Carboxyl-Terminal Decoy Epitopes in the Capsid Protein of Porcine Circovirus Type 2 Are Immunogenicity-Enhancers That Elicit Predominantly Specific Antibodies in Non-Vaccinated Pigs
Abstract
1. Introduction
2. Materials and Methods
2.1. Design of Synthesized Peptides
2.2. Generation of MAbs Which against the C-Terminus of the Capsid Peptide of PCV2a (Residues 205–233, P64)
2.3. Isotyping of MAbs
2.4. Peptide Array-Based Epitope Mapping
2.5. Immunofluorescence Assay
2.6. Generation of Structural Images for Capsid Protein of PCV2a
2.7. Archival Pig Sera Collected from the Piglets following Vaccination or Unvaccinated Controls
2.8. Detection of the Specific Antibodies against the Capsid Peptides or Other ORF Peptides in Sera among Vaccinated Piglets and Control Ones
2.9. Statistical Analysis
3. Results
3.1. Hybridomas Screening and Isotyping of MAbs against the C-Terminus of the Capsid Peptide of PCV2a (Peptide P64)
3.2. Mapping of Linear Epitopes for Anti-Capsid Peptide (P64) MAbs Binding
3.3. Immunoreactivity of Anti-P64 MAbs with PCV2 Virus
3.4. Locations of Binding Residues of MAbs (3H11, 4F6, and 6H11) on the 3-D Model of the VLP of PCV2
3.5. Immunoreactivities of Peptides with Swine Sera Which Were from Vaccinated Piglets or Control Ones
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Opriessnig, T.; Meng, X.-J.; Halbur, P.G. Porcine Circovirus Type 2 Associated Disease: Update on Current Terminology, Clinical Manifestations, Pathogenesis, Diagnosis, and Intervention Strategies. J. Vet. Diagn. Investig. 2007, 19, 591–615. [Google Scholar] [CrossRef] [PubMed]
- Tischer, I.; Gelderblom, H.; Vettermann, W.; Koch, M.A. A Very Small Porcine Virus with Circular Single-Stranded DNA. Nature 1982, 295, 64. [Google Scholar] [CrossRef] [PubMed]
- López-Lorenzo, G.; Díaz-Cao, J.M.; Prieto, A.; López-Novo, C.; López, C.M.; Díaz, P.; Rodríguez-Vega, V.; Díez-Baños, P.; Fernández, G. Environmental Distribution of Porcine Circovirus Type 2 (PCV2) in Swine Herds with Natural Infection. Sci. Rep. 2019, 9, 14816. [Google Scholar] [CrossRef] [PubMed]
- Allan, G.M.; Kennedy, S.; McNeilly, F.; Foster, J.C.; Ellis, J.A.; Krakowka, S.J.; Meehan, B.M.; Adair, B.M. Experimental Reproduction of Severe Wasting Disease by Co-Infection of Pigs with Porcine Circovirus and Porcine Parvovirus. J. Comp. Pathol. 1999, 121, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Kennedy, S.; Moffett, D.; McNeilly, F.; Meehan, B.; Ellis, J.; Krakowka, S.; Allan, G.M. Reproduction of Lesions of Postweaning Multisystemic Wasting Syndrome by Infection of Conventional Pigs with Porcine Circovirus Type 2 Alone or in Combination with Porcine Parvovirus. J. Comp. Pathol. 2000, 122, 9–24. [Google Scholar] [CrossRef]
