Next Article in Journal
Bioprospecting Cultivated Tropical Green Algae, Caulerpa racemosa (Forsskal) J. Agardh: A Perspective on Nutritional Properties, Antioxidative Capacity and Anti-Diabetic Potential
Next Article in Special Issue
Peptide–Mineral Complexes: Understanding Their Chemical Interactions, Bioavailability, and Potential Application in Mitigating Micronutrient Deficiency
Previous Article in Journal
Production and Properties of Starch Citrates—Current Research
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Chicken Egg White—Advancing from Food to Skin Health Therapy: Optimization of Hydrolysis Condition and Identification of Tyrosinase Inhibitor Peptides

Analytical Biochemistry Research Centre, Universiti Sains Malaysia, Penang 11800, Malaysia
*
Author to whom correspondence should be addressed.
Foods 2020, 9(9), 1312; https://doi.org/10.3390/foods9091312
Submission received: 27 August 2020 / Revised: 14 September 2020 / Accepted: 14 September 2020 / Published: 18 September 2020

Abstract

:
Active fragments (bioactive peptides) from the chicken egg white proteins were expected to exert tyrosinase inhibitory activities in which skin hyperpigmentation could be prevented. Egg white was hydrolyzed by trypsin, chymotrypsin and the combination of both enzymes. The enzyme treatments achieved >50% degree of hydrolysis (DH) at substrate-to-enzyme (S/E) ratio of 10–30 (w/w) and hydrolysis time of 2–5 h. A crossed D-optimal experimental design was then used to determine the optimal enzyme composition, S/E ratio and hydrolysis time in order to yield hydrolysates with strong monophenolase and diphenolase inhibitory activities. The optimized conditions 55% trypsin, 45% chymotrypsin, S/E 10:1 w/w and 2 h achieved 45.9% monophenolase activity inhibition whereas 100% trypsin, S/E 22.13:1 w/w and 3.18 h achieved 48.1% diphenolase activity inhibition. LC/MS and MS/MS analyses identified the peptide sequences and the subsequent screening had identified 7 peptides (ILELPFASGDLLML, GYSLGNWVCAAK, YFGYTGALRCLV, HIATNAVLFFGR, FMMFESQNKDLLFK, SGALHCLK and YFGYTGALR) as the potential inhibitor peptides. These peptides were able to bind to H85, H94, H259, H263, and H296 (hotspots for active residues) as well as F92, M280 and F292 (stabilizing residues) of tyrosinase based on structure-activity relationship analysis. These findings demonstrated the potential of egg white-derived bioactive peptides as skin health therapy.

Graphical Abstract

1. Introduction

The excess melanin production and deposition in the melanocytes and keratinocytes cause hyperpigmentation, leading to uneven skin tones. Tyrosinase (E.C. 1.14.18.1) plays a key role in melanin synthesis (melanogenesis) by catalyzing the rate-limiting hydroxylation of l-tyrosine to 3,4-dihydroxy-l-phenylalanine (l-DOPA) and the subsequent oxidation of l-DOPA to dopaquinone, via the monophenolase and diphenolase reactions, respectively [1]. The inhibition of tyrosinase using a nature-derived agent is hence of huge cosmeceutical demand, as some potent skin-lightening ingredients including hydroquinone and heavy metals have been ascribed with harmful side effects and banned for use in certain countries [2,3]. Since the discovery of a potential protein or peptide with tyrosinase inhibitory activity from lemon skin extract in 2006 [4], reports on peptide-based skin lightening agents has increased by leaps and bounds. The anti-pigmentation mechanisms of peptides include tyrosinase inhibition [5], copper chelation [6] and melanogenesis pathway regulation [7]. Peptide was also incorporated as an active ingredient in commercial skin lightening products such as β-WhiteTM (contains oligopeptide-68) and MelanostatineTM 5 (contains nonapeptide-1) marketed by Lucas Meyer Cosmetics. The emergence of bioactive peptides as a new class of therapeutic agent is nonetheless endowed by their relatively small size, low toxicity, fast clearance and high specificity in inhibiting protein-ligand interactions [8].
Anti-pigmentation peptides have been discovered from various natural protein sources including rice bran [6,9] and marine microalgae [10]. Yet, there has been no relevant study on the anti-pigmentation effect of chicken egg white-derived peptides, although this readily available protein has been traditionally used as facial masks to boost skin health. It should be also noted that the active fragments are usually encrypted in the parent protein and required to be released in order to exhibit higher rate of the bioactivity. Enzymatic hydrolysis was therefore employed in this study to release the bioactive peptides from the egg white. In addition, the hydrolysis conditions such as the enzyme used, enzyme composition, substrate-to-enzyme (S/E) ratio and hydrolysis time in order to produce egg white hydrolysates that exhibit the highest monophenolase and diphenolase inhibitory activities should be optimized using D-optimal experimental design. The crossed D-optimal approach conjugates the mixture component (enzyme composition) and process factors (S/E ratio and hydrolysis time) in a single experimental design and generates a relatively smaller number of experimental runs, which has made it more viable in terms of cost and time, especially when each variable comes with multiple levels [11]. In fact, crossed D-optimal design had been successfully implemented to optimize different hydrolysis conditions for other purposes [12,13]. Therefore, this technique was used in this study.
Enzymes used in this study were trypsin and chymotrypsin due to their specific cleavage preferences, i.e., trypsin selectively cleaves at the C-terminal of arginine and lysine [14] whereas chymotrypsin predominantly cleaves at the C-terminal of the aromatic phenylalanine, leucine, methionine, tryptophan and tyrosine [15]. The peptides released may thus fulfil the characteristics of strong tyrosinase inhibitors such as the presence of an aromatic C-terminal residue tyrosine, tryptophan or phenylalanine [9,16] or one or more arginine in combination with phenylalanine, valine, alanine and leucine in the peptide sequence as delineated by Schurink, van Berkel, Wichers and Boeriu [17]. Therefore, the objectives of present study were to determine the optimum hydrolysis conditions of egg white using trypsin and/or chymotrypsin that yield the protein hydrolysates with tyrosinase inhibitory activities followed by peptide sequence identification as well as to investigate the structure-activity relationship between the identified inhibitor peptides and tyrosinase.

2. Materials and Methods

2.1. Chemicals

Egg white powder was purchased from a local market (Penang, Malaysia). Trypsin (EC 3.4.21.4, 10,000 U/mg) and α-chymotrypsin (EC 3.4.21.1, 40 U/mg) from bovine pancreas, tyrosinase (EC 1.14.18.1, 7164 U/mg) from Agaricus bisporus were purchased from Sigma-Aldrich. Other chemicals and reagents used were of analytical grade and purchased from Sigma-Aldrich unless otherwise stated.

2.2. Enzymatic Hydrolysis of Egg White Proteins

The enzymatic hydrolysis of egg white was conducted according to the protocol of Miguel, Recio, Gomez-Ruiz, Ramos and Lopez-Fandino [18] with modifications. Briefly, egg white powder was dissolved in 0.05 M sodium phosphate buffer (pH 7.8 or 8.0, depending on the digestive enzyme used) to 5 mg/mL and boiled at 95 °C for 30 min. Subsequently, designated enzyme treatments at various substrate-to-enzyme (S/E) ratios were added to the substrate solution and incubated for different durations at 37 °C with constant shaking of 300 rpm. The details of the experiment will be elaborated in Section 2.2.1 and Section 2.2.2. The resultant hydrolysate was then boiled at 95 °C for 30 min to terminate the reaction and centrifuged at 4500× g for 15 min. The supernatant was collected and stored at −20 °C until further analysis. Heat-inactivated enzymes were used as the control treatment.

2.2.1. Single-Factor Experiment

The effects of enzyme composition, S/E ratio and hydrolysis time on the degree of hydrolysis (DH) and sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) protein band profiling of egg white hydrolysate were studied as preliminary work to investigate the hydrolysis condition required to produce sufficient peptides from egg white. Below are the details of the experiment:
The effect of enzyme composition was investigated based on the hydrolysis of egg white using designated enzyme treatments: 100% trypsin (T), 100% chymotrypsin (C), and 50% trypsin + 50% chymotrypsin (T+C). Phosphate buffer at pH 7.8 was used for T whereas pH 8.0 was used for C and T+C treatments. All these compositions were used for the investigations of the effects of S/E ratio and hydrolysis time. During the investigation of the effect of S/E ratio, the ratio of 10:1, 20:1, 30:1, 40:1 and 50:1 (w/w) were studied whereas the hydrolysis time was fixed at 3 h. On the other hand, 0.5, 1, 2, 3, 4 and 5 h were studied during the investigation of the effect of hydrolysis period and the S/E ratio fixed at 30:1 (w/w).
The DH of the hydrolysate was determined by measuring the soluble protein content in 10% trichloroacetic acid (TCA) (Fisher ChemicalsTM, Leicestershire, UK) according to the protocol of Baharuddin, Halim and Sarbon [19] with modifications. Briefly, the hydrolysate was dissolved in an equal volume of 20% TCA and incubated at room temperature for 30 min. The sample was then centrifuged at 3000× g for 10 min. The pellet was suspended in 0.5 mL 0.1 M NaOH and subjected to Bradford assay to determine the amount of soluble protein in the hydrolysate. Briefly, 5 µL of the hydrolysate was added with 250 µL of Bradford reagent and incubated at room temperature for 10 min. The absorbance was then measured at 595 nm using a spectrophotometer (Spectramax M5, Molecular Devices, San Jose, CA, USA). Each measurement was autozeroed against a blank containing Bradford reagent and 0.1 M NaOH. The DH was calculated using the following equation:
Degree   of   hydrolysis   ( % ) = A control A sample A control × 100
where Acontrol denotes the absorbance of the system containing Bradford reagent, NaOH and undigested egg white powder; Asample denotes the absorbance of the system containing Bradford reagent, NaOH and egg white hydrolysate.
To evaluate the protein profile after enzymatic hydrolysis, SDS-PAGE analysis was conducted using 4% stacking gel and 12% resolving gel. Briefly, 10 µL of sample was added with 10 µL 2× Laemmli buffer (Bio-Rad Laboratories Inc., Hercules, CA, USA) and 1 µL 2-mercaptolethanol followed by incubation at 95 °C for 15 min. Then, 10 µL of the mixture was loaded into the well and the set was run at 80 V for15 min followed by 120 V for 1 h. Opti-Protein XL Marker G266 (abm Inc., Richmond, BC, Canada) with a molecular weight range of 10 to 245 kDa was used as the standard protein marker. The gel was stained overnight using staining solution (50% ddH2O, 40% methanol, 10% acetic acid, 0.1% Coomassie Blue) and destained using destaining solution (50% ddH2O, 40% methanol, 10% acetic acid) until blue protein bands were visible against a clear background. The image of the gel was captured using Fujifilm LAS-3000 Imager (Fujifilm, Tokyo, Japan). The molecular weights of the protein bands were analyzed using Multi Gauge software version 3.0 (Fujifilm, Tokyo, Japan).

