Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature
Abstract
1. Introduction
2. Detailed Case Description
3. Discussion
4. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
Abbreviations
pseudo-HTG | Pseudohypertriglyceridemia |
TG | triglyceride |
GKD | glycerol kinase deficiency |
DKA | diabetic ketoacidosis |
LPL | lipoprotein lipase |
GK | glycerate kinase |
VLDL | very-low-density lipoprotein |
GPO-POD | glycerol-phosphoric acid oxidase peroxidase |
References
- Backes, J.M.; Dayspring, T.D.; Hoefner, D.M.; Contois, J.H.; McConnell, J.P.; Moriarty, P.M. Identifying pseudohypertriglyceridemia in clinical practice. Clin. Lipidol. 2014, 9, 625–641. [Google Scholar] [CrossRef]
- Fu, X.; Williamson, C.P.; Bosfield, K. Pseudo-hypertriglyceridemia in a 2-year-old male with global developmental delay, myopathy and adrenal hypoplasia. J. Mass. Spectrom. Adv. Clin. Lab. 2024, 32, 47–49. [Google Scholar] [CrossRef]
- Lamiquiz-Moneo, I.; Mateo-Gallego, R.; Fernandez-Pardo, J.; Lopez-Arino, C.; Marco-Benedi, V.; Bea, A.M.; Ferraro, L.; Jarauta, E.; Cenarro, A.; Civeira, F. Glycerol kinase deficiency in adults: Description of 4 novel cases, systematic review and development of a clinical diagnostic score. Atherosclerosis 2020, 315, 24–32. [Google Scholar] [CrossRef]
- Farooq, A.; Treml, A.; Colon-Franco, J.M. A Woman with Pancreatitis and Hypertriglyceridemia. Clin. Chem. 2019, 65, 1216–1218. [Google Scholar] [CrossRef]
- Rajagopal, R.; Srinivasan, M. Oral Glycerol Ingestion Causes Pseudohypertriglyceridemia. Am. J. Med. 2017, 130, e543–e544. [Google Scholar] [CrossRef]
- Nauck, M.; Winkler, K.; Siekmeier, R.; Marangos, N.; Richter, B.; Marz, W.; Wieland, H. Pseudo-pseudohypertriglyceridemia: A case of increased free glycerol without evidence for glycerol kinase deficiency. Clin. Chem. 1995, 41, 619–620. [Google Scholar] [CrossRef]
- Speeckaert, M.M.; Segers, H.; Van Biesen, W.; Verstraete, A.; Langlois, M.R.; Delanghe, J.R. An unusual case of (pseudo)hypertriglyceridaemia. NDT Plus 2010, 3, 570–572. [Google Scholar] [CrossRef]
- Backes, J.M.; Dayspring, T.; Mieras, T.; Moriarty, P.M. Pseudohypertriglyceridemia: Two cases of probable glycerol kinase deficiency. J. Clin. Lipidol. 2012, 6, 469–473. [Google Scholar] [CrossRef]
- Arrobas-Velilla, T.; Mondejar-Garcia, R.; Gomez-Gerique, J.A.; Canizares Diaz, I.; Cruz Mengibar, M.C.; Orive de Diego, A.; Fabiani-Romero, F. Pseudo-hypertriglyceridaemia or hyperglycerolemia? Clin. Investig. Arterioscler. 2013, 25, 123–126. [Google Scholar] [CrossRef]
- Backes, J.M.; Dayspring, T.; Moriarty, P.M. Pseudohypertriglyceridemia-verifying the hypertriglyceridemic patient. J. Clin. Lipidol. 2013, 7, 182–183. [Google Scholar] [CrossRef]
- Backes, J.M.; Dayspring, T.D.; Hoefner, D.M.; Moriarty, P.M. Hypertriglyceridaemia unresponsive to multiple treatments. BMJ Case Rep. 2015, 2015, bcr2015210788. [Google Scholar] [CrossRef]
- Arranz, N.; Fernandez, S.; Bastida, C. Use of insulin and heparin in the management of severe hypertriglyceridemia in a critically ill patient. Med. Clin. 2022, 159, e81–e82. [Google Scholar] [CrossRef]
- Coskun, A.; Erkan, N.; Yakan, S.; Yildirim, M.; Carti, E.; Ucar, D.; Oymaci, E. Treatment of hypertriglyceridemia-induced acute pancreatitis with insulin. Prz. Gastroenterol. 2015, 10, 18–22. [Google Scholar] [CrossRef]