- Kim, J.; Ha, Y.; Jung, K.; Choi, C.; Chae, C. Enteritis Associated with Porcine Circovirus 2 in Pigs. Can. J. Vet. Res. 2004, 68, 218–221. [Google Scholar]
- Segalés, J. Porcine Circovirus Type 2 (PCV2) Infections: Clinical Signs, Pathology and Laboratory Diagnosis. Virus Res. 2012, 164, 10–19. [Google Scholar] [CrossRef]
- Segalés, J.; Domingo, M. Postweaning Mulstisystemic Wasting Syndrome (PMWS) in Pigs. A Review. Vet. Q. 2002, 24, 109–124. [Google Scholar] [CrossRef]
- Fort, M.; Sibila, M.; Allepuz, A.; Mateu, E.; Roerink, F.; Segalés, J. Porcine Circovirus Type 2 (PCV2) Vaccination of Conventional Pigs Prevents Viremia against PCV2 Isolates of Different Genotypes and Geographic Origins. Vaccine 2008, 26, 1063–1071. [Google Scholar] [CrossRef]
- Feng, H.; Blanco, G.; Segalés, J.; Sibila, M. Can Porcine Circovirus Type 2 (PCV2) Infection Be Eradicated by Mass Vaccination? Vet. Microbiol. 2014, 172, 92–99. [Google Scholar] [CrossRef]
- Czyżewska-Dors, E.B.; Dors, A.; Pomorska-Mól, M.; Podgórska, K.; Pejsak, Z. Efficacy of the Porcine Circovirus 2 (PCV2) Vaccination under Field Conditions. Vet. Ital. 2018, 54, 219–224. [Google Scholar] [CrossRef]
- Oliver-Ferrando, S.; Segalés, J.; López-Soria, S.; Callén, A.; Merdy, O.; Joisel, F.; Sibila, M. Evaluation of Natural Porcine Circovirus Type 2 (PCV2) Subclinical Infection and Seroconversion Dynamics in Piglets Vaccinated at Different Ages. Vet. Res. 2016, 47, 121. [Google Scholar] [CrossRef] [PubMed]
- Lyoo, K.; Joo, H.; Caldwell, B.; Kim, H.; Davies, P.R.; Torrison, J. Comparative Efficacy of Three Commercial PCV2 Vaccines in Conventionally Reared Pigs. Vet. J. 2011, 189, 58–62. [Google Scholar] [CrossRef] [PubMed]
- Wiederkehr, D.D.; Sydler, T.; Buergi, E.; Haessig, M.; Zimmermann, D.; Pospischil, A.; Brugnera, E.; Sidler, X. A New Emerging Genotype Subgroup within PCV-2b Dominates the PMWS Epizooty in Switzerland. Vet. Microbiol. 2009, 136, 27–35. [Google Scholar] [CrossRef] [PubMed]
- Patterson, A.R.; Opriessnig, T. Epidemiology and Horizontal Transmission of Porcine Circovirus Type 2 (PCV2). Anim. Health Res. Rev. 2010, 11, 217–234. [Google Scholar] [CrossRef] [PubMed]
- Cortey, M.; Pileri, E.; Sibila, M.; Pujols, J.; Balasch, M.; Plana, J.; Segalés, J. Genotypic Shift of Porcine Circovirus Type 2 from PCV-2a to PCV-2b in Spain from 1985 to 2008. Vet. J. 2011, 187, 363–368. [Google Scholar] [CrossRef]
- Beach, N.M.; Meng, X.-J. Efficacy and Future Prospects of Commercially Available and Experimental Vaccines against Porcine Circovirus Type 2 (PCV2). Virus Res. 2012, 164, 33–42. [Google Scholar] [CrossRef]