2.2.2. Optimization of Hydrolysis Conditions for Monophenolase and Diphenolase Inhibitory Activities

Crossed D-optimal design was used to optimize the hydrolysis parameters to yield egg white hydrolysates with the highest tyrosinase inhibitory activities (i.e., the monophenolase inhibitory activity (Y) and diphenolase inhibitory activity (Z)). The enzyme composition (trypsin, X1; chymotrypsin, X2) represents the mixture component whereas S/E ratio (X3) and hydrolysis time (X4) represents the process factors. Based on the results of single-factor experiment (Section 2.2.1), the levels of the variables were chosen and coded, as shown in Table 1. These variables generated 28 experimental runs. Data analysis and calculation of predicted response were conducted using Design-Expert software (version 6.0, Minneapolis, MN, USA). Five confirmation experiments were performed to verify the optimized condition.

2.3. Determination of Tyrosinase Inhibitory Activities

2.3.1. Monophenolase Inhibitory Activity

The monophenolase inhibitory activity was performed according to Takahashi, Takara, Toyozato and Wada [20] with slight modifications. Briefly, 10 µL of sample and 180 µL of 50 mM potassium phosphate buffer (pH 6.8) containing 0.5 mM l-tyrosine were added to a 96-well plate and incubated at 30 °C for 10 min. The reaction was started by the addition of 1 µL tyrosinase (6250 U/mL) and immediately monitored at 470 nm at every 20 s for 15 min with a constant temperature of 30 °C throughout the reaction. Each measurement was autozeroed against a blank containing l-tyrosine. The monophenolase inhibitory activity is calculated as follows:
Monophenolase   inhibitory   activity   ( % ) = A control A sample A control × 100
where Acontrol denotes the absorbance of the system containing tyrosinase and l-tyrosine; Asample denotes the absorbance of the system containing tyrosinase, l-tyrosine and sample.

2.3.2. Diphenolase Inhibitory Activity

The diphenolase inhibitory activity was performed according to Takahashi, Takara, Toyozato and Wada [20] with slight modifications. Briefly, 10µL of sample and 180 µL of 50 mM potassium phosphate buffer (pH 6.8) containing 0.5 mM l-DOPA were added to a 96-well plate and incubated at 30 °C for 10 min. The reaction was started by the addition of 1 µL tyrosinase (6250 U/mL) and immediately monitored at 470 nm at every 10 s for 1 min with constant temperature 30 °C throughout the reaction. Each measurement was autozeroed against a blank containing l-DOPA. The diphenolase inhibitory activity is calculated as follows:
Diphenolase   inhibitory   activity   ( % ) = A control A sample A control × 100
where Acontrol denotes the absorbance of the system containing tyrosinase and l-DOPA; Asample denotes the absorbance of the system containing tyrosinase, l-DOPA and sample.

2.4. Identification of Bioactive Peptides

The samples produced using the optimized parameters (Section 2.2.2) were subjected to LC/MS and MS/MS analyses using Easy-nLC II system (Thermo Scientific, San Jose, CA, USA) coupled with LTQ Orbitrap Velos. The chromatographic separation and mass spectrometry (MS) parameters were set up according to Siow and Gan [21]. Data acquisition was conducted using Xcalibur version 2.1. Peptide sequencing and identification based on the spectra acquired were performed using PEAKS Studio version 7.5 (Bioinformatics Solutions Inc., Waterloo, ON, Canada) [22]. The error mass tolerance allowed for precursor and fragmented ions were 0.1 and 0.8 Da, respectively. Enzyme was not specified in the peaks search against SwissProt2019 database and the false discovery rate (FDR) was estimated with decoy-fusion method. PeptideRanker web server (http://bioware.ucd.ie/, accessed on 6th July 2020) was used to screen for potential biologically active peptides where peptides with PeptideRanker score >0.5 were considered potentially active [23] and hence selected for further analysis. Protein-peptide docking was then performed using PepSite 2 web server (http://pepsite2.russelllab.org/, accessed on 7th July 2020) to predict the potential peptide binding sites on the protein molecule [24]. The server requires inputs for a protein structure in pdb format and a peptide sequence for prediction. The three-dimensional crystal structure of mushroom tyrosinase (PDB ID: 2Y9X) was obtained from the RCSB Protein Data Bank (PDB) at https://www.rcsb.org/ (accessed on 10th July). For peptide sequence input, peptides with >10 residues were split into equal portions since the maximum size of peptide accepted by PepSite 2 server was 10 residues. The predicted protein–peptide binding spots were ranked according to statistical significance where a p-value < 0.25 implies significant binding interaction.

2.5. Statistical Analysis

The study was performed in replicates. Statistical analysis was conducted using SPSS version 20.0 (SPSS Institute, Chicago, IL, USA). The results were analyzed using one-way ANOVA. p-value less than 0.05 implies a significant difference between sample means. T-test was conducted to analyze the significant (p < 0.05) difference between the experimental and predicted results for model validation.

3. Results and Discussion

3.1. Single-Factor Experiment

The SDS-PAGE profile of the protein bands after enzymatic hydrolysis using different enzyme compositions, S/E ratios and hydrolysis times was shown in Figure 1. Generally, protein bands with MW ranging from 11–48 kDa and >245 kDa were observed in control treatments (L1). According to Abdou, Kim and Sato [25], the possible egg white proteins within or near the molecular weight range include ovomucin (230–8300 kDa), ovomacroglobulin (760–900 kDa), ovotransferrin (77.7 kDa), avidin (60 kDa), ovoinhibitor (49 kDa), ovoglobulin G3 (45 kDa), ovalbumin (44.5 kDa), ovoflavoprotein (32–36 kDa), ovoglobulin G2 (36 kDa), ovomucoid (28 kDa), ovoglycoprotein (24.4 kDa), lysozyme (14.4 kDa) and cystatin (12.7 kDa). Ovalbumin-related protein X and Y, on the other hand, share similar molecular weight of 50 kDa [26,27]. Notably, the >245 kDa bands were absent after enzymatic hydrolysis, suggesting the successful cleavage of large molecular weight proteins ovomucin and ovomacroglobulin into smaller protein fragments. For T treatment, the protein bands observed after hydrolysis were <17 kDa (Figure 1a). An 11–17 kDa band was observed at t = 0.5 and 1 h (Figure 1a, Lane 2 and 3) which is likely due to the presence of either lysozyme, cystatin or a subunit (15.6 kDa) of the tetrameric avidin. Protein bands of >25 kDa were also absent as the S/E ratio decreased from 50 to 10 (w/w) (Figure 1, Lane 8–12) where S/E 10 (w/w) treatment (Figure 1a, Lane 8) showed no observable bands at MW > 11 kDa. A <11 kDa band was found in all hydrolysates regardless of the hydrolysis time and S/E ratio, yet there were no reports on egg white proteins within this molecular weight range. This protein band may be contributed by a new, uncharacterized protein or the hydrolysis product from the aforementioned egg white proteins. Similar observations were recorded in C treatment (Figure 1b) yet 17–48 kDa protein bands were observed at S/E 40 and 50 (w/w) (Figure 1b, Lane 11 and 12), suggesting the incomplete hydrolysis of ovalbumin, ovoflavoprotein, ovomucoid or ovoglycoprotein when low amount of enzyme was used. Abeyrathne, Lee, Jo, Nam and Ahn [28] had reported the inability of 1% chymotrypsin to hydrolyze 20 mg/mL ovalbumin even up to 24 h. Apart from incomplete hydrolysis by chymotrypsin, the presence of ovoflavoprotein and ovomucoid could be attributed by their high thermal stability as boiling at 100 °C for 30 min could not denature the protein structures [25,29]. In contrast, T+C treatment showed complete digestion of large MW proteins (25–48 kDa) even when the shortest hydrolysis time at t = 0.5 h (Figure 1c, Lane 2) and the least amount of enzyme at S/E 50 (w/w) (Figure 1c, Lane 12) were used. This implies enzyme combination using trypsin and chymotrypsin was more effective in releasing smaller peptides from large protein molecules compered to individual enzyme treatments.
DH is an indication of peptide bond cleavage in a protein hydrolysate and is vital in modulating the composition and properties of the peptides produced. The effects of different enzyme compositions, S/E ratio and hydrolysis time on the DH of egg white were summarized in Figure 2. Overall, it was observed that a lower S/E ratio and longer hydrolysis time contributed to higher DH in all T, C and T+C enzyme treatments. The highest DH was recorded in the T+C treatments at S/E ratio 10 (88.3 ± 0.4%; Figure 2a) and t = 5 h (86.1 ± 1.7%; Figure 2b). This could be due to the synergistic effect between the trypsin and chymotrypsin as the enzymes have different preferential cleavage sites. For example, the simultaneous treatment with trypsin and chymotrypsin had significantly reduced the time required for total hydrolysis of cheese whey proteins [30]. Chymotrypsin may cleave the bulky side chains of egg white proteins, exposing more cleavage sites for trypsin actions. Moreover, the resistance of albumin to trypsin digestion was overcome by boiling at 95 °C for 30 min before enzymatic hydrolysis. Heat treatment may have partially denatured or altered the tertiary structure of albumin, making the protein more accessible to both trypsin and chymotrypsin cleavage. A high DH corresponds to more peptide production and is often related to high bioactivity. For instance, Noh and Suh [31] who hydrolyzed egg white liquid using Alcalase, Neutrase, Protamex, Flavourzyme, Collupulin and Ficin had reported a positive correlation between DH and antioxidant activity. Alcalase hydrolysate produced at S/E 50 w/w and 24 h recorded the highest DH (43.2%) and free radical scavenging effects (82.5%) compared to other enzyme treatments. Moreover, high radical scavenging effect (ORAC value 1193.12 and DPPH value 19.05 Trolox EQ µmol g−1) were recorded when the DH of egg white were higher than 50% [32]. Similar conclusion was drawn by Chen, Chi, Zhao and Xu [33] where the antioxidant and angiotensin I-converting enzyme (ACE) inhibitory activities of egg white protein hydrolysate increased as the DH increased. Thus, together with the SDS-PAGE analysis result, the S/E ratio of 10–30 (w/w) and hydrolysis time of 2–5 h were selected for optimization study as these ranges recorded egg white hydrolysates with small peptides (MW < 17 kDa) and DH >50%.