- Valdivielso, P.; Ramirez-Bueno, A.; Ewald, N. Current knowledge of hypertriglyceridemic pancreatitis. Eur. J. Intern. Med. 2014, 25, 689–694. [Google Scholar] [CrossRef]
- Jain, P.; Rai, R.R.; Udawat, H.; Nijhawan, S.; Mathur, A. Insulin and heparin in treatment of hypertriglyceridemia-induced pancreatitis. World J. Gastroenterol. 2007, 13, 2642–2643. [Google Scholar] [CrossRef]
- Ahern, B.J.; Yi, H.J.; Somma, C.L. Hypertriglyceridemia-Induced Pancreatitis and a Lipemic Blood Sample: A Case Report and Brief Clinical Review. J. Emerg. Nurs. 2022, 48, 455–459. [Google Scholar] [CrossRef]
- van Heerden, C.; Magwete, A.; Mabuza, D. Evaluating the need for free glycerol blanking for serum triglyceride measurements at Charlotte Maxeke Johannesburg Academic Hospital. Clin. Chem. Lab. Med. 2020, 58, 1257–1264. [Google Scholar] [CrossRef]
- Swanson, M.A.; Garcia, S.M.; Spector, E.; Kronquist, K.; Creadon-Swindell, G.; Walter, M.; Christensen, E.; Van Hove, J.L.K.; Sass, J.O. d-Glyceric aciduria does not cause nonketotic hyperglycinemia: A historic co-occurrence. Mol. Genet. Metab. 2017, 121, 80–82. [Google Scholar] [CrossRef]
- Sambeat, A.; Ratajczak, J.; Joffraud, M.; Sanchez-Garcia, J.L.; Giner, M.P.; Valsesia, A.; Giroud-Gerbetant, J.; Valera-Alberni, M.; Cercillieux, A.; Boutant, M.; et al. Endogenous nicotinamide riboside metabolism protects against diet-induced liver damage. Nat. Commun. 2019, 10, 4291. [Google Scholar] [CrossRef]
- Singla, A.A.; Ting, F.; Singla, A. Acute pancreatitis secondary to diabetic ketoacidosis induced hypertriglyceridemia in a young adult with undiagnosed type 2 diabetes. JOP 2015, 16, 201–204. [Google Scholar] [CrossRef]
- Nair, S.; Pitchumoni, C.S. Diabetic ketoacidosis, hyperlipidemia, and acute pancreatitis: The enigmatic triangle. Am. J. Gastroenterol. 1997, 92, 1560–1561. [Google Scholar]
- McGarry, J.D.; Woeltje, K.F.; Kuwajima, M.; Foster, D.W. Regulation of ketogenesis and the renaissance of carnitine palmitoyltransferase. Diabetes Metab. Rev. 1989, 5, 271–284. [Google Scholar] [CrossRef]
- Dhatariya, K.K.; Glaser, N.S.; Codner, E.; Umpierrez, G.E. Diabetic ketoacidosis. Nat. Rev. Dis. Primers 2020, 6, 40. [Google Scholar] [CrossRef]
- Robergs, R.A.; Griffin, S.E. Glycerol. Biochemistry, pharmacokinetics and clinical and practical applications. Sports Med. 1998, 26, 145–167. [Google Scholar] [CrossRef]
- Al Riyami, N.B.; Frohlich, J. Extreme hypertriglyceridemia following intravenous heparin infusion. Clin. Biochem. 2008, 41, 907–909. [Google Scholar] [CrossRef]
- Guo, Y.Y.; Li, H.X.; Zhang, Y.; He, W.H. Hypertriglyceridemia-induced acute pancreatitis: Progress on disease mechanisms and treatment modalities. Discov. Med. 2019, 27, 101–109. [Google Scholar]
- Nasstrom, B.; Stegmayr, B.G.; Olivecrona, G.; Olivecrona, T. Lower plasma levels of lipoprotein lipase after infusion of low molecular weight heparin than after administration of conventional heparin indicate more rapid catabolism of the enzyme. J. Lab. Clin. Med. 2003, 142, 90–99. [Google Scholar] [CrossRef]
- Charoenhirunyingyos, W.; Vannasaeng, S. Pseudohypertriglyceridemia from oral glycerine. J. Med. Assoc. Thai 2010, 93, 870–872. [Google Scholar]
Parameter | Value | Reference Range |
---|---|---|
TG (GPO-POD) | 22.85 mmol/L (928.86 mg/dL) | <1.70 mmol/L (69.11 mg/dL) |
