Search Results (6)

Talpidae is a model group for evolutionary studies due to their highly specialized morphologies and diverse lifestyles. Mitochondrial genomes are molecular markers commonly used in species evolution and phylogenetic studies. In this study, the complete mitochondrial genome sequence of Scaptochirus moschatus was obtained by Illumina NovaSeq sequencing. The complete mitochondrial genomes of 14 Talpidae species (including Scaptochirus moschatus obtained in the present study) and the cytochrome b (Cyt b) gene sequences of 48 Talpidae species were downloaded from the NCBI database for comparison and phylogenetic studies to analyze the phylogenetic relationships and to find the possible reasons of the niche differentiation and ecotype specialization of Talpidae animals. The results showed that the mitochondrial genome sequences of 14 species belonging to the family Talpidae were 16,528 to 16,962 bp, all containing 13 protein-coding genes, 22 tRNA, two rRNA, and a non-coding region (control region). The difference in the number of repetitive repeats in the control region is responsible for the difference in the length of Talpidae mitochondrial genome sequences. Combining the divergence time of Talpidae animals with the geological history, it is found that the niche differentiation and ecotype divergence of Talpidae is closely related to historically global climate changes. Semi-aquatic groups diverged in the early Oligocene (about 31.22 MYA), probably in response to the global climate transition from warm to cool. During the early Miocene (about 19.54 MYA), some species of Talpidae moved to underground habitats and formed fossorial groups that were adept at digging due to the effects of the glaciation. In the middle Miocene (about 16.23 MYA), some Talpidae animals returned to the ground and formed semi-fossorial shrew moles as global climate warming again. Full article

In the genus Talpa a new species, named Talpa aquitania, has been recently described. Only cytogenetic data are available for the nuclear genome of this species. In this work, we characterize the satellitome of the T. aquitania genome that presents 16 different families, including telomeric sequences, and they represent 1.24% of the genome. The first satellite DNA family (TaquSat1-183) represents 0.558%, and six more abundant families, including TaquSat1-183, comprise 1.13%, while the remaining 11 sat-DNAs represent only 0.11%. The average A + T content of the SatDNA families was 50.43% and the median monomer length was 289.24 bp. The analysis of these SatDNAs indicated that they have different grades of clusterization, homogenization, and degeneration. Most of the satDNA families are present in the genomes of the other Talpa species analyzed, while in the genomes of other more distant species of Talpidae, only some of them are present, in accordance with the library hypothesis. Moreover, chromosomal localization by FISH revealed that some satDNAs are localized preferentially on centromeric and non-centromeric heterochromatin in T. aquitania and also in the sister species T. occidentalis karyotype. The differences observed between T. aquitania and the close relative T. occidentalis and T. europaea suggested that the satellitome is a very dynamic component of the genomes and that the satDNAs could be responsible for chromosomal differences between the species. Finally, in a broad context, these data contribute to the understanding of the evolution of satellitomes on mammals. Full article

The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development. Full article

To date, six hantavirus species have been detected in moles (family Talpidae). In this report, we describe Academ virus (ACDV), a novel hantavirus harbored by the Siberian mole (Talpa altaica) in Western Siberia. Genetic analysis of the complete S-, M-, and partial L-genomic segments showed that ACDV shared a common evolutionary origin with Bruges virus, previously identified in the European mole (Talpa europaea), and is distantly related to other mole-borne hantaviruses. Co-evolution and local adaptation of genetic variants of hantaviruses and their hosts, with possible reassortment events, might have shaped the evolutionary history of ACDV. Full article

Only six parasitic species of Demodecidae mite have thus far been described from the Soricomorpha, these being associated with the common shrew Sorex araneus Linnaeus, 1758, and the Mediterranean water shrew Neomys anomalus Cabrera, 1907 (two species from each host), and with the lesser white-toothed shrew Crocidura suaveolens (Pallas, 1811) and the European mole Talpa europaea Linnaeus, 1758 (one from each host species). Presently, Demodex crocidurae, a new species, has been described from the territory of Poland for C. suaveolens; in order to confirm its validity, it was necessary to redescribe D. talpae Hirst, 1921, from T. europaea, a demodecid species first described by Hirst in 1921 from England and then noted only in Poland. Both species colonized the hairy skin of the body in their hosts, where no disease symptoms of infestation were observed. However, D. crocidurae showed higher infection parameters (prevalence 100%, mean intensity 11.7, intensity range 3–26 individuals) than those of D. talpae (30.0%, 4.7, 2.0–8.0), possibly due to different host biology. Full article

The recent discovery that multiple species of shrews and moles (order Eulipotyphla, families Soricidae and Talpidae) from Europe, Asia, Africa and/or North America harbour genetically distinct viruses belonging to the family Hantaviridae (order Bunyavirales) has prompted a further exploration of their host diversification. In analysing thousands of frozen, RNAlater^®-preserved and ethanol-fixed tissues from bats (order Chiroptera) by reverse transcription polymerase chain reaction (RT-PCR), ten hantaviruses have been detected to date in bat species belonging to the suborder Yinpterochiroptera (families Hipposideridae, Pteropodidae and Rhinolophidae) and the suborder Yangochiroptera (families Emballonuriade, Nycteridae and Vespertilionidae). Of these, six hantaviruses are from Asia (Xuân Sơn virus and Đakrông virus in Vietnam; Láibīn virus in China and Myanmar; Huángpí virus and Lóngquán virus in China; and Quezon virus in the Philippines); three are from Africa (Mouyassué virus in Côte d’Ivoire and Ethiopia; Magboi virus in Sierra Leone; and Makokou virus in Gabon); and one from Europe (Brno virus in the Czech Republic). Molecular identification of many more bat-borne hantaviruses is expected. However, thus far, none of these newfound viruses has been isolated in cell culture and it is unclear if they cause infection or disease in humans. Future research must focus on myriad unanswered questions about the genetic diversity and geographic distribution, as well as the pathogenic potential, of bat-borne viruses of the family Hantaviridae. Full article