3.2. Optimization of Tyrosinase Inhibitory Activities

The experimental and predicted responses of the 28 generated runs, presented as the mean of triplicate experiments, are shown in Table 2. There was a close agreement between the experimental and predicted responses. X1 was designated as the slack variable and removed from the model. This is because the summation of X1 and X2 equals 100%, hence a significant (p < 0.05) X2 reflects the significance of X1. Square root transformation of data was performed to normalize the data as suggested by the software.
Based on Table 2a, the experimental monophenolase inhibitory activity ranged from 15.2–48.0% under various test conditions, with the highest inhibition (47.989%) recorded at X1 = 75%, X2 = 25%, X3 = 20 w/w and X4 = 5 h. On the other hand, the experimental diphenolase inhibitory activity were ranging from 25.0–49.6% under various test conditions, with the highest inhibition (49.6%) recorded at X1 = 75%, X2 = 25%, X3 = 25 w/w and X4 = 2.75 h (Table 2b). Analysis of variance (ANOVA) was then conducted to evaluate the significance of the coefficient models at a 95% confidence interval (Table 3). The crossed reduced quadratic × cubic model was selected as it recorded a p-value of < 0.0001 for both monophenolase and diphenolase inhibitory activities. The insignificant lack of fit test p-value of 0.3348 (Table 3a) and 0.2906 (Table 3b) were observed for monophenolase and diphenolase inhibitory activities, respectively, indicating a well-fitted model that is adequate to describe the observed data. In addition, the values of coefficient of determination, R2 and adjusted R2 observed were 0.967 and 0.920, respectively (for monophenolase inhibitory activity), and 0.934 and 0.863, respectively (for diphenolase inhibitory activity), suggesting an excellent fit to the selected model. The coefficient of variation (CV) measures the dispersion of data around the mean. Both models had a low CV of 4.611 and 2.996%, respectively, implying a high precision and low degree of variation of the experiment performed.
The significant (p < 0.05) effect on the monophenolase inhibitory activity was contributed by the linear terms X4 and X2, quadratic term X32 and various interaction terms X2X3, X2X4, X3X4, X22X3, X22X4, X2X32 and X32X4, whereas, the significant (p < 0.05) effect on the diphenolase inhibitory activity was contributed by the linear terms X4 and X2, quadratic terms X32 and X42 alongside various interaction terms X2X3, X2X4, X3X4, X22X3, X22X4, X2X32 and X3X42. This suggested the hydrolysis time, enzyme compositions, as well as their interactions with S/E ratio, played a prominent role in the inhibition of these activities. To better fit the model, backward elimination step was carried out to eliminate the non-significant terms. The final response equations for monophenolase and diphenolase inhibitory activities in coded variables are given in Equations (4) and (5), respectively.
M o n o p h e n o l a s e   i n h i b i t o r y   a c t i v i t y = 6.269 2.711 x 2 + 1.395 x 4 1.084 x 3 2 + 0.612 x 4 2 3.157 x 2 x 3 2.128 x 2 x 4 + 0.289 x 3 x 4 + 2.835 x 2 2 x 3 + 2.334 x 2 2 x 4 + 3.45 x 2 x 3 2 0.926 x 2 x 4 2 0.938 x 3 2 x 4
D i p h e n o l a s e   i n h i b i t o r y   a c t i v i t y = 6.943 1.258 x 2 0.269 x 4 0.952 x 3 2 0.269 x 4 2 + 1.301 x 2 x 3 1.472 x 2 x 4 0.139 x 3 x 4 1.267 x 2 2 x 3 + 2.244 x 2 2 x 4 + 1.726 x 2 x 3 2 0.226 x 3 x 4 2

3.3. Verification of Predictive Models

Various combination of hydrolysis parameters was suggested to verify the suitability of the predictive models. Taking into consideration the cost, efficiency and feasibility of the experiment, the optimal condition (desirability value of 0.949, which indicating that the suggested condition is close to the desired process condition-minimum amount of enzymes, minimum hydrolysis time and maximum inhibitory activities) to achieve monophenolase inhibitory activity of 45.9% corresponded to 55% trypsin, 45% chymotrypsin, S/E ratio 10:1 (w/w) and hydrolysis time 2 h was examined. The experimental value of 45.3% was found close with no significant (p > 0.05) difference with the predicted value (45.9%). The DH determined was 84.8 ± 1.8%. For diphenolase inhibitory activity, the optimal condition suggested was 100% trypsin, 0% chymotrypsin, S/E ratio 22.13:1 (w/w) and hydrolysis time 3.18 h. The experimental value of 48.1% was found close with no significant (p > 0.05) difference with the predicted value (48.1%). The degree of hydrolysis determined was 64.0 ± 2.1%. Therefore, this model was valid for the optimization of monophenolase and diphenolase inhibitory activities from egg white. It was also observed that in monophenolase inhibitory activity optimization, even though 48.0% was achieved by sample run 23 (Table 2), 5 h of hydrolysis time was required, whereas 2 h of hydrolysis time could achieve 45.3% (the difference by only 2.7%) in the optimized condition. In the optimization of diphenolase inhibitory activity, the optimized sample achieved 48.1% activity by using only trypsin (lower in cost) compared to the sample run 17 (49.6%) in which the difference was only 1.5%. Therefore, it was suggested that the optimization process had managed to achieve the goal of study.