TG (glycerol-corrected) | 2.54 mmol/L (103.25 mg/dL) | / |
Glycerol, calculated | 20.31 mmol/L (785.18 mg/dL) | / |
VLDL-C (TG/5) | 4.57 mmol/L (203.25 mg/dL) | / |
LDL-C | 0.97 mmol/L (37.51 mg/dL) | 1.89–4.21 mmol/L (73.09–162.80 mg/dL) |
HDL-C | 0.68 mmol/L (26.29 mg/dL) | 1.02–1.55 mmol/L (39.44–59.94 mg/dL) |
Cholesterol | 1.80 mmol/L (69.61 mg/dL) | 3.00–5.70 mmol/L (171.6–326.04 mg/dL) |
Authors | Year | Age/Sex | BMI (kg/m2) | Medical History | Family History of HTG | Alcohol Use/Abuse | Clinical Characteristics | TG Level (mg/dL) | G-C TG Level (mg/dL) | Glycerol Level (mg/dL) | Serum Sample |
---|---|---|---|---|---|---|---|---|---|---|---|
Nauck M et al. [6] | 1995 | 43/M | NA | a loss of hearing of the left ear; hypertension | NA | No | HTG with little response to therapy; healthy | 2398 | NA | 158 | clear |
Speeckaert MM et al. [7] | 2010 | 57/M | NA | ESRD; autosomal dominant polycystic kidney disease | No | 4 drinks weekly | intake of glycerol-containing beer; a reduced glycerol clearance | 996 | NA | 228 | NA |
Backes JM et al. [8] | 2012 | 46/M | 22 | osteopenia secondary to hypercalciuria | No | 2 ounces, 2–3 times weekly | HTG with little response to therapy; periodic TG levels reported as normal | 405 to 552 | 88 | NA | clear |
Backes JM et al. [8] | 2012 | 58/M | 26 | hypertension | No | No | HTG with little response to therapy; periodic TG levels reported as normal | 381 | NA | NA | clear |
Arrobas-Velilla et al. [9] | 2013 | 21/M | normal | none | cardiovascular disease | No | HTG with little response to fibrates | 497–638 | NA | 370 | clear |
Backes JM et al. [10] | 2013 | 60/M | 27 | none | NA | 1–2 alcoholic drinks daily | HTG little response to therapy; healthy | 488 to 532 | 49 | NA | clear |
Backes JM et al. [10] | 2013 | 54/M | 21 | none | NA | No | HTG with little response to therapy; healthy | 368 to 538 | 114 | NA | clear |
Backes JM et al. [11] | 2015 | 52/M | NA | hypertension; a cerebral vascular accident | No | 2 beers daily | HTG unresponsive to multiple treatments | 552 to 695 | 62 | NA | clear |
Rajagopal R et al. [5] | 2017 | 56/F | NA | T2DM; hypertension | No | 3 to 4 cocktails daily | drank glycerol sometimes | 1110 | NA | NA | NA |
Farooq A et al. [4] | 2019 | NA/F | NA | pancreatitis; T1DM; hypertension; ESRD; hypothyroidism; CHF | No | No | HTG with little response to therapy; ingestion of soap; impaired renal function | 6620 | 151 | 6469 | clear |
Our case | 2025 | 46/M | 33.12 | pancreatitis; T2DM | No | No | HTG unresponsive to multiple treatments; impaired renal function | 928.86 | 103.25 | 785.18 | clear |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Zhu, J.; Zhang, C.; Zhao, R. Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases 2025, 13, 29. https://doi.org/10.3390/diseases13020029
Zhu J, Zhang C, Zhao R. Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases. 2025; 13(2):29. https://doi.org/10.3390/diseases13020029
Chicago/Turabian StyleZhu, Jianping, Chunjuan Zhang, and Rui Zhao. 2025. "Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature" Diseases 13, no. 2: 29. https://doi.org/10.3390/diseases13020029
APA StyleZhu, J., Zhang, C., & Zhao, R. (2025). Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases, 13(2), 29. https://doi.org/10.3390/diseases13020029