- Wang, F.; Guo, X.; Ge, X.; Wang, Z.; Chen, Y.; Cha, Z.; Yang, H. Genetic Variation Analysis of Chinese Strains of Porcine Circovirus Type 2. Virus Res. 2009, 145, 151–156. [Google Scholar] [CrossRef]
- Guo, L.J.; Lu, Y.H.; Wei, Y.W.; Huang, L.P.; Liu, C.M. Porcine Circovirus Type 2 (PCV2): Genetic Variation and Newly Emerging Genotypes in China. Virol. J. 2010, 7, 273. [Google Scholar] [CrossRef]
- Xiao, C.-T.; Harmon, K.M.; Halbur, P.G.; Opriessnig, T. PCV2d-2 Is the Predominant Type of PCV2 DNA in Pig Samples Collected in the U.S. during 2014–2016. Vet. Microbiol. 2016, 197, 72–77. [Google Scholar] [CrossRef]
- Mone, N.K.; Clark, N.J.; Kyaw-Tanner, M.; Turni, C.; Barnes, T.S.; Parke, C.R.; Alawneh, J.A.; Blackall, P.J.; Meers, J. Genetic Analysis of Porcine Circovirus Type 2 (PCV2) in Queensland, Australia. Aust. Vet. J. 2020, 98, 388–395. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Noll, L.; Lu, N.; Porter, E.; Stoy, C.; Zheng, W.; Liu, X.; Peddireddi, L.; Niederwerder, M.; Bai, J. Genetic Diversity and Prevalence of Porcine Circovirus Type 3 (PCV3) and Type 2 (PCV2) in the Midwest of the USA during 2016-2018. Transbound. Emerg. Dis. 2020, 67, 1284–1294. [Google Scholar] [CrossRef] [PubMed]
- Xiao, C.-T.; Halbur, P.G.; Opriessnig, T. Global Molecular Genetic Analysis of Porcine Circovirus Type 2 (PCV2) Sequences Confirms the Presence of Four Main PCV2 Genotypes and Reveals a Rapid Increase of PCV2d. J. Gen. Virol. 2015, 96, 1830–1841. [Google Scholar] [CrossRef] [PubMed]
- Hamel, A.L.; Lin, L.L.; Nayar, G.P.S. Nucleotide Sequence of Porcine Circovirus Associated with Postweaning Multisystemic Wasting Syndrome in Pigs. J. Virol. 1998, 72, 5262–5267. [Google Scholar] [CrossRef]
- Cheung, A.K. The Essential and Nonessential Transcription Units for Viral Protein Synthesis and DNA Replication of Porcine Circovirus Type 2. Virology 2003, 313, 452–459. [Google Scholar] [CrossRef]
- Nawagitgul, P.; Morozov, I.; Bolin, S.R.; Harms, P.A.; Sorden, S.D.; Paul, P.S. Open Reading Frame 2 of Porcine Circovirus Type 2 Encodes a Major Capsid Protein. J. Gen. Virol. 2000, 81, 2281–2287. [Google Scholar] [CrossRef]
- Zhou, J.-Y.; Shang, S.-B.; Gong, H.; Chen, Q.-X.; Wu, J.-X.; Shen, H.-G.; Chen, T.-F.; Guo, J.-Q. In Vitro Expression, Monoclonal Antibody and Bioactivity for Capsid Protein of Porcine Circovirus Type II without Nuclear Localization Signal. J. Biotechnol. 2005, 118, 201–211. [Google Scholar] [CrossRef]
- Fan, H.; Ju, C.; Tong, T.; Huang, H.; Lv, J.; Chen, H. Immunogenicity of Empty Capsids of Porcine Circovius Type 2 Produced in Insect Cells. Vet. Res. Commun. 2007, 31, 487–496. [Google Scholar] [CrossRef]