3.4. Identification of Bioactive Peptides

There were 139 and 189 peptides identified for monophenolase and diphenolase inhibitory activities, respectively, using PEAKS Studio (Appendix A Table A1). For monophenolase inhibitory activity, 76, 36, 4, 7, 11, 4 and 1 peptides were identified from ovalbumin, ovotransferrin, ovomucoid, ovalbumin-related protein X, ovalbumin-related protein Y, Ovomucin, and cystatin, respectively, where they were found to achieve 77%, 45%, 42%, 38%, 32%, 16% and 12% coverages of the corresponding protein sequences (Appendix A Table A1a). For diphenolase activity, 81, 54, 9, 12, 4, 8, 20 and 2 peptides identified were found to match 81%, 63%, 54%, 38%, 29%, 28%, 26% and 2% sequence coverages of ovalbumin, ovotransferrin, lysozyme, ovomucoid, ovalbumin-related protein X, ovalbumin-related protein Y, Ovomucin and ovostatin, respectively (Appendix A Table A1b). Subsequently, PeptideRanker web server was used to screen for potential biologically active peptides since the likeliness of being bioactive is usually governed by specific structural characteristics of peptide [23]. The use of PeptideRanker for initial screening and prediction had been proven successful to identify bioactive peptides with wide array of bioactivities [34,35,36]. Therefore, there were 7 and 21 peptides (PeptideRanker score >0.5) shortlisted for monophenolase and diphenolase inhibitory activities, respectively. The shortlisted peptides were further subjected to structure-activity relationship analysis with mushroom tyrosinase using the PepSite2 web server.
The p-values of mushroom tyrosinase-peptide binding interactions predicted by PepSite 2 web server were summarized in Table 4. A smaller p-value signifies higher potential of peptide binding to the enzyme. The smallest p-value was recorded by ADHPF (0.002658), AFKDEDTKAMPF (0.02053) and ILELPFASGDLLML (0.03464) whereas the largest p-value was recorded by DGSGGCIPK (0.1274) for monophenolase inhibitory activity (Table 4a). For diphenolase activity, SDFHLFGPPGK (0.009412), FDGRSR (0.01312) and FNCSSAGPGAIGSEC (0.01614) were among the peptides with the smallest p-values whereas YFGYTGALR had recorded the largest p-value of 0.2364 (Table 4b). Overall, all peptides showed significant (p < 0.25) binding interactions with mushroom tyrosinase. Notably, phenylalanine, leucine and alanine were frequently observed in the peptide sequences. Phenylalanine may act as the pseudo-substrate of tyrosinase since it is structurally identical to tyrosine, the natural substrate of tyrosinase. Besides, the hydrophobic side chains of leucine and alanine may interact directly with the hydrophobic binding pocket of tyrosinase to cause enzyme inhibition. According to Strothkamp, Jolley and Mason [37], mushroom tyrosinase is a tetramer comprising of two H subunits and two L subunits. The L subunit is the product of Orf239342 gene and possesses a lectin-like structure, hence annotated as mushroom tyrosinase associated lectin-like protein. It comprises residues 9–28 and 35–150 of ORF239342 protein and is arranged into 12 antiparallel β-strands that is located away from the tyrosinase catalytic site, suggesting an insignificant role in enzyme activity [38]. The L subunit was postulated to provide innate immunity against bacterial infection [39] and act as a cofactor in melanin production [40]. In contrast, the H subunit originates from ppo3 gene and covers residues 2–392 of PPO3. This subunit is made up of 13 α-helices, 8 short β-strands and loops that structured the catalytically essential tyrosinase core domain [38,41]. The H subunit houses a binuclear copper active site where copper A is coordinately bonded with H61, H85 and H94 whereas copper B to H 259, H263 and H296. The 6 histidine residues form a hydrophobic binding pocket at the bottom of the H subunit and H263 is postulated to regulate proper orientation of incoming substrate [38]. The structural rigidity of the binding pocket is maintained by several interactions between the 6 histidine and their neighboring residues. For instance, the side chain rotational freedom of H85 is restricted through the formation of a thioether bond with the side chain of C83. This thioether bond stabilizes H85 and is also suggested to optimize redox potential as well as to facilitate rapid electron transfer for the redox reactions occurring in the binuclear copper site [38,42]. Furthermore, the presence of F90 confers structural constraints to H94, H259 and H296 while F292 limits the side chain flexibility of H61, H263 and H296 [38]. The interaction between M280 and the aromatic ring of histidines also stabilizes the protein structure [43] and this residue may aid in copper incorporation into the binding pocket [44]. Notably, the ILELPFASGDLLML for monophenolase inhibitory activity (Table 4a) and GYSLGNWVCAAK, YFGYTGALRCLV, HIATNAVLFFGR, FMMFESQNKDLLFK, SGALHCLK and YFGYTGALR for diphenolase inhibitory activity (Table 4b) were found to interact with H61, H85, H94, H259, H263, and H296 (hotspot residues) and F92, F292 and M280 (stabilizing residues) of mushroom tyrosinase. The peptide interactions with the hotspot residues may weaken or hinder enzyme binding with its putative substrate whereas peptide interactions with the stabilizing residues may disrupt the integrity of active site, which reduces the catalytic potency of the enzyme. Thus, ILELPFASGDLLML, GYSLGNWVCAAK, YFGYTGALRCLV, HIATNAVLFFGR, FMMFESQNKDLLFK, SGALHCLK and YFGYTGALR represent potential tyrosinase inhibitory peptides.
On the other hand, majority of the peptides were also found to bind to Y140, W386 and H390 (Table 4) which were not within the mushroom tyrosinase substrate binding pocket. Hassani Hagnbeen and Fazli [45] reported two mixed-type inhibitors of tyrosinase, phthalic acid and cinnamic acid, each bound to different binding sites of the enzyme. For instance, phthalic acid formed hydrogen bonds with W136, W141 and G149 and van der Waals interactions with D137, W138, G139, Y140, F147 and F224 whereas cinnamic acid form hydrogen bonds with Q307 and D312 and van der Waals interactions with T308, Y311, V313, Y314, E356 and W358. Jung et al. [46] also reported a mixed-type tyrosinase inhibitor, (E)-2-(2,4-dihydroxybenzylidene)-2,3-dihydro-1H-inden-1-one (BID3) which formed a hydrogen bond with Y140 and interacted hydrophobically with L24, F147 and I148. These findings suggest potential peptide interaction with non-specific binding site of the enzyme since the allosteric site of mushroom tyrosinase has yet to be identified.

4. Conclusions

In this study, egg white has been proven to be more than just a food component. The optimization of enzymatic hydrolysis conditions, LC/MS MS/MS peptide identification and sequencing followed by structure-activity relationship analyses had corroborated the potential of this food protein as a source for the production of anti-tyrosinase peptides to prevent skin hyperpigmentation. Nonetheless, the monophenolase and diphenolase inhibitory peptides identified will next be chemically synthesized and validated for their in vitro anti-tyrosinase efficacies before proceeding to in vivo assays to examine their effects on the melanogenesis pathway regulatory proteins.

Author Contributions

Conceptualization, P.-G.Y. and C.-Y.G.; methodology, C.-Y.G.; software, P.-G.Y.; validation, P.-G.Y. and C.-Y.G.; formal analysis, P.-G.Y.; investigation, P.-G.Y.; resources, C.-Y.G.; data curation, P.-G.Y.; writing—original draft preparation, P.-G.Y.; writing—review and editing, P.-G.Y. and C.-Y.G.; visualization, P.-G.Y.; supervision, C.-Y.G.; project administration, C.-Y.G.; funding acquisition, C.-Y.G. All authors have read and agreed to the published version of the manuscript.

Funding

This research was financially supported by Universiti Sains Malaysia RUI Grant (Grant number: 1001/CABR/8011045) and Universiti Sains Malaysia MyRA incentive fund (1001/CABR/AUPS001).

Conflicts of Interest

The authors declare no conflict of interest.

