. Regulatory T cells in cancer immunosuppression—Implications for anticancer therapy. Nat. Rev. Clin. Oncol. 2019, 16, 356–371. [Google Scholar] [CrossRef] [Scilit]
- Dominguez-Villar, M.; Hafler, D.A. Regulatory T cells in autoimmune disease. Nat. Immunol. 2018, 19, 665–673. [Google Scholar] [CrossRef] [Scilit]
- Grant, C.R.; Liberal, R.; Mieli-Vergani, G.; Vergani, D.; Longhi, M.S. Regulatory T-cells in autoimmune diseases: Challenges, controversies and—yet—unanswered questions. Autoimmun. Rev. 2015, 14, 105–116. [Google Scholar] [CrossRef] [Scilit]
- Bluestone, J.A.; Trotta, E.; Xu, D. The therapeutic potential of regulatory T cells for the treatment of autoimmune disease. Expert Opin. Ther. Targets 2015, 19, 1091–1103. [Google Scholar] [CrossRef] [Scilit]
- Romano, M.; Fanelli, G.; Albany, C.J.; Giganti, G.; Lombardi, G. Past, present, and future of regulatory T cell therapy in transplantation and autoimmunity. Front. Immunol. 2019, 10, 43. [Google Scholar] [CrossRef] [Scilit]
- Ohue, Y.; Nishikawa, H. Regulatory T (Treg) cells in cancer: Can Treg cells be a new therapeutic target? Cancer Sci. 2019, 110, 2080–2089. [Google Scholar] [CrossRef] [Scilit]
- Morse, M.A.; Hobeika, A.; Serra, D.; Aird, K.; McKinney, M.; Aldrich, A.; Clay, T.; Mourich, D.; Lyerly, H.K.; Iversen, P.L. Depleting regulatory T cells with arginine-rich, cell-penetrating, peptide-conjugated morpholino oligomer targeting FOXP3 inhibits regulatory T-cell function. Cancer Gene Ther. 2012, 19, 30–37. [Google Scholar] [CrossRef] [Scilit]
- Xiao, D.; Huang, Y.; Huang, S.; Zhuang, J.; Chen, P.; Wang, Y.; Zhang, L. Targeted delivery of cancer drug paclitaxel to chordomas tumor cells via an RNA nanoparticle harboring an EGFR aptamer. Colloids Surf. B Biointerfaces 2022, 212, 112366. [Google Scholar] [CrossRef] [Scilit]
- Okuda, A.; Futaki, S. Protein delivery to cytosol by cell-penetrating peptide bearing tandem repeat penetration-accelerating sequence. In Cell Penetrating Peptides; Springer: Berlin/Heidelberg, Germany, 2022; pp. 265–273. [Google Scholar]
- Chen, J.X.; Xu, X.D.; Yang, S.; Yang, J.; Zhuo, R.X.; Zhang, X.Z. Self-Assembled BolA-like Amphiphilic Peptides as Viral-Mimetic Gene Vectors for Cancer Cell Targeted Gene Delivery. Macromol. Biosci. 2013, 13, 84–92. [Google Scholar] [CrossRef] [Scilit]
- Liu, Y.; Lu, Z.; Mei, L.; Yu, Q.; Tai, X.; Wang, Y.; Shi, K.; Zhang, Z.; He, Q. Tandem peptide based on structural modification of poly-arginine for enhancing tumor targeting efficiency and therapeutic effect. ACS Appl. Mater. Interfaces 2017, 9, 2083–2092. [Google Scholar] [CrossRef] [Scilit]
- Ji, T.; Ding, Y.; Zhao, Y.; Wang, J.; Qin, H.; Liu, X.; Lang, J.; Zhao, R.; Zhang, Y.; Shi, J. Peptide assembly integration of fibroblast-targeting and cell-penetration features for enhanced antitumor drug delivery. Adv. Mater. 2015, 27, 1865–1873. [Google Scholar] [CrossRef] [Scilit]
- Cheng, Y.-J.; Cheng, H.; Zhao, X.; Xu, X.-D.; Zhuo, R.-X.; He, F. Self-assembled micelles of a multi-functional amphiphilic fusion (MFAF) peptide for targeted cancer therapy. Polym. Chem. 2015, 6, 3512–3520. [Google Scholar] [CrossRef] [Scilit]
- Yang, C.; Ng, C.-T.; Li, D.; Zhang, L. Targeting indoleamine 2, 3-dioxygenase 1: Fighting cancers via dormancy regulation. Front. Immunol. 2021, 12, 725204. [Google Scholar] [CrossRef] [Scilit]
- Zhang, L.; Jiang, C.; Zeng, F.; Zhou, H.; Li, D.; He, X.; Shen, S.; Yang, X.; Wang, J. A polymeric nanocarrier with a tumor acidity-activatable arginine-rich (R 9) peptide for enhanced drug delivery. Biomater. Sci. 2020, 8, 2255–2263. [Google Scholar] [CrossRef] [Scilit]
- Wang, S.; Li, F.; Qiao, R.; Hu, X.; Liao, H.; Chen, L.; Wu, J.; Wu, H.; Zhao, M.; Liu, J. Arginine-rich manganese silicate nanobubbles as a ferroptosis-inducing agent for tumor-targeted theranostics. Acs Nano 2018, 12, 12380–12392. [Google Scholar] [CrossRef] [Scilit]
- Bozym, R.A.; Thompson, R.B.; Stoddard, A.K.; Fierke, C.A. Measuring picomolar intracellular exchangeable zinc in PC-12 cells using a ratiometric fluorescence biosensor. ACS Chem. Biol. 2006, 1, 103–111. [Google Scholar] [CrossRef] [Scilit]
- Xia, M.-C.; Cai, L.; Zhang, S.; Zhang, X. A cell-penetrating ratiometric probe for simultaneous measurement of lysosomal and cytosolic pH change. Talanta 2018, 178, 355–361. [Google Scholar] [CrossRef] [Scilit]
- Xia, M.-C.; Cai, L.; Yang, Y.; Zhang, S.; Zhang, X. Tuning the p K a of Carboxyfluorescein with Arginine-Rich Cell-Penetrating Peptides for Intracellular pH Imaging. Anal. Chem. 2019, 91, 9168–9173. [Google Scholar] [CrossRef] [Scilit]
- Webster, A.; Compton, S.J.; Aylott, J.W. Optical calcium sensors: Development of a generic method for their introduction to the cell using conjugated cell penetrating peptides. Analyst 2005, 130, 163–170. [Google Scholar] [CrossRef] [Scilit]
- Uri, A.; Lust, M.; Vaasa, A.; Lavogina, D.; Viht, K.; Enkvist, E. Bisubstrate fluorescent probes and biosensors in binding assays for HTS of protein kinase inhibitors. Biochim. Biophys. Acta (BBA)-Proteins Proteom. 2010, 1804, 541–546. [Google Scholar] [CrossRef] [Scilit]
- Hao, G.; Zhou, J.; Guo, Y.; Long, M.A.; Anthony, T.; Stanfield, J.; Hsieh, J.-T.; Sun, X. A cell permeable peptide analog as a potential-specific PET imaging probe for prostate cancer detection. Amino Acids 2011, 41, 1093–1101. [Google Scholar] [CrossRef] [Scilit]
- Lee, H.; Lim, S.I.; Shin, S.-H.; Lim, Y.; Koh, J.W.; Yang, S. Conjugation of cell-penetrating peptides to antimicrobial peptides enhances antibacterial activity. ACS Omega 2019, 4, 15694–15701. [Google Scholar] [CrossRef] [Scilit]
- Grishin, S.Y.; Domnin, P.A.; Kravchenko, S.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Makarova, M.A.; Kurpe, S.R. Is It Possible to Create Antimicrobial Peptides Based on the Amyloidogenic Sequence of Ribosomal S1 Protein of P. aeruginosa? Int. J. Mol. Sci. 2021, 22, 9776. [Google Scholar] [CrossRef] [Scilit]
- Kurpe, S.R.; Grishin, S.Y.; Surin, A.K.; Selivanova, O.M.; Fadeev, R.S.; Dzhus, U.F.; Gorbunova, E.Y.; Mustaeva, L.G.; Azev, V.N.; Galzitskaya, O.V. Antimicrobial and amyloidogenic activity of peptides synthesized on the basis of the ribosomal S1 protein from Thermus thermophilus. Int. J. Mol. Sci. 2020, 21, 6382. [Google Scholar] [CrossRef] [Scilit]
- Sharma, G.; Modgil, A.; Sun, C.; Singh, J. Grafting of cell-penetrating peptide to receptor-targeted liposomes improves their transfection efficiency and transport across blood-brain barrier model. J. Pharm. Sci. 2012, 101, 2468–2478. [Google Scholar] [CrossRef] [Scilit]