- Fort, M.; Sibila, M.; Pérez-Martín, E.; Nofrarías, M.; Mateu, E.; Segalés, J. One Dose of a Porcine Circovirus 2 (PCV2) Sub-Unit Vaccine Administered to 3-Week-Old Conventional Piglets Elicits Cell-Mediated Immunity and Significantly Reduces PCV2 Viremia in an Experimental Model. Vaccine 2009, 27, 4031–4037. [Google Scholar] [CrossRef]
- Mahé, D.; Blanchard, P.; Truong, C.; Arnauld, C.; Le Cann, P.; Cariolet, R.; Madec, F.; Albina, E.; Jestin, A. Differential Recognition of ORF2 Protein from Type 1 and Type 2 Porcine Circoviruses and Identification of Immunorelevant Epitopes. J. Gen. Virol. 2000, 81, 1815–1824. [Google Scholar] [CrossRef]
- Lekcharoensuk, P.; Morozov, I.; Paul, P.S.; Thangthumniyom, N.; Wajjawalku, W.; Meng, X.J. Epitope Mapping of the Major Capsid Protein of Type 2 Porcine Circovirus (PCV2) by Using Chimeric PCV1 and PCV2. J. Virol. 2004, 78, 8135–8145. [Google Scholar] [CrossRef]
- Shang, S.-B.; Jin, Y.-L.; Jiang, X.; Zhou, J.-Y.; Zhang, X.; Xing, G.; He, J.L.; Yan, Y. Fine Mapping of Antigenic Epitopes on Capsid Proteins of Porcine Circovirus, and Antigenic Phenotype of Porcine Circovirus Type 2. Mol. Immunol. 2009, 46, 327–334. [Google Scholar] [CrossRef]
- Hung, L.-C.; Cheng, I.-C. Versatile Carboxyl-Terminus of Capsid Protein of Porcine Circovirus Type 2 Were Recognized by Monoclonal Antibodies with Pluripotency of Binding. Mol. Immunol. 2017, 85, 100–110. [Google Scholar] [CrossRef]
- Saha, D.; Huang, L.; Bussalleu, E.; Lefebvre, D.J.; Fort, M.; Van Doorsselaere, J.; Nauwynck, H.J. Antigenic Subtyping and Epitopes’ Competition Analysis of Porcine Circovirus Type 2 Using Monoclonal Antibodies. Vet. Microbiol. 2012, 157, 13–22. [Google Scholar] [CrossRef]
- Trible, B.R.; Suddith, A.W.; Kerrigan, M.A.; Cino-Ozuna, A.G.; Hesse, R.A.; Rowland, R.R.R. Recognition of the Different Structural Forms of the Capsid Protein Determines the Outcome Following Infection with Porcine Circovirus Type 2. J. Virol. 2012, 86, 13508–13514. [Google Scholar] [CrossRef] [PubMed]
- Trible, B.R.; Ramirez, A.; Suddith, A.; Fuller, A.; Kerrigan, M.; Hesse, R.; Nietfeld, J.; Guo, B.; Thacker, E.; Rowland, R.R.R. Antibody Responses Following Vaccination versus Infection in a Porcine Circovirus-Type 2 (PCV2) Disease Model Show Distinct Differences in Virus Neutralization and Epitope Recognition. Vaccine 2012, 30, 4079–4085. [Google Scholar] [CrossRef] [PubMed]
- Ilha, M.; Nara, P.; Ramamoorthy, S. Early Antibody Responses Map to Non-Protective, PCV2 Capsid Protein Epitopes. Virology 2020, 540, 23–29. [Google Scholar] [CrossRef]