Appendix A

Table A1. List of egg white-derived peptides for (a) monophenolase and (b) diphenolase inhibitory activities with their corresponding PeptideRanker scores.
Table A1. List of egg white-derived peptides for (a) monophenolase and (b) diphenolase inhibitory activities with their corresponding PeptideRanker scores.
No.Egg Protein Sequence CoveragePeptidePeptide Sequence NumberScore
(a) Monophenolase inhibitory activity
1Ovalbumin (77%)ADHPF *361–3650.8592
2FDKLPGFGD *60–680.6817
3FDKLPGFGDSIEAQCGTSVN *60–790.5429
4AFKDEDTKAMPF *188–1990.5332
5DKLPGFGD *61–680.5174
6MSALAM36–410.4941
7RGGLEPINF127–1350.4842
8YPILPEYL112–1190.4732
9AFKDEDTQAMPF188–1990.4636
10VLLPDEVSGLEKLESIINF244–2620.4494
11QVLLPDEVSGLEQLESIINF243–2620.4335
12KDEDTQAMPF190–1990.4113
13FDKLPGFGDSIEAQ60–730.4067
14YPILPEYLQCVKELY112–1260.3960
15VLLPHEVSGLEQLESIINF244–2620.3712
16LVQLPDEVSGLEQLESIINF243–2620.3593
17LPDEVSGLEQLESIINF246–2620.3544
18MAMGITDVF299–3070.3250
19SSSANLSGISSAESLK308–3230.3207
20LVLLPDEVSGLEQLESIINF243–2620.3189
21VHHANENIFY21–300.3132
22VTEQESKPVQMMYQIGLF210–2180.3126
23VHHANENIF21–290.2953
24GGLEPINFQTAADQAR128–1430.2810
25VLLPDEVSGLEQLESIINFE244–2630.2738
26VASMASEKMK220–2290.2728
27AAHAEINEAGR330–3400.2679
28AEERYPILPEYL108–1190.2648
29YPILPEYLQ112–1200.2638
30ISQAVHAAHAEINEAGR324–3400.2599
31SANLSGISSAESLK310–3230.2537
32SWVESQTNGIIR148–1590.2523
33AFKDEDTQAMP188–1980.2456
34SGISSAESLK314–3230.2242
35MAMGITDVFSSSANLSGIS299–3170.2239
36INSWVESQTNGIIR146–1590.2193
37LYAEERYPILPEYL106–1190.2015
38SGISSAESL314–3220.1982
39VLLPDEVSGLEQLESIINFEK244–2640.1885
40VLQPSSVHSQTAM161–1730.1836
41VLLPDEVSGLEQL244–2560.1835
42LSGISSAESLK313–3230.1793
43HAEINEAGR332–3400.1789
44SAEAGVDAASVSEEF345–3590.1784
45VLLPDEVSGLEQLESIIN244–2610.1723
46EVVGSAEAGVDAASVSEEFR341–3600.1703
47NVLQPSSVHSQTAM160–1730.1699
48AMGITDVFSS300–3090.1674
49SSNVMEE270–2760.1638
50EVVGSAEAGVDAASVSEEF341–3590.1629
51SGISSAESLQ314–3230.1544
52ELINSWVESQTNGIIR144–1590.1482
53SGISSAESLE314–3230.1469
54VTEQESKPVQMM201–2120.1453
55AEINEAGR333–3400.1437
56VLKPSSVDSQTAM161–1730.1431
57VESQTNGIIR150–1590.1401
58NVLQPSSVDSQTAM160–1730.1362
59VLLPDEVSGLEQLESR244–2590.1282
60VLLPDEVSGLEKLESIINFEK244–2640.1189
61VASMASEK220–2270.1086
62ISQAVH324–3290.1070
63TSSNVMEER269–2770.1050
64VLLPHEVSGLEQLES244–2580.0986
65QITKPNDVY90–980.0968
66DILNQITKPNDVY86–980.0951
67VLLPDEVSGLEQLES244–2580.0916
68NQITKPNDVY89–980.0879
69LTEWTSSNVMEER265–2770.0807
70VTEQESKPVQMK201–2120.0805
71RVTEQESKPVQM200–2110.0787
72NQITEPNDVY89–980.0742
73VTEQESKPVQM201–2110.0712
74VTEQESKPV201–2090.0395
75NVLQPSSVDSQTAMVLVNAIVFK160–1820.0365
76NVLQPSSVDSQTAMVLVNAIVF160–1810.0218
77Ovotransferrin (45%)KDSNVNWNNLK458–4680.4863
78GEADAVALHGGLVY406–4190.4290
79NLQMDDFELL579–5880.4262
80NLKMDDFELL579–5880.3988
81KDQLTPSPR352–3600.3329
82VPSLMHSQLY329–3380.3155
83GAIEWEGIESGSVEKAVAK155–1730.2986
84KGEADAVALDGGLVY405–4190.2793
85TAGVCGLVPVMAER420–4330.2662
86VPSLMDSQLY329–3380.2612
87AQSDFGVDTK289–2980.2525
88GAIEWEGIESGSVEQAVAK155–1730.2308
89RVPSLMDSQLY328–3380.2249
90VPVMAER427–4330.1784
91VAAHAVVAR266–2740.1704
92GAIEWEGIESGSVEQAVAE155–1730.1683
93AIEWEGIESGSVEQAVAK156–1730.1624
94LKPIAAEVY93–1010.1209
95KLKPIAAEVY92–1010.1184
96HAVVVRPEK611–6190.1049
97IQHSTVEENTGGK559–5710.1005
98TVNDLQGK124–1310.0955
99AVVVRPEK612–6190.0953
100TVNENAPDQKDEYELL231–2460.0946
101QGIESGSVEQAVAK160–1730.0919
102TDERPASY443–4500.0891
103IKHSTVEENTGGK559–5710.0865
104VAAHAVVARDDNQVEDIW266–2830.0847
105DLTQQER44–500.0846
106VQHSTVEENTGGK559–5710.0835
107EGIESGSVEQAVAK160–1730.0768
108TVISSLK682–6880.0710
109HTTVNENAPDQKDEYELL229–2460.0630
110EGIESGSVEQAVAE160–1730.0600
111VVVRPEK613–6190.0580
112TVEENTGGK563–5710.0491
113Ovalbumin-related protein Y (32%)ISDAVHGVF324–3320.4692
114MISDAVHGVF323–3320.4224
115VLLPDEVSGLEHIEKTINF244–2620.2846
116HSLELEEFR354–3620.2286
117SLEIADKLY99–1070.1898
118VLLPDEVSGLER244–2550.1871
119VLLPDEVSGLERIEKTIN244–2610.1605
120VLLPDEVSGLERIEK244–2580.1316
121MEVNEEGTEATGSTGAIGNIK333–3530.1211
122TGGVEEVNFK127–1360.1200
123NVATLPAEK219–2270.1152
124Ovalbumin-related protein X (38%)ILELPFASGDLLML *74–870.8643
125TGISSAESLK158–1670.1223
126NVATLPAEK63–710.1152
127VLLPDEVSDLER88–990.1084
128ISQAVH168–1730.1070
129AGSTGVIEDIK187–1970.1025
130VTKQESKPVQM45–550.0833
131Ovomucoid (42%)FPNATDKEGK32–410.3269
132DLRPICGTDGVTY49–610.2154
133VEQGASVDKR137–1460.0903
134VEQGASVDER137–1460.0734
135Ovomucin (16%)DGSGGCIPK *814–8220.6103
136VTDSF1591–15950.2004
137SNSLVILTQA1494–15030.1384
138IQEIATDPGAEK941–9520.1215
139Cystatin (12%)LLGAPVPVDENDEGLQR30–460.2450
(b) Diphenolase inhibitory activity
1Ovalbumin (81%)ADHPFLF *361–3670.9699
2MYQIGLFR *212–2190.8011
3SMLVLLPDEVSGLEQLESIINFEK *241–2640.6983
4FDKLPGFGD *60–680.6817
5HIATNAVLFFGR *371–3820.5209
6FKDEDTQAMPFR *189–2000.5001
7DEDTKAMPFR191–2000.4978
8ILELPFASGTMS230–2410.4972
9DEDTQAMPFR191–2000.4842
10MLVLLPDEVSGLEQLESIINFEK242–2640.4842
11YPILPEYLQCVK112–1230.4769
12AFKDEDTQAMPFR188–2000.4702
13SSSANLSGISSAESLK308–3230.3207
14SQAVHAAHAEINEAGR325–3400.2965
15VTEQESKPVQMMYQIGLFR201–2190.2886
16GGLEPINFQTAADQAR128–1430.2810
17SQTAMVLVNAIVFK169–1820.2781
18VASMASEKMK220–2290.2728
19AAHAEINEAGR330–3400.2679
20YPILPEYLQ112–1200.2638
21QAVHAAHAEINEAGR326–3400.2606
22ISQAVHAAHAEINEAGR324–3400.2599
23EAQCGTSVNVHSSLR71–850.2554
24SANLSGISSAESLK310–3230.2537
25SSANLSGISSAESLK309–3230.2497
26EVCGSAEAGVDAASVSEEFR341–3600.2424
27GLEPINFQTAADQAR129–1430.2420
28VLLPDEVSGLEQLESIINFEQ244–2640.2410
29VLVNANVFK174–1820.2362
30NSQAVHAAHAEINEAGR324–3400.2273
31ISQAVHAAHAEIN324–3360.2267
32DILNQITKPNDVYSFSLASR86–1050.2229
33FQTAADQAR135–1430.2202
34VLVNAIVFK174–1820.2049
35MAMGITDVFSSSANLSGISSAESLK299–3230.1963
36AVHAAHAEINEAGR327–3400.1935
37SVNVHSSLR77–850.1930
38LCEWTSSNVMEER265–2770.1886
39VLLPDEVSGLEQLESIINFEK244–2640.1885
40DLEPINFQTAADQAR129–1430.1854
41LSGISSAESLK313–3230.1793
42HAEINEAGR332–3400.1789
43LEPINFQTAADQAR130–1430.1739
44EVVGSAEAGVDAASVSEEFR341–3600.1703
45DILNQITKPNDVYSF86–1000.1698
46EAGVDAASVSEEFR437–3600.1664
47AEAGVDAASVSEEFR346–3600.1641
48VHAAHAEINEAGR328–3400.1633
49EVVGAAEAGVDAASVSEEFR341–3600.1628
50EPINFQTAADQAR131–1430.1588
51ISQAVHAAH324–3320.1572
52ELINSWVESQTNGIIR144–1590.1482
53VTEQESKPVQMM201–2120.1453
54VTEQESKPVQMMY201–2130.1416
55RVTEQESKPVQMMY200–2130.1413
56GITHVFSSSANLSGISSAESLK302–3230.1401
57VLVNAIVFE174–1820.1401
58AMGNTDVFSSSANLSGISSAESLK300–3230.1395
59NVLQPSSVDSQTAM160–1730.1362
60EWTSSNVMEER267–2770.1280
61GTSVNVHSSLR75–850.1274
62LQPSSVDSQTAMVLVNAIVFK162–1820.1259
63AMGITDVFSSSANLSGISSAESLK300–3230.1239
64VTEQESKPVKM201–2110.1172
65GITDVFSSSANLSGISSAESLK302–3230.1089
66VASMASEK200–2270.1086
67TSSNVMEER269–2770.1050
68DILNQITKPNDVY86–980.0951
69LTEWTSSNVMEER265–2770.0807
70ELINSWVESQTN144–1550.0798
71TEWTSSNVMEER266–2770.0763
72LYAEER106–1110.0759
73EAGVDAASVS347–3560.0755
74VASMASEE220–2270.0721
75VTEQESKPVQM201–2110.0712
76TQINK52–560.0607
77NKVVR55–590.0591
78VTEQESKPVQMMYQIGLFRVASMASEK201–2270.0512
79NVLKPSSVDSQTAMVLVNAIVFK160–1820.0486
80NVLQPSSVDSQTAMVLVNAIVFK160–1820.0365
81Ovotransferrin (63%)SDFHLFGPPGK *299–3090.8619
82SGYSGAFHCLK *208–2180.8239
83SGAFHCLK *211–2180.8038
84CQLCQGSGGIPPEK *518–5310.6874
85YFGYTGALRCLV *540–5510.6541
86DLLFKDSAIMLK *216–3270.6400
87SGALHCLK *211–2180.5971
88FMMFESQNKDLLFK *644–6570.5892
89YFGYTGALR *540–5480.5801
90KDSNVNWNNLK458–4680.4863
91DDNKVEDIWSFLSK275–2880.4641
92SGGIPPEK524–5310.4622
93NIPIGTLLHRG145–1550.4328
94DLLFKDSAIMLE316–3270.4322
95SAIQSMR345–3510.4293
96ANVMDYR595–6010.4255
97FFSASCVPGATIEQK174–1880.4152
98NIPIGTLLHR145–1540.3756
99TSCHTGLGR132–1400.3624
100GAIEWEGIESGSVEQAVAKFFSASCVPGA155–1830.3503
101FMMFESKNK644–6520.3416
102KDQLTPSPR352–3600.3329
103FMMFESQNK644–6520.3265
104GDVAFVK222–2280.3236
105EAGLAPYK85–920.3173
106GLIHNR488–4930.3124
107VEDIWSFLSE278–2880.3066
108GAIEWEGIESGSVEKAVAK155–1730.2986
109DGKGDVAFVK219–2280.2939
110SDFGVDTK291–2980.2580
111AQSDFGVDTK289–2980.2525
112GDVAFIKHSTVEENTGGK554–5710.2429
113TDERPASYF443–4510.2356
114GAIEWEGIESGSVEQAVAK155–1730.2308
115AAHAVVAR267–2740.2295
116GANEWEGIESGSVEQAVAK155–1730.2076
117GAIEWEGNESGSVEQAVAK155–1730.2067
118AQSDFGVDTE289–2980.1852
119FYTVISSLKTCNPS680–6930.1792
120VAAHAVVAR266–2740.1704
121GAIEWEGIESGSVEQAVAE155–1730.1683
122FGVHGSEK634–6410.1601
123FGVNGSEKSK634–6430.1364
124RFGVNGSEK633–6410.1351
125GDVAFVQHSTVEENTGGK554–5710.1323
126KGTEFTVNDLQGK119–1310.1190
127GTEFTVNDLQGK120–1310.1166
128DVAFIQHSTVEENTGGK555–5710.1158
129KCVAS531–5350.1136
130TDERPASY443–4500.0891
131LKPIAAEVYEHTEGSTTSYY93–1120.0753
132YTVISSLK681–6880.0742
133CTVVDETK390–3970.0495
134HTTVNENAPDQK229–2400.0390
135Ovomucoid (38%)FPNATDKEGK32–410.3269
136VMVLCNR107–1130.2887
137GASVDKR140–1460.2203
138SIEFGTNISK71–800.1899
139AVVESNGTLTLSHFGK194–2090.1597
140FCNAVVES191–1980.1383
141VEQGASVDKR137–1460.0903
142CAHKVEQ133–1390.0902
143VEQGASVDER137–1460.0734
144CNFCNAVVESNGTLTLSHFGK189–2090.0623
145VEQGASVDK137–1450.0585
146VEQGASVDE137–1450.0467
147Ovomucin (26%)SGGQFSLTSTVKVC *1973–19860.5560
148SSCEDCVCT *1888–18960.5459
149FNCSSAGPGAIGSEC *771–7850.5429
150SSCICS *270–2750.5397
151FDGRSR *1000–10050.5330
152PAQEQLM1255–12610.3931
153KSLSICSLK916–9240.3501
154VTSDGCCK2001–20080.3200
155LEGCYPECS1163–11710.3088
156ECGNSC312–3170.2923
157EPSELCK1629–16350.2680
158TCTCNKR846–8520.2315
159DTCADPE319–3250.2167
160VTDSF1591–15950.2004
161TATGAVEDSAAAFGNSWE547–5640.1661
162GTCSTYS2044–20500.1278
163IQEIATDPGAEK941–9520.1215
164EVIVDTLLSR1722–17310.1101
165VQVSTVGR28–350.0990
166AVTGTN1901–19060.0685
167Lysozyme (54%)GYSLGNWVCAAK *40–510.6563
168HGLDNYRG33–400.4763
169HGLDNYR33–390.3753
170GTDVQAWIR135–1430.3365
171GILQINSR72–790.2008
172FESNFNTQATNR52–630.1820
173SNFNTQATNR54–630.1487
174ILQINSR73–790.1212
175NTDGSTDYGILQINSR64–790.0900
176Ovalbumin-related protein Y (28%)VHNLFK80–850.3580
177HSLELEEFR354–3620.2286
178VATLPAEKMK220–2290.1937
179KFYTGGVEEVNFK124–1360.1917
180VLLPDEVSGLER244–2550.1871
181FYTGGVEEVNFK125–1360.1570
182ATGSTGAI342–3490.1262
183TESQMK50–550.0899
184Ovostatin (2%)EKMAPALRLLV538–5480.4863
185LVDKDNSPISNK379–3900.1410
186Ovalbumin-related protein X (29%)HNPTNTIVYFGR217–2280.2810
187ILELPFASGDLSMLVLLPDEVSDLER74–990.1682
188ILELPFASGDLSMLVLLPDEVSHLER74–990.1607
189ISQAVHGAFMELSEDGIEMAGSTGVIEDIK168–1970.0118
* shortlisted peptides (PeptideRanker score > 0.5) for structure-activity relationship analysis.