- Gotanda, Y.; Wei, F.-Y.; Harada, H.; Ohta, K.; Nakamura, K.-i.; Tomizawa, K.; Ushijima, K. Efficient transduction of 11 poly-arginine peptide in an ischemic lesion of mouse brain. J. Stroke Cerebrovasc. Dis. Off. J. Natl. Stroke Assoc. 2014, 23, 2023–2030. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Tian, Y.; Mi, G.; Chen, Q.; Chaurasiya, B.; Li, Y.; Shi, D.; Zhang, Y.; Webster, T.J.; Sun, C.; Shen, Y. Acid-Induced Activated Cell-Penetrating Peptide-Modified Cholesterol-Conjugated Polyoxyethylene Sorbitol Oleate Mixed Micelles for pH-Triggered Drug Release and Efficient Brain Tumor Targeting Based on a Charge Reversal Mechanism. ACS Appl. Mater. Interfaces 2018, 10, 43411–43428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yao, L.; Xu, J.; Zhang, L.; Liu, L.; Zhang, L. Nanoencapsulation of anthocyanin by an amphiphilic peptide for stability enhancement. Food Hydrocoll. 2021, 118, 106741. [Google Scholar] [CrossRef] [Scilit]
- Yao, L.; Xu, J.; Zhang, L.; Zheng, T.; Liu, L.; Zhang, L. Physicochemical stability-increasing effects of anthocyanin via a co-assembly approach with an amphiphilic peptide. Food Chem. 2021, 362, 130101. [Google Scholar] [CrossRef] [Scilit]
- Kim, S.; Kang, J.Y.; Balance, W.C.; Sutton, B.P.; Shin, D.H.; Jang, K.H.; Shin, M.; Kong, H.; Kim, J.W. Fabrication of cell penetrating peptide-conjugated bacterial cellulose nanofibrils with remarkable skin adhesion and water retention performance. Int. J. Pharm. 2021, 600, 120476. [Google Scholar] [CrossRef] [Scilit]
| Name | Sequences | Reference |
|---|---|---|
| Tat protein (residues 49–57) | RKKRRQRRR | [26] |
| R9 | RRRRRRRRR | [69] |
| r9 | rrrrrrrrr | [69] |
| R8 | RRRRRRRR | [70] |
| rR7 | rRRRRRRR | [70] |
| (rR)2R4 | rRrRRRRR | [70] |
| (rR)3R2 | rRrRrRRR | [70] |
| (rR)4 | rRrRrRrR | [70] |
| r2(rR)3 | rrrRrRrR | [70] |
| r8 | rrrrrrrr | [70] |
| W1 | LLWRLWRLLWRLRLL | [71] |
| W5 | LLRLLRWWWRLLRLL | [71] |
| W1-4R | RLLWRLWLWRLLR | [71] |
| W5-4R | RLLRLLWWWLLRLLR | [71] |
| CLr | RLLrLLR, | [72] |
| CL | RLLRLLR | [72] |
| A2-17 | LRKLRKRLLRLWKLRKR | [73] |
| NP1 | stearyl-HHHHHHHHHHHHHHHH-RRRRRRRR-NH2 | [36,74] |
| 599 peptides | GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK | [75] |
| RR-22 | Ac-RGDGPLGLAGI3GR8-NH2 | [76] |
| SynB1 | RGGRLSYSRRRFSTSTGR | [77] |
| R23F | RKKRRQRRRGGSarGVVVHI-Asi-GGKF-NH2 | [78] |
| R23DI | RKKRRQRRRGGSarGLTQFGAFIDI-NH2 | [78] |
| R23EI | RKKRRQRRRGGSarGVQGLVHISEI-NH2 | [78] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hao, M.; Zhang, L.; Chen, P. Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides. Int. J. Mol. Sci. 2022, 23, 9038. https://doi.org/10.3390/ijms23169038
Hao M, Zhang L, Chen P. Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides. International Journal of Molecular Sciences. 2022; 23(16):9038. https://doi.org/10.3390/ijms23169038
Chicago/Turabian StyleHao, Minglu, Lei Zhang, and Pu Chen. 2022. "Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides" International Journal of Molecular Sciences 23, no. 16: 9038. https://doi.org/10.3390/ijms23169038
APA StyleHao, M., Zhang, L., & Chen, P. (2022). Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides. International Journal of Molecular Sciences, 23(16), 9038. https://doi.org/10.3390/ijms23169038