- Jeong, J.; Park, C.; Kim, S.; Park, S.-J.; Kang, I.; Park, K.H.; Chae, C. Evaluation of the Efficacy of a Novel Porcine Circovirus Type 2 Synthetic Peptide Vaccine. Can. J. Vet. Res. 2018, 82, 146–153. [Google Scholar] [PubMed]
- Jung, B.-K.; Kim, H.-R.; Jang, H.; Chang, K.-S. Replacing the Decoy Epitope of PCV2 Capsid Protein with Epitopes of GP3 and/or GP5 of PRRSV Enhances the Immunogenicity of Bivalent Vaccines in Mice. J. Virol. Methods 2020, 284, 113928. [Google Scholar] [CrossRef]
- Kim, K.; Shin, M.; Hahn, T.-W. Deletion of a Decoy Epitope in Porcine Circovirus 2 (PCV2) Capsid Protein Affects the Protective Immune Response in Mice. Arch. Virol. 2020, 165, 2829–2835. [Google Scholar] [CrossRef]
- Rakibuzzaman, A.; Kolyvushko, O.; Singh, G.; Nara, P.; Piñeyro, P.; Leclerc, E.; Pillatzki, A.; Ramamoorthy, S. Targeted Alteration of Antibody-Based Immunodominance Enhances the Heterosubtypic Immunity of an Experimental PCV2 Vaccine. Vaccines 2020, 8, 506. [Google Scholar] [CrossRef] [PubMed]
- Hung, L.-C.; Yang, C.-Y.; Cheng, I.-C. Peptides Mimicking Viral Proteins of Porcine Circovirus Type 2 Were Profiled by the Spectrum of Mouse Anti-PCV2 Antibodies. BMC Immunol. 2017, 18, 25. [Google Scholar] [CrossRef] [PubMed]
- Afghah, Z.; Webb, B.; Meng, X.-J.; Ramamoorthy, S. Ten Years of PCV2 Vaccines and Vaccination: Is Eradication a Possibility? Vet. Microbiol. 2017, 206, 21–28. [Google Scholar] [CrossRef] [PubMed]
- Patterson, A.R.; Johnson, J.; Ramamoorthy, S.; Meng, X.-J.; Halbur, P.G.; Opriessnig, T. Comparison of Three Enzyme-Linked Immunosorbent Assays to Detect Porcine Circovirus-2 (PCV-2)-Specific Antibodies after Vaccination or Inoculation of Pigs with Distinct PCV-1 or PCV-2 Isolates. J. Vet. Diagn. Investig. 2008, 20, 744–751. [Google Scholar] [CrossRef]
- Hung, L.-C.; Huang, Y.-H.; Lai, Y.-S.; Lee, W.-C.; Wang, C.; Lin, Y.-L.; Cheng, I.-C. Humoral Immunity of TLRI Black Pig and the Effect of PCV2 Subunit Vaccination into It. J. Chin. Soc. Anim. Sci. 2016, 45, 241–257. [Google Scholar]
- Chen, Q.; Rong, J.; Li, G.; Xu, B.; Wang, X.; Hu, J.; Rong, M.; Li, H. Establishment of a Rep’ Protein Antibody Detection Method to Distinguish Natural Infection with PCV2 from Subunit Vaccine Immunization. J. Med. Microbiol. 2020, 69, 1183–1196. [Google Scholar] [CrossRef]
- Trible, B.R.; Kerrigan, M.; Crossland, N.; Potter, M.; Faaberg, K.; Hesse, R.; Rowland, R.R.R. Antibody Recognition of Porcine Circovirus Type 2 Capsid Protein Epitopes after Vaccination, Infection, and Disease. Clin. Vaccine Immunol. 2011, 18, 749–757. [Google Scholar] [CrossRef]
- Trible, B.R.; Rowland, R.R.R. Genetic Variation of Porcine Circovirus Type 2 (PCV2) and Its Relevance to Vaccination, Pathogenesis and Diagnosis. Virus Res. 2012, 164, 68–77. [Google Scholar] [CrossRef]