References

  1. Sánchez-Ferrer, Á.; Rodríguez-López, J.N.; García-Cánovas, F.; García-Carmona, F. Tyrosinase: A comprehensive review of its mechanism. BBA Protein Struct. Mol. Enzymol. 1995, 1247, 1–11. [Google Scholar] [CrossRef]
  2. Michalek, I.M.; Benn, E.K.; dos Santos, F.L.C.; Gordon, S.; Wen, C.; Liu, B. A systematic review of global legal regulations on the permissible level of heavy metals in cosmetics with particular emphasis on skin lightening products. Environ. Res. 2019, 170, 187–193. [Google Scholar] [CrossRef] [PubMed]
  3. Westerhof, W.; Kooyers, T.J. Hydroquinone and its analogues in dermatology—A potential health risk. J. Cosmet Dermatol. 2005, 4, 55–59. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  4. Lee, M.C. Tyrosinase Inhibitor Extract. U.S. Patent 7,125,572, 24 October 2006. [Google Scholar]
  5. Ubeid, A.A.; Zhao, L.; Wang, Y.; Hantash, B.M. Short-sequence oligopeptides with inhibitory activity against mushroom and human tyrosinase. J. Investig. Dermatol. 2009, 129, 2242–2249. [Google Scholar] [CrossRef]
  6. Kubglomsong, S.; Theerakulkait, C.; Reed, R.L.; Yang, L.; Maier, C.S.; Stevens, J.F. Isolation and identification of tyrosinase-inhibitory and copper-chelating peptides from hydrolyzed rice-bran-derived albumin. J. Agric. Food Chem. 2018, 66, 8346–8354. [Google Scholar] [CrossRef] [PubMed]
  7. Marini, A.; Farwick, M.; Grether-Beck, S.; Brenden, H.; Felsner, I.; Jaenicke, T.; Weber, M.; Schild, J.; Maczkiewitz, U.; Köhler, T.; et al. Modulation of skin pigmentation by the tetrapeptide PKEK: In vitro and in vivo evidence for skin whitening effects. Exp. Dermatol. 2012, 21, 140–146. [Google Scholar] [CrossRef] [PubMed]
  8. Albericio, F.; Kruger, H.G. Therapeutic peptides. Future Med. Chem. 2012, 4, 1527–1531. [Google Scholar] [CrossRef] [Green Version]
  9. Ochiai, A.; Tanaka, S.; Tanaka, T.; Taniguchi, M. Rice bran protein as a potent source of antimelanogenic peptides with tyrosinase inhibitory activity. J. Nat. Prod. 2016, 79, 2545–2551. [Google Scholar] [CrossRef]
  10. Oh, G.W.; Ko, S.C.; Heo, S.Y.; Nguyen, V.T.; Kim, G.; Jang, C.H.; Park, W.S.; Choi, I.-W.; Qian, Z.-J.; Jung, W.K. A novel peptide purified from the fermented microalga Pavlova lutheri attenuates oxidative stress and melanogenesis in B16F10 melanoma cells. Process. Biochem. 2015, 50, 1318–1326. [Google Scholar] [CrossRef]
  11. Eriksson, L.; Johansson, E.; Kettaneh-Wold, N.; Wikström, C.; Wold, S. D-optimal design. In Design of Experiments: Principles and Applications; UMETRICS: Stockholm, Sweden, 2000. [Google Scholar]
  12. Alkali, L.M.T.B.M. D-optimal design optimization of Jatropha curcas L. seed oil hydrolysis via alkali-catalyzed reactions. Sains Malays. 2012, 41, 731–738. [Google Scholar]
  13. Bahadi, M.; Yusoff, M.F.; Derawi, J.S.D. Optimization of response surface methodology by d-optimal design for alkaline hydrolysis of crude palm kernel oil. Sains Malays. 2020, 49, 29–41. [Google Scholar] [CrossRef]
  14. Olsen, J.V.; Ong, S.E.; Mann, M. Trypsin cleaves exclusively C-terminal to arginine and lysine residues. Mol. Cell. Proteom. 2004, 3, 608–614. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  15. Blow, D.M. The Structure of Chymotrypsin. In The Enzymes, 3rd ed.; Boyer, P.D., Ed.; Academic Press: New York, NY, USA, 1971; pp. 185–212. [Google Scholar]
  16. Hsiao, N.W.; Tseng, T.S.; Lee, Y.C.; Chen, W.C.; Lin, H.H.; Chen, Y.R.; Wang, Y.-T.; Hsu, H.-J.; Tsai, K.C. Serendipitous discovery of short peptides from natural products as tyrosinase inhibitors. J. Chem. Inf. Model. 2014, 54, 3099–3111. [Google Scholar] [CrossRef] [PubMed]
  17. Schurink, M.; van Berkel, W.J.; Wichers, H.J.; Boeriu, C.G. Novel peptides with tyrosinase inhibitory activity. Peptides 2007, 28, 485–495. [Google Scholar] [CrossRef]
  18. Miguel, M.; Recio, I.; Gomez-Ruiz, J.A.; Ramos, M.; Lopez-Fandino, R. Angiotensin I–converting enzyme inhibitory activity of peptides derived from egg white proteins by enzymatic hydrolysis. J. Food Protect. 2004, 67, 1914–1920. [Google Scholar] [CrossRef]
  19. Baharuddin, N.A.; Halim NR, A.; Sarbon, N.M. Effect of degree of hydrolysis (DH) on the functional properties and angiotensin I-converting enzyme (ACE) inhibitory activity of eel (Monopterus sp.) protein hydrolysate. Int. Food Res. J. 2016, 23, 1424–1431. [Google Scholar]
  20. Takahashi, M.; Takara, K.; Toyozato, T.; Wada, K. A novel bioactive chalcone of Morus australis inhibits tyrosinase activity and melanin biosynthesis in B16 melanoma cells. J. Oleo Sci. 2012, 61, 585–592. [Google Scholar] [CrossRef]
  21. Siow, H.L.; Gan, C.Y. Extraction of antioxidative and antihypertensive bioactive peptides from Parkia speciosa seeds. Food Chem. 2013, 141, 3435–3442. [Google Scholar] [CrossRef]
  22. Ma, B.; Zhang, K.; Hendrie, C.; Liang, C.; Li, M.; Doherty-Kirby, A.; Lajoie, G. PEAKS: Powerful software for peptide de novo sequencing by tandem mass spectrometry. Rapid Commun. Mass Spectrom. 2003, 17, 2337–2342. [Google Scholar] [CrossRef]
  23. Mooney, C.; Haslam, N.J.; Pollastri, G.; Shields, D.C. Towards the improved discovery and design of functional peptides: Common features of diverse classes permit generalized prediction of bioactivity. PLoS ONE 2012, 7, e45012. [Google Scholar] [CrossRef] [Green Version]
  24. Trabuco, L.G.; Lise, S.; Petsalaki, E.; Russell, R.B. PepSite: Prediction of peptide-binding sites from protein surfaces. Nucleic Acids Res. 2012, 40, W423–W427. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  25. Abdou, A.M.; Kim, M.; Sato, K. Functional proteins and peptides of hen’s egg origin. In Bioactive Food Peptides in Health and Disease; Blanca, H.L., Hsieh, C.C., Eds.; InTech: Rijeka, Croatia, 2013; pp. 115–144. [Google Scholar]
  26. Akazawa, T.; Ogawa, M.; Hayakawa, S. Migration of chicken egg-white protein ovalbumin-related protein X and its alteration in heparin-binding affinity during embryogenesis of fertilized egg. Poult. Sci. 2019, 98, 5100–5108. [Google Scholar] [CrossRef] [PubMed]
  27. Hirose, J.; Doi, Y.; Kitabatake, N.; Narita, H. Ovalbumin-related gene Y protein bears carbohydrate chains of the ovomucoid type. Biosci. Biotechnol. Biochem. 2006, 70, 144–151. [Google Scholar] [CrossRef] [Green Version]
  28. Abeyrathne, E.D.N.S.; Lee, H.Y.; Jo, C.; Nam, K.C.; Ahn, D.U. Enzymatic hydrolysis of ovalbumin and the functional properties of the hydrolysates. Poult. Sci. 2014, 93, 2678–2686. [Google Scholar] [CrossRef] [PubMed]
  29. Stevens, L. Egg white proteins. Comp. Biochem. Phys. B Comp. Biochem. 1991, 100, 1–9. [Google Scholar] [CrossRef]
  30. Custódio, M.F.; Goulart, A.J.; Marques, D.P.; Giordano, R.C.; Giordano, R.D.L.C.; Monti, R. Hydrolysis of cheese whey proteins with trypsin, chymotrypsin and carboxypeptidase A. Aliment. Nutr. Araraquara 2009, 16, 105–109. [Google Scholar]
  31. Noh, D.O.; Suh, H.J. Preparation of egg white liquid hydrolysate (ELH) and its radical-scavenging activity. Prev. Nutr. Food Sci. 2015, 20, 183. [Google Scholar] [CrossRef] [Green Version]
  32. De Castro, R.J.S.; Sato, H.H. A response surface approach on optimization of hydrolysis parameters for the production of egg white protein hydrolysates with antioxidant activities. Biocatal. Agric. Biotechnol. 2015, 4, 55–62. [Google Scholar] [CrossRef]
  33. Chen, C.; Chi, Y.J.; Zhao, M.Y.; Xu, W. Influence of degree of hydrolysis on functional properties, antioxidant and ACE inhibitory activities of egg white protein hydrolysate. Food Sci. Biotechnol. 2012, 21, 27–34. [Google Scholar] [CrossRef]
  34. Garg, S.; Apostolopoulos, V.; Nurgali, K.; Mishra, V.K. Evaluation of in silico approach for prediction of presence of opioid peptides in wheat. J. Funct. Foods 2018, 41, 34–40. [Google Scholar] [CrossRef]
  35. Mudgil, P.; Kamal, H.; Yuen, G.C.; Maqsood, S. Characterization and identification of novel antidiabetic and anti-obesity peptides from camel milk protein hydrolysates. Food Chem. 2018, 259, 46–54. [Google Scholar] [CrossRef] [PubMed]
  36. Salim MA, S.M.; Gan, C.Y. Dual-function peptides derived from egg white ovalbumin: Bioinformatics identification with validation using in vitro assay. J. Funct. Foods 2020, 64, 103618. [Google Scholar]
  37. Strothkamp, K.G.; Jolley, R.L.; Mason, H.S. Quaternary structure of mushroom tyrosinase. Biochem. Bioph. Res. Co. 1976, 70, 519–524. [Google Scholar]
  38. Ismaya, W.T.; Rozeboom, H.J.; Weijn, A.; Mes, J.J.; Fusetti, F.; Wichers, H.J.; Dijkstra, B.W. Crystal structure of Agaricus bisporus mushroom tyrosinase: Identity of the tetramer subunits and interaction with tropolone. Biochemistry 2011, 50, 5477–5486. [Google Scholar]
  39. Drickamer, K.; Taylor, M.E. Recent insights into structures and functions of C-type lectins in the immune system. Curr. Opin. Struct. Biol. 2015, 34, 26–34. [Google Scholar] [PubMed] [Green Version]
  40. Weijn, A.; Bastiaan-Net, S.; Wichers, H.J.; Mes, J.J. Melanin biosynthesis pathway in Agaricus bisporus mushrooms. Fungal Genet. Biol. 2013, 55, 42–53. [Google Scholar]
  41. Flurkey, W.H.; Inlow, J.K. Proteolytic processing of polyphenol oxidase from plants and fungi. J. Inorg. Biochem. 2008, 102, 2160–2170. [Google Scholar] [CrossRef]
  42. Kanteev, M.; Goldfeder, M.; Fishman, A. Structure–function correlations in tyrosinases. Protein Sci. 2015, 24, 1360–1369. [Google Scholar]
  43. Valley, C.C.; Cembran, A.; Perlmutter, J.D.; Lewis, A.K.; Labello, N.P.; Gao, J.; Sachs, J.N. The methionine-aromatic motif plays a unique role in stabilizing protein structure. J. Biol. Chem. 2012, 287, 34979–34991. [Google Scholar]
  44. Kanteev, M.; Goldfeder, M.; Chojnacki, M.; Adir, N.; Fishman, A. The mechanism of copper uptake by tyrosinase from Bacillus megaterium. JBIC J. Biol. Inorg. Chem. 2013, 18, 895–903. [Google Scholar]
  45. Hassani, S.; Haghbeen, K.; Fazli, M. Non-specific binding sites help to explain mixed inhibition in mushroom tyrosinase activities. Eur. J. Med. Chem. 2016, 122, 138–148. [Google Scholar] [CrossRef] [PubMed]
  46. Jung, H.J.; Noh, S.G.; Park, Y.; Kang, D.; Chun, P.; Chung, H.Y.; Moon, H.R. In vitro and in silico insights into tyrosinase inhibitors with (E)-benzylidene-1-indanone derivatives. Comput. Struct. Biotechnol. J. 2019, 17, 1255–1264. [Google Scholar] [CrossRef] [PubMed]
Figure 1. SDS-PAGE protein band profiling of albumin hydrolysate by (a) 100% trypsin, T; and (b) 100% chymotrypsin, C and (c) 50% trypsin + 50% chymotrypsin, T+C treatments at various substrate-to-enzyme (S/E) ratios and hydrolysis times. L1, control; L2, t = 0.5 h; L3, t = 1 h; L4, t = 2 h; L5, t = 3 h; L6, t = 4 h; L7, t = 5 h; L8, S/E = 10 (w/w); L9, S/E = 20 (w/w); L10, S/E = 30 (w/w); L11, S/E = 40 (w/w); L12, S/E = 50 (w/w).
Figure 1. SDS-PAGE protein band profiling of albumin hydrolysate by (a) 100% trypsin, T; and (b) 100% chymotrypsin, C and (c) 50% trypsin + 50% chymotrypsin, T+C treatments at various substrate-to-enzyme (S/E) ratios and hydrolysis times. L1, control; L2, t = 0.5 h; L3, t = 1 h; L4, t = 2 h; L5, t = 3 h; L6, t = 4 h; L7, t = 5 h; L8, S/E = 10 (w/w); L9, S/E = 20 (w/w); L10, S/E = 30 (w/w); L11, S/E = 40 (w/w); L12, S/E = 50 (w/w).
Foods 09 01312 g001
Figure 2. Effects of enzyme treatments (100% trypsin, T; 100% chymotrypsin, C and 50% trypsin + 50% chymotrypsin, T+C) on the degree of hydrolysis of egg white proteins at various (a) substrate-to-enzyme (S/E) ratio where the hydrolysis time is fixed at t = 3 h and (b) hydrolysis time where the S/E ratio is fixed at 30 (w/w). Results were reported as means with error bars representing the standard deviations of triplicate experiments.
Figure 2. Effects of enzyme treatments (100% trypsin, T; 100% chymotrypsin, C and 50% trypsin + 50% chymotrypsin, T+C) on the degree of hydrolysis of egg white proteins at various (a) substrate-to-enzyme (S/E) ratio where the hydrolysis time is fixed at t = 3 h and (b) hydrolysis time where the S/E ratio is fixed at 30 (w/w). Results were reported as means with error bars representing the standard deviations of triplicate experiments.
Foods 09 01312 g002aFoods 09 01312 g002b
Table 1. Parameters and levels for crossed D-optimal design of the monophenolase and diphenolase inhibitory activities.
Table 1. Parameters and levels for crossed D-optimal design of the monophenolase and diphenolase inhibitory activities.
VariableCoded VariableCoded Variable Level
−1−0.500.51
Trypsin composition (%)X10255075100
Chymotrypsin composition (%)X20255075100
S/E ratio (w/w)X31015202530
Hydrolysis time (h)X422.753.54.255
Table 2. Crossed D-optimal experimental design with the actual and predicted responses for (a) monophenolase and (b) diphenolase inhibitory activities.
Table 2. Crossed D-optimal experimental design with the actual and predicted responses for (a) monophenolase and (b) diphenolase inhibitory activities.
S/E Ratio,
X3
Hydrolysis Time,
X4 (h)
(a)(b)
RunEnzyme Composition
(%)
Monophenolase Inhibitory Activity (%)Diphenolase Inhibitory Activity (%)
Trypsin, X1Chymotrypsin, X2Experimental (y1)Predicted * (y0)Experimental (z1)Predicted # (z0)
1100010532.5 ± 2.835.630.7 ± 1.733.6
2505030220.8 ± 1.820.244.3 ± 4.544.1
30100203.515.2 ± 1.412.731.4 ± 3.532.1
4010010231.6 ± 2.430.534.2 ± 4.033.8
5100030224.7 ± 1.324.335.7 ± 2.136.1
6010030539.1 ± 3.438.540.6 ± 1.840.9
7010030218.9 ± 1.819.630.2 ± 2.331.1
8100020229.5 ± 4.730.745.5 ± 3.648.1
9010030220.0 ± 3.819.632.0 ± 0.531.1
10505010537.2 ± 2.537.532.8 ± 0.931.7
11010010230.2 ± 5.030.533.7 ± 1.733.8
12505030526.1 ± 3.725.328.8 ± 2.730.0
131000303.526.3 ± 3.527.338.1 ± 2.437.3
14100010230.3 ± 4.532.835.8 ± 3.935.6
15505020215.8 ± 3.816.944.7 ± 3.942.5
165050303.519.2 ± 2.821.043.4 ± 3.844.3
177525252.7526.1 ± 3.523.549.6 ± 3.247.0
18010020521.8 ± 3.623.936.2 ± 3.435.1
192575152.7519.0 ± 2.120.931.8 ± 2.535.0
20010030538.4 ± 0.638.541.6 ± 2.240.9
21010010543.4 ± 4.041.546.6 ± 2.048.7
220100103.537.4 ± 4.539.741.7 ± 2.739.3
23752520548.0 ± 4.148.135.9 ± 2.834.5
24100030544.7 ± 0.244.425.0 ± 2.325.2
25100010538.7 ± 0.735.635.7 ± 4.233.6
26100010235.2 ± 1.332.836.9 ± 1.435.6
27505010247.2 ± 2.245.937.7 ± 2.538.6
287525153.536.1 ± 1.434.639.1 ± 1.739.7
Note: Data is presented as the mean ± standard deviation of triplicate experiments; * predicted using Equation (4); # predicted using Equation (5).
Table 3. ANOVA for crossed reduced quadratic × cubic model: estimated regression model of the relationship between the mixture component (X1, X2), process variables (X3, X4) and the response variables (a) monophenolase inhibitory activity (Y) and (b) diphenolase inhibitory activity (Z).
Table 3. ANOVA for crossed reduced quadratic × cubic model: estimated regression model of the relationship between the mixture component (X1, X2), process variables (X3, X4) and the response variables (a) monophenolase inhibitory activity (Y) and (b) diphenolase inhibitory activity (Z).
SourceSum of SquaresDFMean SquareF ValueProb > F
(a) Monophenolase inhibitory activity (Y)
Model20.668161.29220.447<0.0001
X21.67811.67826.5630.0003
X30.00910.0090.1390.7167
X44.15514.15565.766<0.0001
X220.07510.0751.1890.2988
X321.46911.46923.2600.0005
X420.25810.2584.0790.0685
X2X31.72811.72827.3460.0003
X2X40.97310.97315.3960.0024
X3X40.87310.87313.8120.0034
X22X31.48911.48923.5720.0005
X22X41.22211.22219.3420.0011
X2X325.10715.10780.846<0.0001
X2X420.21710.2173.4420.0905
X32X42.02412.02432.0380.0001
X3X420.00510.0050.0710.7943
X2X3X40.07310.0731.1480.3069
Residual0.695110.063
Lack of Fit0.44760.0751.5070.3348
Pure Error0.24750.049
Cor Total21.36227
R20.967
Adjusted R20.920
C.V.4.611
(b) Diphenolase inhibitory activity (Z)
Model6.078140.43413.106<0.0001
X20.18510.1855.5730.0345
X30.07110.0712.1430.1669
X40.51910.51915.6580.0016
X220.01010.0100.3160.5833
X321.28311.28338.730<0.0001
X420.21410.2146.4540.0246
X2X30.23510.2357.1040.0194
X2X40.38510.38511.6320.0046
X3X40.25810.2587.7990.0152
X22X30.26310.2637.9390.0145
X22X41.06011.06031.990<0.0001
X2X321.77111.77153.473<0.0001
X3X420.31410.3149.4810.0088
X2X3X40.04010.0401.1980.2936
Residual0.431130.033
Lack of Fit0.31580.0391.6960.2906
Pure Error0.11650.023
Cor Total6.50827
R20.934
Adjusted R20.863
C.V.2.996
Table 4. List of potential biologically active egg white-derived peptides shortlisted for (a) monophenolase and (b) diphenolase inhibitory activities using PeptideRanker web server and their potential binding sites on mushroom tyrosinase predicted using PepSite 2 web server.
Table 4. List of potential biologically active egg white-derived peptides shortlisted for (a) monophenolase and (b) diphenolase inhibitory activities using PeptideRanker web server and their potential binding sites on mushroom tyrosinase predicted using PepSite 2 web server.
No.Peptide SequenceEgg Protein FragmentPeptide LengthPotential Binding Sites of Mushroom Tyrosinase (PDB ID: 2Y9X)PepSite 2 p-Value
(a) Monophenolase inhibitory activity
1ADHPFOvalbumin5Y140, K389, H390 0.002658
2AFKDEDTKAMPFOvalbumin12N22, F135, D137, Y140. R301, P366, D367, W386, H390, Y3910.02053
3ILELPFASGDLLMLOvalbumin-related protein X14Y36, L40, F54, G58, H61, H85, F90, H94, W101, Q133, H259, H263, M280, H285, A286, A287, F288, D289, P290, F292, W293, H2960.03464
4DKLPGFGDOvalbumin8Y140, P370, Y382, W386, K389, H3900.05277
5FDKLPGFGDOvalbumin9Y140, P370, Y382, W386, K389, H3900.0722
6FDKLPGFGDSIEAQCGTSVNOvalbumin20Y140, T233, R301, M309, D367, P370, Y382, N384, W386, H388, K389, H3900.08107
7DGSGGCIPKOvomucin9N22, F135, D137, Y140, R301, D367, Y382, W386, K389, H3900.1274
(b) Diphenolase inhibitory activity
1SDFHLFGPPGKOvotransferrin11Y140, R301, D367, Y382, W386, H3900.009412
2FDGRSROvomucin6D137, R301, P366, D367, W386, H390, Y3910.01312
3FNCSSAGPGAIGSECOvomucin15N22, F135, D137, Y140, R301, P366, D367, W386, H390, Y3910.01614
4MYQIGLFROvalbumin8D137, Y140, R301, D367, P370, Y382, W386, H390, Y3910.01832
5GYSLGNWVCAAKLysozyme12H61, N81, Y82, C83, T84, H85, F90, W93, H94, R95, Y97, E98, E256, H259, H263, M280, V283, A286, A287, F292, W293, H2960.01891
6DLLFKDSAIMLKOvotransferrin12D137, Y140, R301, D367, Y382, W386, K389, H390, Y3910.02538
7CQLCQGSGGIPPEKOvotransferrin14D137, Y140, R301, P366, D367, Y382, W386, H390, Y3910.02578
8ADHPFLFOvalbumin7Y140, R301, P366, D367, F368, P370, W386, H3900.03051
9SGAFHCLKOvotransferrin8Y140, Y382, W386, H3900.03994
10YFGYTGALRCLVOvotransferrin12H61, H85, H94, Y97, Y140, H259, H263, M280, V283, A287, F292, W293, H295, H296, V299, R301, D367, Y382, W386, H3900.04488
11HIATNAVLFFGROvalbumin12G58, H61, C83, H85, F90, Typ93, H94, Y97, D137, Y140, H259, H263, M280, H285, A286, A287, F288, D289, F292, W293, H296, R301, D367, W386, H390, Y3910.04707
12FKDEDTQAMPFROvalbumin12D137, Y140, R301, P366, D367, W386, H390, Y3910.05594
13FMMFESQNKDLLFKOvotransferrin14H61, N81, Y82, C83, T84, H85, F90, W93, H94, Y97, D137, Y140, H259, H263, M280, A286, A287, F292, W293, H296, R301, P366, D367, W386, H390, Y3910.06287
14FDKLPGFGDOvalbumin9Y140, P370, Y382, W386, K389, H3900.0722
15SMLVLLPDEVSGLEQLESIINFEKOvalbumin24D137, Y140, R301, D367, P370, Y382, W386, K389, H390, Y3910.08195
16SGYSGAFHCLKOvotransferrin11Y140, R301, P366, D367, Y382, W386, H3900.0849
17SGGQFSLTSTVKVCOvomucin14D137, Y140, R301, D367, W386, H390, Y3910.08667
18SGALHCLKOvotransferrin8H61, N81, Y82, C83, T84, H85, W93, H94, R95, Y97, E98, H259, H263, A286, A287, F292, W293, H2960.1247
19SSCICSOvomucin6N22, F135, D137, R301, P366, D367, W386, H3900.1938
20SSCEDCVCTOvomucin9D137, Y140, R301, D367, W386, H390, Y3910.2086
21YFGYTGALROvotransferrin9H61, H85, H94, Y97, H259, H263, M280, V283, A286, Als287, F292, W293, H295, H296, V2990.2364
Note: Underlined residues are actively involved in binding interaction with mushroom tyrosinase; Residues in bold indicate mushroom tyrosinase hotspots; Residues in italics indicate stabilizing residues.