- Neurath, A.R.; Strick, N.; Lee, E.S. B Cell Epitope Mapping of Human Immunodeficiency Virus Envelope Glycoproteins with Long (19- to 36-Residue) Synthetic Peptides. J. Gen. Virol. 1990, 71 Pt 1, 85–95. [Google Scholar] [CrossRef]
- Gillet, L.; May, J.S.; Colaco, S.; Stevenson, P.G. The Murine Gammaherpesvirus-68 Gp150 Acts as an Immunogenic Decoy to Limit Virion Neutralization. PLoS ONE 2007, 2, e705. [Google Scholar] [CrossRef]
- Ostrowski, M.; Galeota, J.A.; Jar, A.M.; Platt, K.B.; Osorio, F.A.; Lopez, O.J. Identification of Neutralizing and Nonneutralizing Epitopes in the Porcine Reproductive and Respiratory Syndrome Virus GP5 Ectodomain. J. Virol. 2002, 76, 4241–4250. [Google Scholar] [CrossRef]
- Hoffman, B.E.; Herzog, R.W. Covert Warfare against the Immune System: Decoy Capsids, Stealth Genomes, and Suppressors. Mol. Ther. 2013, 21, 1648–1650. [Google Scholar] [CrossRef]
- Zhan, Y.; Yu, W.; Cai, X.; Lei, X.; Lei, H.; Wang, A.; Sun, Y.; Wang, N.; Deng, Z.; Yang, Y. The Carboxyl Terminus of the Porcine Circovirus Type 2 Capsid Protein Is Critical to Virus-Like Particle Assembly, Cell Entry, and Propagation. J. Virol. 2020, 94, e00042-20. [Google Scholar] [CrossRef]
- Liu, Z.; Guo, F.; Wang, F.; Li, T.; Jiang, W. 2.9 Å Resolution Cryo-EM 3D Reconstruction of Close-Packed Virus Particles. Structure 2016, 24, 319–328. [Google Scholar] [CrossRef]
- Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Couch, G.S.; Greenblatt, D.M.; Meng, E.C.; Ferrin, T.E. UCSF Chimera--a Visualization System for Exploratory Research and Analysis. J. Comput. Chem. 2004, 25, 1605–1612. [Google Scholar] [CrossRef]
- Hung, L.-C. The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells. Viruses 2020, 12, 961. [Google Scholar] [CrossRef]
- Dvorak, C.M.T.; Yang, Y.; Haley, C.; Sharma, N.; Murtaugh, M.P. National Reduction in Porcine Circovirus Type 2 Prevalence Following Introduction of Vaccination. Vet. Microbiol. 2016, 189, 86–90. [Google Scholar] [CrossRef]
- Opriessnig, T.; Xiao, C.-T.; Halbur, P.G.; Gerber, P.F.; Matzinger, S.R.; Meng, X.-J. A Commercial Porcine Circovirus (PCV) Type 2a-Based Vaccine Reduces PCV2d Viremia and Shedding and Prevents PCV2d Transmission to Naïve Pigs under Experimental Conditions. Vaccine 2017, 35, 248–254. [Google Scholar] [CrossRef]
- Kim, K.; Hahn, T.-W. Evaluation of Novel Recombinant Porcine Circovirus Type 2d (PCV2d) Vaccine in Pigs Naturally Infected with PCV2d. Vaccine 2021, 39, 529–535. [Google Scholar] [CrossRef]
- Khayat, R.; Brunn, N.; Speir, J.A.; Hardham, J.M.; Ankenbauer, R.G.; Schneemann, A.; Johnson, J.E. The 2.3-Angstrom Structure of Porcine Circovirus 2. J. Virol. 2011, 85, 7856–7862. [Google Scholar] [CrossRef]
- Jin, J.; Park, C.; Cho, S.-H.; Chung, J. The Level of Decoy Epitope in PCV2 Vaccine Affects the Neutralizing Activity of Sera in the Immunized Animals. Biochem. Biophys. Res. Commun. 2018, 496, 846–851. [Google Scholar] [CrossRef] [PubMed]





| Name | PCV Type | Position | Peptide Sequence |
|---|---|---|---|
| P29 | 2 | 215–224 | VTMYVQFREF |
| P30 | 2b | 225–233 | NLKDPPLNP |
| P39 | 2 | 220–229 | QFREFNLKDP |
| P47 | 2a | 225–233 | NLKDPPLKP |
| P51 | 2b | 222–233 | REFNLKDPPLNP |
| P52 | 2 | 225–231 | NLKDPPL |
| P53 | 2 | 225–230 | NLKDPP |
| P54 | 2 | 226–229 | LKDP |
| P55 | 2b | 230–233 | PLNP |
| P57 | 2 | 222–231 | REFNLKDPPL |
| P58 | 2b | 221–232 | FREFNLKDPPLN |
| P59 | 2b | 227–233 | KDPPLNP |
| P62 | 2b | 228–233 | DPPLNP |
| P63 | 2b | 229–233 | PPLNP |
| P64 | 2a | 205–233 | CSKYDQDYNIRVTMYVQFREFNLKDPPLKP |
| P65 | 2a | 228–233 | DPPLKP |
| P66 | 2b-1c | 228–234 | DPPLKPK |
| P67 | 2d | 228–234 | DPPLNPK |
| P68 | 2d | 227–234 | KDPPLNPK |
| P71 | 2a | 227–233 | KDPPLKP |
| P72 | 2b-1c | 227–234 | KDPPLKPK |
| P73 | 2a | 226–233 | LKDPPLKP |
| P74 | 2b-1c | 225–234 | NLKDPPLKPK |
| P77 | 2a | 205–214 | SKYDQDYNIR |
| P78 | 2a | 210–219 | DYNIRVTMYV |
| P79 | 2 | 219–228 | VQFREFNLKD |
| P80 | 2 | 218–227 | YVQFREFNLK |
| P81 | 1 | 219–230 | VQFREFILKDP |
| P82 | 2 | 220–227 | QFREFNLK |
| P83 | 2 | 217–226 | MYVQFREFNL |
| P84 | 2a | 229–233 | PPLKP |
| P85 | 2a | 229–233 | PLKP |
| P86 | 2a | 205–222 | SKYDQDYNIRVTMYVQFR |
| P88 | 2 | 220–226 | QFREFNL |
| P89 | 2 | 220–225 | QFREFN |
| P92 | 1 | 215–233 | RLTIYVQFREFILKDPLNK |
| P97 | 2a | 220–233 | QFREFNLKDPPLKP |
| P98 | 2a | 223–233 | EFNLKDPPLKP |
| P106 | 2a | 215–233 | VTMYVQFREFNLKDPPLKP |
| P107 | 2b | 215–233 | VTMYVQFREFNLKDPPLNP |
| P108 | 2a | 210–233 | DYNIRVTMYVQFREFNLKDPPLKP |
| Name | PCV Type | Position | Peptide Sequence |
|---|---|---|---|
| C1 | 2b | ORF2(59–86) | CRTTVKTPSWAVDMMRFNINDFLPPGGGS |
| C2 | 2b | ORF2(108–137) | CSPITQGDRGVGSSAVILDDNFVTKATALT |
| C3 | 2b | ORF2(195–233) | CHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPLNP |
| N1 | 2b | ORF3(35–66) | CHNDVYISLPITLLHFPAHFQKFSQPAEISDKR |
| N2 | 2 | ORF6 protein | CMASSTPASPAPSDILSSEPQSERPPGRWT |
| N3 | 2 | ORF9 protein | MGLGSASSILLAGHVAAEVLPRCCRCRSALVILTAHFFRFQI |
| P24 | 2b | ORF2(59–68) | RTTVKTPSWA |
| P25 | 2b | ORF2(69–78) | VDMMRFNIND |
| P26 | 2b | ORF2(79–86) | FLPPGGGS |
| P27 | 2b | ORF2(195–204) | HVGLGTAFEN |
| P60 | 2b | ORF2(195–207) | CHVGLGTAFENSIY |
| P69 | 2b | ORF3(45–66) | TLLHFPAHFQKFSQPAEISDKR |
| P70 | 2b | ORF3(72–92) | CNGHQTPALQQGTHSSRQVTP |
| P75 | 2b | ORF3(40–59) | ISLPITLLHFPAHFQKFSQP |
| P93 | 2b | ORF2(169–180) | STIDYFQPNNKR |
| P99 | 2 | ORF2(26–36) | RPWLVHPRHRY |
| P100 | 2 | ORF2(47–58) | TRLSRTFGYTVK |
| P101 | 2 | ORF2(132–146) | KATALTYDPYVNYSS |
| P102 | 2 | ORF2(92–107) | PFEYYRIRKVKVEFWP |
| P103 | 2b | ORF2(117–131) | GVGSSAVILDDNFVT |
| P104 | 2 | ORF2(156–162) | YHSRYFT |
| P105 | 2 | ORF2(165–185) | PVLDSTIDYFQPNNKRNQLWL |
| P114 | 2 | ORF10 protein | CMSTAQEGVLTVVALTVYPKVRERRVLKMPFFLLQR |
| P115 | 2 | ORF11 protein | CMNNKNHYEVIKKTQ |
| P119 | 2b | ORF2(220–233) | QFREFNLKDPPLNP |
| P120 | 2 | ORF7 protein | CMAAGAVSSSAVTPPWIRHS |
| P121 | 2 | ORF8 protein | CMDIDHTVSVDHPTAASHKSHQ |
| P122 | 2a | ORF2(224–232) | NLKDPPLK |
| P126 | 2b | ORF3(35–66) | HNDVYISLPITLLHFPAHFQKFSQPAEISDKR |
| P127 | 2a | ORF2(51–65) | RTFGYTVKATTVRTP |
| P128 | 2b | ORF2(72–85) | MRFNINDFVPPGGG |
| P129 | 2a | ORF2(127–137) | DNFVTKATALT |
| P130 | 2a | ORF2(166–173) | VLDSTIDY |
| P131 | 2a | ORF2(186–191) | RLQTSA |
| mAb | Heavy Chain | Light Chain | ELISA * | IFA # | Minimal Linear Epitope | ||
|---|---|---|---|---|---|---|---|
| PCV2a Peptide P64 | PCV2b Peptide C3 | VLP | PCV2 FA Substrate Slide | PCV2a/PCV2b Peptide | |||
| 3H11 | IgG2a | κ | +++++ | +++++ | + | + | PPLKP/DPPLNP |
| 4C9 | IgG1 | κ | +++++ | − | − | + | − |
| 4F6 | IgG1 | κ | +++++ | ++++ | − | − | QFREFNLK |
| 4H9 | IgG1 | κ | +++++ | − | − | + | − |
| 6E3 | IgG2b | κ | +++++ | − | − | − | − |
| 6H11 | IgG2b | κ | +++++ | +++++ | ++ | + | PPLKP/PPLNP |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the author. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hung, L.-C. Carboxyl-Terminal Decoy Epitopes in the Capsid Protein of Porcine Circovirus Type 2 Are Immunogenicity-Enhancers That Elicit Predominantly Specific Antibodies in Non-Vaccinated Pigs. Viruses 2022, 14, 2373. https://doi.org/10.3390/v14112373
Hung L-C. Carboxyl-Terminal Decoy Epitopes in the Capsid Protein of Porcine Circovirus Type 2 Are Immunogenicity-Enhancers That Elicit Predominantly Specific Antibodies in Non-Vaccinated Pigs. Viruses. 2022; 14(11):2373. https://doi.org/10.3390/v14112373
Chicago/Turabian StyleHung, Ling-Chu. 2022. "Carboxyl-Terminal Decoy Epitopes in the Capsid Protein of Porcine Circovirus Type 2 Are Immunogenicity-Enhancers That Elicit Predominantly Specific Antibodies in Non-Vaccinated Pigs" Viruses 14, no. 11: 2373. https://doi.org/10.3390/v14112373
APA StyleHung, L.-C. (2022). Carboxyl-Terminal Decoy Epitopes in the Capsid Protein of Porcine Circovirus Type 2 Are Immunogenicity-Enhancers That Elicit Predominantly Specific Antibodies in Non-Vaccinated Pigs. Viruses, 14(11), 2373. https://doi.org/10.3390/v14112373