Share and Cite

MDPI and ACS Style

Yap, P.-G.; Gan, C.-Y. Chicken Egg White—Advancing from Food to Skin Health Therapy: Optimization of Hydrolysis Condition and Identification of Tyrosinase Inhibitor Peptides. Foods 2020, 9, 1312. https://doi.org/10.3390/foods9091312

AMA Style

Yap P-G, Gan C-Y. Chicken Egg White—Advancing from Food to Skin Health Therapy: Optimization of Hydrolysis Condition and Identification of Tyrosinase Inhibitor Peptides. Foods. 2020; 9(9):1312. https://doi.org/10.3390/foods9091312

Chicago/Turabian Style

Yap, Pei-Gee, and Chee-Yuen Gan. 2020. "Chicken Egg White—Advancing from Food to Skin Health Therapy: Optimization of Hydrolysis Condition and Identification of Tyrosinase Inhibitor Peptides" Foods 9, no. 9: 1312. https://doi.org/10.3390/foods9091312

APA Style

Yap, P.-G., & Gan, C.-Y. (2020). Chicken Egg White—Advancing from Food to Skin Health Therapy: Optimization of Hydrolysis Condition and Identification of Tyrosinase Inhibitor Peptides. Foods, 9(9), 1312. https://doi.org/10.3390/foods9091312

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop