Structure-Based Screening of Antiviral Candidates Against Infectious Spleen and Kidney Necrosis Virus (ISKNV) Using Molecular Docking and In Vitro Evaluation
Abstract
1. Introduction
2. Materials and Methods
2.1. Platform for Molecular Modeling
2.2. Ligand Preparation
2.3. Selection and Sequence Preparation of ISKNV Target Proteins
2.4. Protein Structure Prediction, Preparation, SiteMap Analysis, and Receptor Grid Generation
2.5. Molecular Docking and Interaction Analysis
2.6. Cell Culture and Compounds
2.7. Cytotoxicity Assay
2.8. Analysis of Viral Gene Expression Following Compound Treatment
2.9. Determination of Viral Titers Following Compound Treatment
2.10. Time-Course Analysis of Cytopathic Effects and Extracellular Viral Load
3. Results
3.1. Selection of ISKNV Target Proteins and Molecular Docking Analysis
3.2. Representative Ligand–Protein Interaction Analysis
3.3. Cytotoxicity of Selected Compounds on DGF Cells
3.4. Antiviral Effects of Selected Compounds on ISKNV Viral Gene Expression
3.5. Effects of Treatments on Infectious ISKNV Production
3.6. Time-Course of CPE Progression
3.7. Time-Course Analysis of Extracellular Viral Load
4. Discussion
5. Conclusions
Author Contributions
Funding
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
| ISKNV | Infectious spleen and kidney necrosis virus |
| RSIV | Red sea bream iridovirus |
| ORFs | Open reading frames |
| DGF | Dwarf gourami fin |
| CPE | Cytopathic effect |
| CID | Compound identifier |
| CAS | Chemical Abstracts Service |
| TFIIS | Transcription elongation factor |
| ATPase | Adenosine triphosphatase |
| MCP | Major capsid protein |
| PCR | Polymerase chain reaction |
| PBD | Protein Data Bank |
| SP | Standard precision |
| L-15 | Leibovitz’s |
| FBS | Fetal bovine serum |
| NEAA | Non-essential amino acids |
| HEPES | Hydroxyethyl piperazine ethane sulfonic acid |
| MCE | MedChemExpress |
| DMSO | Dimethyl sulfoxide |
| TCID50 | Median tissue culture infectious dose |
| PBS | Phosphate-buffered saline |
| ANOVA | Analysis of variance |
Appendix A
| Protein Name | ORF No. (AF371960) | Amino Acid Length | Amino Acid Sequence |
|---|---|---|---|
| DNA polymerase | ORF019R | 948 aa | MDSVYIYQWLYANYEVRGYGIAPNNTVVCVRVPNFKQVVYVECTDPQQHDPRSTFTQHGFRVYETPRACSLYGAKGVGTYFAARVPNYNAMRDVQETQGPFKIHESRVSKTMEFTARAGLPTVGWIQVSQRCVVTRTVTMAAKEYMVPNWRTDVRPAPDMEGVPPAKIVYFDIEVKSDHENVFPSDRDDEVIFQIGLVLCSGNTVLRTDLLSLPGRDYDDSVYQYATEGELLHAFIAYIREHEVVAVCGYNIMGFDIPYIIKRCARTSMLGTLRRIGFDNRRLAIEKTAGVGHAKMTYIQWEGVLTIDLMPIIMMDHKLDSYSLDYVANHFVKAGKDPIRPRDIFHAYNTGMMAPVGAYWLKEPQLCKQLVDYLNTWVALCEMAGVCNTSIMQLFTQGQQVRVFAQIYRDCTPMDVVDKVYVIPDGGCDSDVVSPSSYTGAYVYEPVPGVYKNVIPMDFQSLYPSIIISKNICYSTLVDQGGEEYAWQEHEGCEHDPQYAKQHALGIEIGVLQCNMAALPRRATQERARLRERIADMKIQYASMTPAAVKCNVFSFRFTHAHEGVLPRVLRNLLESRARIRARIKTTDDPDIRAVLDKRQLAYKISANSVYGTMGTQRGYLPFMAGAMTTTYCGRKLIEKAAHLLKTVVGATIVYGDTDSCYIQLGHDRASLDELWQMAVNASDTVSAFFERPVRLEFEQCIYTKFIIFTKKRYVYRAFTRDGKQRTGSKGVMLSRRDSAMCARNTYAAIMNTILEGSADVPFIAACMMHDMMIPGALQDDDFVLTKSVQDIGNGDDNNQGSYKVRNPQKAQAAATQRVAPDDAEGYAIALRQEMVKQMPAQAQLAERMRLQGRAVVSGARIEYVVLKHQYGVPEGALGARLLDFERWREMKVAYPLDRLYYMKSVVNACDQLLVTAGYGPVCSKVYAAHLQLAYVHKQLLRRTTPAV * |
| TFIIS | ORF029L | 73 aa | MYTCTTMNKDLYDKEAEQDRLARTRFSSLTQSQYLCRACGNAKTYTLTMQTRGGDEALSVFVCCVACGKRYRI* |
| ATPase | ORF122R | 239 aa | MEIKELSLTELRPVKPDDEMGGMKLIVLGKPQRGKSVLIKSIIAAKRHIIPAAVVISGSEEANHFYSKLLPNCFVYNKFDADIITRVKQRQLALKNVDPEHSWLMLIFDDCMDNAKMFNHEAVMDLFKNGRHWNVLVIIASQYIMDLNASLRCCIDGVFLFTETSQTCVDKIYKQFGGNIPKQTFHTLMEKVTQDHTCLYIDNTTTRQKWEDMVRYYKAPLLTDADVGFGFKDYKAGVA* |
| Ankyrin repeat-containing protein | ORF125L | 228 aa | MLPEELAGALRTGGSNGQSILFDAIRSGTITAFTGVHADIVNTVREHSTGNTLLMAAVMTRDLLIIKHVVENLGYNTFMGMRLSDHATALHLVACLADPYHGCVRYLLTQYGAQMAPALTMTTNEDDMNPLHYACKYGGVQTMVLLATVMSQYDGFAQACFALNASLAQPALLALHYDELGGAQKAFILDSVAPLQERWNGHNVARLIRGDHNLTWFLMARNNKDFFA* |
| MCP | ORF006L | 453 aa | MSAISGANVTSGFIDISAFDAMETHLYGGDNAVTYFARETVRSSWYSKLPVTLSKQTGHANFGQEFSVTVARGGDYLINVWLRVKIPSITSSKENSYIRWCDNLMHNLVEEVSVSFNDLVAQTLTSEFLDFWNACMMPGSKQSGYNKMIGMRSDLVAGITNGQTMPAVYLNLPIPLFFTRDTGLALPTVSLPYNEVRIHFKLRRWEDLLISQSNQADMAISTVTLANIGNVAPALTNVSVMGTYAVLTSEEREVVAQSSRSMLIEQCQVAPRVPVTPADNSLVHLDLRFSHPVKALFFAVKNVTHRNVQSNYTAASPVYVNNKVNLPLMATNPLSEVSLIYENTPRLHQMGVDYFTSVDPYYFAPSMPEMDGVMTYCYTLDMGNINPMGSTNYGRLSNVTLSCKVSDNAKTTAAGGGDNGSGYTVAQKFELVVIAVNHNIMKIADGAAGFPIL* |
Appendix B

References
- He, J.G.; Deng, M.; Weng, S.P.; Li, Z.; Zhou, S.Y.; Long, Q.X.; Wang, X.Z.; Chan, S.M. Complete genome analysis of the mandarin fish infectious spleen and kidney necrosis iridovirus. Virology 2001, 291, 126–139. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kurita, J.; Nakajima, K. Megalocytiviruses. Viruses 2012, 4, 521–538. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Subramaniam, K.; Shariff, M.; Omar, A.R.; Hair-Bejo, M. Megalocytivirus infection in fish. Rev. Aquac. 2012, 4, 221–233. [Google Scholar] [CrossRef] [Scilit]
- Jung-Schroers, V.; Adamek, M.; Wohlsein, P.; Wolter, J.; Wedekind, H.; Steinhagen, D. First outbreak of an infection with infectious spleen and kidney necrosis virus (ISKNV) in ornamental fish in Germany. Dis. Aquat. Org. 2016, 119, 239–244. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Choi, S.W.; Jeong, Y.J.; Jeong, Y.S.; Kim, K.I. Genetic and pathogenic characteristics of infectious spleen and kidney necrosis virus isolated from dwarf gourami (Trichogaster lalius) imported into Korea. Aquaculture 2024, 593, 741297. [Google Scholar] [CrossRef] [Scilit]
- He, J.G.; Weng, S.P.; Huang, Z.J.; Zeng, K. Identification of outbreak and infectious diseases pathogen of Siniperca chuatsi. Acta Sci. Nat. Univ. Sunyatseni 1998, 5, 74–77. [Google Scholar]
- Girisha, S.K.; Kushala, K.B.; Nithin, M.S.; Puneeth, T.G.; Naveen Kumar, B.T.; Vinay, T.N.; Suresh, T.; Ajay, S.K.; Venugopal, M.N.; Ramesh, K.S. First report of the infectious spleen and kidney necrosis virus (ISKNV) infection in ornamental fishes in India. Transbound. Emerg. Dis. 2021, 68, 964–972. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mohr, P.G.; Moody, N.J.; Williams, L.M.; Hoad, J.; Cummins, D.M.; Davies, K.R.; Crane, M.S. Molecular confirmation of infectious spleen and kidney necrosis virus (ISKNV) in farmed and imported ornamental fish in Australia. Dis. Aquat. Org. 2015, 116, 103–110. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ramírez-Paredes, J.G.; Paley, R.K.; Hunt, W.; Feist, S.W.; Stone, D.M.; Field, T.R.; Haydon, D.J.; Ziddah, P.A.; Nkansa, M.; Guilder, J.; et al. First detection of infectious spleen and kidney necrosis virus (ISKNV) associated with massive mortalities in farmed tilapia in Africa. Transbound. Emerg. Dis. 2021, 68, 1550–1563. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yanong, R.P.; Waltzek, T.B. Megalocytivirus infections in fish, with emphasis on ornamental species. EDIS 2013, 2013, FA182. [Google Scholar] [CrossRef] [Scilit]
- Jeong, J.B.; Kim, H.Y.; Jun, L.J.; Lyu, J.H.; Park, N.G.; Kim, J.K.; Do Jeong, H. Outbreaks and risks of infectious spleen and kidney necrosis virus disease in freshwater ornamental fishes. Dis. Aquat. Org. 2008, 78, 209–215. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Caipang, C.M.A.; Takano, T.; Hirono, I.; Aoki, T. Genetic vaccines protect red seabream, Pagrus major, upon challenge with red seabream iridovirus (RSIV). Fish. Shellfish Immunol. 2006, 21, 130–138. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dong, C.; Xiong, X.; Luo, Y.; Weng, S.; Wang, Q.; He, J. Efficacy of a formalin-killed cell vaccine against infectious spleen and kidney necrosis virus (ISKNV) and immunoproteomic analysis of its major immunogenic proteins. Vet. Microbiol. 2013, 162, 419–428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhang, M.; Hu, Y.H.; Xiao, Z.Z.; Sun, Y.; Sun, L. Construction and analysis of experimental DNA vaccines against megalocytivirus. Fish. Shellfish Immunol. 2012, 33, 1192–1198. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Nakajima, K.; Ito, T.; Kurita, J.; Kawakami, H.; Itano, T.; Fukuda, Y.; Aoi, Y.; Tooriyama, T.; Manabe, S. Effectiveness of a vaccine against red sea bream iridoviral disease in various cultured marine fish under laboratory conditions. Fish. Pathol. 2002, 37, 90–91. [Google Scholar] [CrossRef] [Scilit]
- Nakajima, K.; Maeno, Y.; Kurita, J.; Inui, Y. Vaccination against red sea bream iridoviral disease in red sea bream. Fish. Pathol. 1997, 32, 205–209. [Google Scholar] [CrossRef] [Scilit]
- Strang, B.L. Toward inhibition of human cytomegalovirus replication with compounds targeting cellular proteins. J. General. Virol. 2022, 103, 001795. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pushpakom, S.; Iorio, F.; Eyers, P.A.; Escott, K.J.; Hopper, S.; Wells, A.; Doig, A.; Guilliams, T.; Latimer, J.; McNamee, C.; et al. Drug repurposing: Progress, challenges and recommendations. Nat. Rev. Drug Discov. 2019, 18, 41–58. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Talluri, S. Molecular docking and virtual screening based prediction of drugs for COVID-19. Comb. Chem. High Throughput Screen. 2021, 24, 716–728. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Roy, U. Structural evaluation of interleukin-19 cytokine and interleukin-19-bound receptor complex using computational immuno-engineering approach. Targets 2024, 2, 385–395. [Google Scholar] [CrossRef] [Scilit]
- Elfiky, A.A. Ribavirin, Remdesivir, Sofosbuvir, Galidesivir, and Tenofovir against SARS-CoV-2 RNA dependent RNA polymerase (RdRp): A molecular docking study. Life Sci. 2020, 253, 117592. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sahoo, M.; Jena, L.; Rath, S.N.; Kumar, S. Identification of suitable natural inhibitor against influenza A (H1N1) neuraminidase protein by molecular docking. Genom. Inform. 2016, 14, 96. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, H.C.; Zhang, Q.X.; Zhao, J.; Wei, N.N. Molecular docking and molecular dynamics simulations studies on the protective and pathogenic roles of the amyloid-β peptide between herpesvirus infection and Alzheimer’s disease. J. Mol. Graph. Model. 2022, 113, 108143. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lima, A.R.; Silva, J.; Bezerra, L.L.; Marinho, M.M.; Marinho, E.S. Molecular docking of potential curcuminoids inhibitors of the NS1 protein of dengue virus. Int. J. Sci. Eng. Res. 2017, 8, 861–868. [Google Scholar]
- Khang, L.T.P.; Dinh-Hung, N.; Islam, S.I.; Dwinanti, S.H.; Mwamburi, S.M.; Permpoonpattana, P.; Linh, N.V. A review of in silico approaches for discovering natural viral protein inhibitors in aquaculture disease control. J. Fish. Dis. 2025, 48, e14120. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ghasemi, J.B.; Abdolmaleki, A.; Shiri, F. Molecular docking challenges and limitations. In Pharmaceutical Sciences: Breakthroughs in Research and Practice; IGI Global Scientific Publishing: Hershey, PA, USA, 2017; pp. 770–794. [Google Scholar] [CrossRef] [Scilit]
- Power, H.; Wu, J.; Turville, S.; Aggarwal, A.; Valtchev, P.; Schindeler, A.; Dehghani, F. Virtual screening and in vitro validation of natural compound inhibitors against SARS-CoV-2 spike protein. Bioorg. Chem. 2022, 119, 105574. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Eaton, H.E.; Metcalf, J.; Penny, E.; Tcherepanov, V.; Upton, C.; Brunetti, C.R. Comparative genomic analysis of the family Iridoviridae: Re-annotating and defining the core set of iridovirus genes. Virol. J. 2007, 4, 11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Guo, C.J.; Chen, W.J.; Yuan, L.Q.; Yang, L.S.; Weng, S.P.; Yu, X.Q.; He, J.G. The viral ankyrin repeat protein (ORF124L) from infectious spleen and kidney necrosis virus attenuates nuclear factor-κ B activation and interacts with I κ B kinase β. J. General. Virol. 2011, 92, 1561–1570. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jeong, Y.J.; Kim, K.I. A new cell line derived from the caudal fin of the dwarf gourami (Trichogaster lalius) and its susceptibility to fish viruses. Biology 2023, 12, 829. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Baek, E.J.; Choi, H.D.; Kim, K.I. Screening of potential antiviral compounds and in vitro evaluation of 5-fluorouracil, ganciclovir, ethyl ferulate, and saponin against infectious spleen and kidney necrosis virus (ISKNV). J. Fish. Pathol. 2025, 38, 11–29. [Google Scholar] [CrossRef]
- Rao, X.; Huang, X.; Zhou, Z.; Lin, X. An improvement of the 2–∆∆CT method for quantitative real-time polymerase chain reaction data analysis. Biostat. Bioinform. Biomath. 2013, 3, 71. [Google Scholar]
- Jin, J.W.; Kim, K.I.; Kim, J.K.; Park, N.G.; Do Jeong, H. Dynamics of megalocytivirus transmission between bivalve molluscs and rock bream Oplegnathus fasciatus. Aquaculture 2014, 428, 29–34. [Google Scholar] [CrossRef] [Scilit]
- Kim, G.H.; Kim, M.J.; Choi, H.J.; Koo, M.J.; Kim, M.J.; Min, J.G.; Kim, K.I. Evaluation of a novel TaqMan probe-based real-time polymerase chain reaction (PCR) assay for detection and quantitation of red sea bream iridovirus. Fish. Aquat. Sci. 2021, 24, 351–359. [Google Scholar] [CrossRef] [Scilit]
- Reed, L.J.; Muench, H. A Simple Method of Estimating Fifty per Cent Endpoints. Am. J. Epidemiol. 1938, 27, 493–497. [Google Scholar] [CrossRef] [Scilit]
- Wei, X.; Gao, M.; Sheng, N.; Yao, W.; Bao, B.; Cheng, F.; Cao, Y.; Yan, H.; Zhang, L.; Shan, M.; et al. Mechanism investigation of Shi-Xiao-San in treating blood stasis syndrome based on network pharmacology, molecular docking and in vitro/vivo pharmacological validation. J. Ethnopharmacol. 2023, 301, 115746. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Shen, L.; Zhao, J.; Xia, Y.; Lu, J.; Sun, J.; Tang, J.; Xing, H.; Yin, L.; Yang, Y.; Wang, C. Lycorine derivative effectively inhibits the replication of coronaviruses both in vitro and in vivo. hLife 2024, 2, 75–87. [Google Scholar] [CrossRef] [Scilit]
- Liu, J.; Yang, Y.; Xu, Y.; Ma, C.; Qin, C.; Zhang, L. Lycorine reduces mortality of human enterovirus 71-infected mice by inhibiting virus replication. Virol. J. 2011, 8, 483. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Agrawal, T.; Siddqui, G.; Dahiya, R.; Patidar, A.; Madan, U.; Das, S.; Asthana, S.; Samal, S.; Awasthi, A. Inhibition of early RNA replication in Chikungunya and Dengue virus by lycorine: In vitro and in silico studies. Biochem. Biophys. Res. Commun. 2024, 730, 150393. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Renard-Nozaki, J.; Kim, T.; Imakura, Y.; Kihara, M.; Kobayashi, S. Effect of alkaloids isolated from Amaryllidaceae on herpes simplex virus. Res. Virol. 1989, 140, 115–128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hood, M.A.; Finley, R.S. Fludarabine: A review. Dicp 1991, 25, 518–524. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gandhi, V.; Plunkett, W. Cellular and clinical pharmacology of fludarabine. Clin. Pharmacokinet. 2002, 41, 93–103. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Christopherson, R.I.; Mactier, S.; Almazi, J.G.; Kohnke, P.L.; Best, O.G.; Mulligan, S.P. Mechanisms of action of fludarabine nucleoside against human Raji lymphoma cells. Nucleosides Nucleotides Nucleic Acids 2014, 33, 375–383. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhu, J.; Deng, Y.Q.; Wang, X.; Li, X.F.; Zhang, N.N.; Liu, Z.; Zhang, B.; Qin, C.F.; Xie, Z. An artificial intelligence system reveals liquiritin inhibits SARS-CoV-2 by mimicking type I interferon. bioRxiv 2020. [Google Scholar] [CrossRef] [Scilit]
- Sun, Y.X.; Tang, Y.; Wu, A.L.; Liu, T.; Dai, X.L.; Zheng, Q.S.; Wang, Z.B. Neuroprotective effect of liquiritin against focal cerebral ischemia/reperfusion in mice via its antioxidant and antiapoptosis properties. J. Asian Nat. Prod. Res. 2010, 12, 1051–1060. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yu, J.Y.; Ha, J.Y.; Kim, K.M.; Jung, Y.S.; Jung, J.C.; Oh, S. Anti-inflammatory activities of licorice extract and its active compounds, glycyrrhizic acid, liquiritin and liquiritigenin, in BV2 cells and mice liver. Molecules 2015, 20, 13041–13054. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, Y.; Beyer, A.; Aebersold, R. On the dependency of cellular protein levels on mRNA abundance. Cell 2016, 165, 535–550. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Cortazzo da Silva, L.; Aoki, J.I.; Floeter-Winter, L.M. Finding correlations between mRNA and protein levels in leishmania development: Is there a discrepancy? Front. Cell. Infect. Microbiol. 2022, 12, 852902. [Google Scholar] [CrossRef] [Scilit] [PubMed]






| No. | Compound Category | Compound Name | PubChem CID | CAS No. | Molecular Formula | Biological Use |
|---|---|---|---|---|---|---|
| 1 | FDA-approved chemical compound | 5-Fluorouracil | 3385 | 51-21-8 | C4H3FN2O2 | Anti-cancer |
| 2 | Abacavir sulfate | 441384 | 188062-50-2 | C28H38N12O6S | HIV | |
| 3 | Adefovir dipivoxil | 60871 | 142340-99-6 | C20H32N5O8P | HBV | |
| 4 | Aluminum hydroxide | 10176082 | 21645-51-2 | AlH3O3 | Antacid/Vaccine adjuvant | |
| 5 | Amantadine | 2130 | 768-94-5 | C10H17N | Influenza/Antiviral | |
| 6 | Amodiaquine | 2165 | 86-42-0 | C20H22ClN3O | Malaria | |
| 7 | Amprenavir | 65016 | 161814-49-9 | C25H35N3O6S | HIV protease inhibitor | |
| 8 | Atovaquone | 74989 | 94015-53-9 | C22H19ClO3 | Malaria/Antiparasitic | |
| 9 | Atovaquone/proguanil | 67439664 | 156879-69-5 | C33H36Cl3N5O3 | Malaria | |
| 10 | Baloxavir marboxil | 124081896 | 1985606-14-1 | C27H23F2N3O7S | Influenza | |
| 11 | Bictegravir | 90311989 | 1611493-60-7 | C21H18F3N3O5 | HIV integrase inhibitor | |
| 12 | Chloroquine | 2719 | 54-05-7 | C18H26ClN3 | Malaria | |
| 13 | Cytarabine | 6253 | 147-94-4 | C9H13N3O5 | Anticancer | |
| 14 | Darunavir | 213039 | 206361-99-1 | C27H37N3O7S | HIV protease inhibitor | |
| 15 | Didanosine | 135398739 | 69655-05-6 | C10H12N4O3 | HIV | |
| 16 | Dolutegravir | 54726191 | 1051375-16-6 | C20H19F2N3O5 | HIV integrase inhibitor | |
| 17 | Emtricitabine | 60877 | 143491-57-0 | C8H10FN3O3S | HIV/HBV | |
| 18 | Famciclovir | 3324 | 104227-87-4 | C14H19N5O4 | Herpesvirus | |
| 19 | Fludarabine | 657237 | 21679-14-1 | C10H12FN5O4 | Anticancer | |
| 20 | Ganciclovir | 135398740 | 82410-32-0 | C9H13N5O4 | CMV/Herpesvirus | |
| 21 | Halofantrine | 37393 | 69756-53-2 | C26H30Cl2F3NO | Malaria | |
| 22 | Lamivudine | 60825 | 134678-17-4 | C8H11N3O3S | HIV/HBV | |
| 23 | Lopinavir | 92727 | 192725-17-0 | C37H48N4O5 | HIV protease inhibitor | |
| 24 | Lumefantrine | 6437380 | 82186-77-4 | C30H32Cl3NO | Malaria | |
| 25 | Maraviroc | 483925835 | 376348-65-1 | C29H41F2N5O | HIV entry inhibitor | |
| 26 | Mefloquine | 40692 | 51742-87-1 | C17H16F6N2O | Malaria | |
| 27 | Oseltamivir | 65028 | 196618-13-0 | C16H28N2O4 | Influenza | |
| 28 | Primaquine | 4908 | 90-34-6 | C15H21N3O | Malaria | |
| 29 | Proguanil | 6178111 | 500-92-5 | C11H16ClN5 | Malaria | |
| 30 | Sofosbuvir | 45375808 | 1190307-88-0 | C22H29FN3O9P | HCV | |
| 31 | Sulfadoxine | 17134 | 2447-57-6 | C12H14N4O4S | Malaria | |
| 32 | Tecovirimat | 16124688 | 869572-92-9 | C19H15F3N2O3 | Orthopoxvirus/Smallpox | |
| 33 | Tenofovir | 464205 | 147127-20-6 | C9H14N5O4P | HIV/HBV | |
| 34 | Zalcitabine | 24066 | 7481-89-2 | C9H13N3O3 | HIV | |
| 35 | Zidovudine | 35370 | 30516-87-1 | C10H13N5O4 | HIV | |
| 36 | Non-FDA- approved chemical compound | MLN4924 (Pevonedistat) | 16720766 | 905579-51-3 | C21H25N5O4S | Experimental anticancer compound |
| 37 | N-acetylcysteine amide | 10176265 | 38520-57-9 | C5H10N2O2S | Antioxidant derivative compound | |
| 38 | Ritiometan | 65787 | 34914-39-1 | C7H10O6S3 | Experimental compound | |
| 39 | Rupintrivir | 6440352 | 223537-30-2 | C31H39FN4O7 | Experimental antiviral compound | |
| 40 | FDA-approved natural product-derived compound | Artemether | 68911 | 71963-77-4 | C16H26O5 | Malaria |
| 41 | Artemisinin | 68827 | 63968-64-9 | C15H22O5 | Malaria | |
| 42 | Artenimol | 3000518 | 71939-50-9 | C15H24O5 | Malaria | |
| 43 | Artesunate | 6917864 | 88495-63-0 | C19H28O8 | Malaria | |
| 44 | Quinine | 3034034 | 130-95-0 | C20H24N2O2 | Malaria | |
| 45 | Squalene | 638072 | 111-02-4 | C30H50 | Vaccine adjuvant/Natural lipid | |
| 46 | Non-FDA- approved natural product-derived compound | (−)-Epigallocatechin gallate | 65064 | 989-51-5 | C22H18O11 | Polyphenol/Green tea-derived compound |
| 47 | 24-Ethylcholest-5-en-3beta-ol | 22012 | 5779-62-4 | C29H50O | Phytosterol | |
| 48 | Andrograpanin | 11666871 | 82209-74-3 | C20H30O3 | Andrographis-derived diterpenoid | |
| 49 | Andrographiside | 44593583 | 82209-76-5 | C26H40O10 | Andrographis-derived compound | |
| 50 | Apigetrin (Cosmosiin) | 5280704 | 578-74-5 | C21H20O10 | Flavonoid glycoside | |
| 51 | Arctigenin | 64981 | 7770-78-7 | C21H24O6 | Lignan phytochemical | |
| 52 | Baicalin | 64982 | 21967-41-9 | C21H18O11 | Flavonoid | |
| 53 | Berberine | 2353 | 2086-83-1 | C20H18NO4+ | Isoquinoline alkaloid | |
| 54 | Betulonal | 473111 | 4439-98-9 | C30H46O2 | Triterpenoid | |
| 55 | Cerevisterol | 10181133 | 516-37-0 | C28H46O3 | Sterol | |
| 56 | Chrysin | 5281607 | 480-40-0 | C15H10O4 | Flavonoid | |
| 57 | Clivimine | 44559309 | 7096-85-7 | C43H43N3O12 | Alkaloid | |
| 58 | Ethyl ferulate | 736681 | 4046-02-0 | C12H14O4 | Phenolic ester | |
| 59 | Ferulic acid | 445858 | 1135-24-6 | C10H10O4 | Phenolic compound | |
| 60 | Fucoidan from Fucus vesiculosus | 92023653 | 9072-19-9 | C7H14O7S | Marine polysaccharide | |
| 61 | Gnidicin | 70691946 | 55319-39-6 | C36H36O10 | Natural product | |
| 62 | Hesperidin | 10621 | 520-26-3 | C28H34O15 | Flavonoid glycoside | |
| 63 | Honokiol | 72303 | 35354-74-6 | C18H18O2 | Lignan | |
| 64 | Kaempferol | 5280863 | 520-18-3 | C15H10O6 | Flavonoid | |
| 65 | Liquiritin | 503737 | 551-15-5 | C21H22O9 | Flavonoid glycoside | |
| 66 | Lycorine | 72378 | 476-28-8 | C16H17NO4 | Alkaloid | |
| 67 | Neohesperidin | 442439 | 13241-33-3 | C28H34O15 | Flavonoid glycoside | |
| 68 | Piceatannol | 667639 | 10083-24-6 | C14H12O4 | Polyphenol | |
| 69 | Rosmarinic acid | 5281792 | 20283-92-5 | C18H16O8 | Phenolic compound | |
| 70 | Theaflavine-3,3′-digallate-3,3′-digallate | 21146795 | 30462-35-2 | C43H32O20 | Tea polyphenol | |
| 71 | Ursolic acid | 64945 | 77-52-1 | C30H48O3 | Triterpenoid | |
| 72 | α-Mangostin | 5281650 | 6147-11-1 | C24H26O6 | Xanthone phytochemical |
| No. | Target Protein | ORF No. (AF371960) | Functional Category | Predicted/Known Function | Reference |
|---|---|---|---|---|---|
| 1 | DNA polymerase | ORF019R | Viral DNA replication | Catalyzes viral genome replication and is associated with DNA synthesis and proofreading | [1,28] |
| 2 | TFIIS | ORF029L | Transcription regulation | Facilitates transcription elongation and maintains RNA polymerase fidelity | [1,28] |
| 3 | ATPase | ORF122R | Viral replication/ Virion assembly | Provides energy for viral replication, DNA packaging, or virion assembly through ATP hydrolysis | [1,28] |
| 4 | Ankyrin repeat- containing protein | ORF125L | Host interaction/ Immune modulation | Mediates protein–protein interactions involved in host signaling and immune modulation | [1,29] |
| 5 | MCP | ORF006L | Viral structure | Essential structural protein forming the viral capsid and maintaining virion stability | [1,28] |
| Target Gene | ORF No. (AF371960) | Sequence (5′–3′) | Tm (°C) | Product Size (bp) |
|---|---|---|---|---|
| DNA polymerase | ORF019R | F: ATG GAT AGT GTG TAC ATC TAT CAG TGG CTC | 60 | 2847 |
| R: TCA TAC GGC AGG CGT CGT GCG TCT CAG TAA | ||||
| TFIIS | ORF029L | F: ATG TAT ACA TGT ACA | 60 | 222 |
| R: TCA AAT GCG ATA GCG | ||||
| ATPase | ORF122R | F: ATG GAA ATC AAA GAG TTG TCC TTG ACG | 60 | 720 |
| R: TTA CGC CAC GCC AGC CTT | ||||
| Ankyrin repeat- containing protein | ORF125L | F: ATG CTG CCC GAG GAG CTT | 60 | 687 |
| R: TTA GGC GAA AAA GTC TTT ATT GTT CCG GG | ||||
| MCP | ORF006L | F: ATG TCT GCA ATC TCA G | 60 | 1362 |
| R: TTA CAG GAT AGG GAA G |
| Target Protein | Site No. | Size | DScore | SiteScore | Volume | Included Sites Within Docking Grid | Pocket Volume |
|---|---|---|---|---|---|---|---|
| DNA polymerase | site 1 | 157 | 1.070 | 1.025 | 564.578 | 1, 4 | 20 |
| site 2 | 79 | 0.891 | 0.976 | 178.017 | |||
| site 3 | 73 | 0.902 | 0.888 | 197.225 | |||
| site 4 | 45 | 0.657 | 0.762 | 81.977 | |||
| site 5 | 26 | 0.509 | 0.592 | 80.605 | |||
| TFIIS | site 1 | 14 | 0.444 | 0.500 | 65.513 | 1 | 10 |
| ATPase | site 1 | 70 | 0.766 | 0.864 | 213.346 | 1 | 15 |
| site 2 | 54 | 0.505 | 0.81 | 141.659 | 2, 3, 4, 5 | 20 | |
| site 3 | 33 | 0.563 | 0.598 | 57.624 | |||
| site 4 | 22 | 0.519 | 0.58 | 49.392 | |||
| site 5 | 26 | 0.469 | 0.552 | 67.914 | |||
| Ankyrin repeat- containing protein | site 1 | 85 | 0.982 | 0.931 | 244.802 | 1, 3 | 20 |
| site 2 | 36 | 0.613 | 0.660 | 91.924 | |||
| site 3 | 35 | 0.414 | 0.648 | 79.576 | |||
| site 4 | 22 | 0.451 | 0.542 | 55.566 | |||
| MCP | site 1 | 124 | 1.052 | 1.047 | 315.56 | 1, 2, 5 | 20 |
| site 2 | 59 | 0.847 | 0.87 | 199.283 | |||
| site 3 | 41 | 0.641 | 0.824 | 73.059 | |||
| site 4 | 33 | 0.691 | 0.723 | 128.625 | |||
| site 5 | 36 | 0.588 | 0.642 | 102.557 |
| Target Gene | Purpose | Sequence (5′–3′) | Conditions | Reference |
|---|---|---|---|---|
| MCP | mRNA expression | F: GGC GAC TAC CTC ATT AAT GT | 95 °C, 10 min; (95 °C, 20 s; 52 °C, 1 min) × 40 | [33] |
| R: CCA CCA GGT CGT TAA ATG A | ||||
| ATPase | mRNA expression | F: ATA ATT CCC GCG GCC GTC | 95 °C, 10 min; (95 °C, 20 s; 60 °C, 1 min) × 40 | [31] |
| R: CTC GGG GTC CAC GTT CTT | ||||
| DNA polymerase | mRNA expression | F: GTT TAT GGC GGG GGC AAT | [30] | |
| R: TGG CCC AGC TGT ATG TAG C | ||||
| β-actin | mRNA expression | F: TAG CCA CGC TCT GTC AGG AT | [30] | |
| R: ACC ACC GGT ATT GTC ATG GA | ||||
| MCP | Viral quantification | F: CCA GCA TGC CTG AGA TGG A | 95 °C, 10 min; (94 °C, 10 s; 60 °C, 35 s) × 40 | [34] |
| R: GTC CGA CAC CTT ACA TGA CAG G | ||||
| P: FAM-TAC GGC CGC CTG TCC AAC G-BHQ1 |
| Compound Name | DNA Polymerase | TFIIS | ATPase 1 | ATPase 2 | Ankyrin Repeat- Containing Protein | MCP | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | |
| 5-Fluorouracil | −6.26 | −29.26 | −5.12 | −27.44 | −4.13 | −26.35 | −3.87 | −39.93 | −4.47 | −27.91 | −6.19 | −35.56 |
| Abacavir sulfate | −5.62 | −44.74 | −4.65 | −38.68 | −4.58 | −40.52 | −4.09 | −36.06 | −3.58 | −37.82 | −5.61 | −50.35 |
| Adefovir Dipivoxil | −3.62 | −35.62 | - | - | −3.33 | −49.58 | −3.47 | −49.99 | −2.07 | −41.89 | −5.62 | −69.31 |
| Amantadine | −4.11 | −20.35 | −4.44 | −23.86 | −3.65 | −21.55 | - | - | −3.72 | −21.97 | −5.52 | −35.86 |
| Amodiaquine | −6.43 | −60.62 | −4.48 | −44.79 | −4.38 | −49.69 | −4.03 | −51.37 | −3.73 | −47.75 | −4.34 | −54.05 |
| Amprenavir | −6.02 | −51.69 | −3.14 | −34.24 | −3.32 | −39.23 | −3.11 | −38.68 | −2.47 | −35.11 | −4.88 | −52.25 |
| Atovaquone | −5.66 | −43.69 | −4.37 | −38.93 | −2.95 | −33.16 | −2.9 | −29.8 | −2.10 | −17.93 | −4.24 | −36.95 |
| Atovaquone/proguanil | −5.66 | −43.69 | −4.37 | −38.93 | −2.95 | −33.16 | −2.9 | −29.8 | −2.10 | −17.93 | −4.24 | −36.95 |
| Baloxavir Marboxil | −4.80 | −46.44 | −3.57 | −39.63 | −3.49 | −43.29 | −2.22 | −31.33 | −2.56 | −39.26 | −3.70 | −53.30 |
| Bictegravir | −5.55 | −53.38 | −3.91 | −45.98 | −3.10 | −38.34 | −3.28 | −49.84 | −3.23 | −41.12 | −5.68 | −61.81 |
| Chloroquine | −3.91 | −30.27 | −4.10 | −31.22 | −4.39 | −38.37 | −3.73 | −43.67 | −4.26 | −43.49 | −6.27 | −57.05 |
| Cytarabine | −5.77 | −41.45 | −5.06 | −38.40 | −6.08 | −49.99 | −4.93 | −41.00 | −4.55 | −34.72 | −7.97 | −59.00 |
| Darunavir | −6.61 | −61.67 | −3.89 | −38.40 | −3.41 | −39.11 | −3.13 | −38.82 | −3.00 | −40.96 | −4.40 | −46.90 |
| Didanosine | −4.81 | −42.29 | −4.69 | −35.13 | −5.84 | −47.79 | −4.27 | −38.27 | −3.79 | −30.30 | −7.60 | −56.28 |
| Dolutegravir | −5.41 | −44.82 | −4.13 | −44.87 | −4.24 | −51.18 | −3.09 | −41.27 | −3.78 | −47.56 | −5.83 | −55.86 |
| Emtricitabine | −5.73 | −38.19 | −4.73 | −27.62 | −5.66 | −48.88 | −3.88 | −33.03 | −3.34 | −29.62 | −7.34 | −49.88 |
| Famciclovir | −4.68 | −38.69 | −3.64 | −32.15 | −4.22 | −45.98 | −2.98 | −33.96 | −2.81 | −38.25 | −5.45 | −57.53 |
| Fludarabine | −6.48 | −46.42 | −5.11 | −39.17 | −5.48 | −49.01 | −5.68 | −52.06 | −4.57 | −34.15 | −6.78 | −52.95 |
| Ganciclovir | −4.85 | −45.72 | −4.84 | −41.01 | −5.30 | −52.14 | −3.77 | −41.39 | −3.66 | −34.54 | −7.11 | −63.73 |
| Halofantrine | −6.71 | −57.80 | −3.17 | −31.59 | −3.62 | −44.74 | −3.09 | −46.69 | −3.12 | −35.68 | −4.54 | −54.88 |
| Lamivudine | −5.81 | −42.32 | −4.89 | −33.87 | −5.68 | −46.59 | −3.90 | −32.84 | −4.65 | −31.59 | −7.43 | −53.79 |
| Lopinavir | −6.59 | −67.19 | - | - | −3.79 | −44.08 | −4.18 | −61.16 | −4.50 | −56.79 | −7.17 | −84.91 |
| Lumefantrine | −5.99 | −54.72 | −3.95 | −38.06 | −2.66 | −37.29 | −2.42 | −39.43 | −2.46 | −38.26 | −5.00 | −62.23 |
| Maraviroc | −5.25 | −41.50 | −3.06 | −29.41 | −4.13 | −49.67 | −3.50 | −45.80 | −3.32 | −33.78 | −4.62 | −53.33 |
| Mefloquine | −7.36 | −50.87 | −4.76 | −36.9 | −5.06 | −48.34 | −4.05 | −44.54 | −4.41 | −35.93 | −4.61 | −44.88 |
| Oseltamivir | −4.63 | −34.97 | −4.86 | −39.64 | −4.36 | −40.03 | −3.97 | −40.58 | −3.20 | −38.37 | −4.90 | −36.24 |
| Primaquine | −6.34 | −51.88 | −4.01 | −29.87 | −4.08 | −36.18 | −4.23 | −36.10 | −3.14 | −31.29 | −5.42 | −47.19 |
| Proguanil | −3.73 | −22.83 | −3.28 | −23.24 | −3.42 | −22.03 | −3.39 | −24.57 | −2.24 | −16.06 | −4.09 | −28.23 |
| Sofosbuvir | −6.12 | −63.06 | −4.11 | −45.41 | −4.74 | −49.09 | −3.48 | −43.52 | −3.68 | −46.41 | −6.63 | −66.17 |
| Sulfadoxine | −5.13 | −36.30 | −4.18 | −40.51 | −2.94 | −32.17 | −1.00 | −23.77 | −2.34 | −27.77 | −3.88 | −39.59 |
| Tecovirimat | −3.86 | −15.62 | −3.51 | −35.19 | −3.52 | −37.36 | −3.03 | −33.01 | −3.05 | −26.98 | −4.67 | −47.96 |
| Tenofovir | −4.23 | −42.27 | −5.26 | −48.79 | −4.36 | −48.23 | −5.07 | −66.09 | −2.95 | −37.36 | −5.10 | −46.29 |
| Zalcitabine | −5.78 | −39.23 | −4.92 | −31.42 | −6.12 | −42.38 | −3.94 | −30.29 | −4.27 | −34.42 | −7.54 | −49.09 |
| Zidovudine | −6.35 | −45.63 | −4.87 | −31.49 | −5.52 | −45.89 | −4.12 | −36.04 | −4.14 | −40.12 | −5.35 | −47.99 |
| MLN4924 (Pevonedistat) | −7.70 | −38.62 | −2.75 | −43.67 | −4.62 | −52.17 | −5.25 | −53.68 | −4.24 | −50.29 | −7.21 | −71.26 |
| N-acetylcysteine amide | −4.93 | −30.64 | −4.55 | −25.7 | −2.04 | −28.67 | −5.19 | −37.26 | −3.95 | −27.83 | −6.55 | −42.73 |
| Ritiometan | −2.99 | −33.83 | −2.29 | −27.41 | −2.29 | −33.50 | −2.97 | −39.50 | −0.57 | −16.03 | −1.30 | −21.01 |
| Rupintrivir | −7.36 | −75.11 | −1.89 | −31.22 | −4.36 | −55.75 | −5.50 | −66.86 | −4.79 | −53.67 | −5.62 | −68.19 |
| Artemether | −5.14 | −19.50 | −4.00 | −21.98 | −3.76 | −27.73 | −3.39 | −23.90 | −2.65 | −18.13 | −5.44 | −28.49 |
| Artemisinin | −5.62 | −36.63 | −4.59 | −32.22 | −4.13 | −33.18 | −5.40 | −43.61 | −3.25 | −24.81 | −6.28 | −43.42 |
| Artenimol | −5.54 | −33.43 | −4.59 | −33.34 | −4.38 | −35.37 | −4.09 | −34.63 | −3.65 | −30.40 | −6.27 | −49.12 |
| Artesunate | −5.03 | −30.97 | −4.62 | −37.99 | −3.51 | −33.93 | −4.33 | −41.08 | −3.04 | −22.92 | −4.66 | −38.52 |
| Quinine | −6.26 | −44.34 | −4.75 | −27.38 | −4.28 | −37.98 | −3.73 | −38.66 | −4.53 | −35.73 | −5.42 | −42.16 |
| Squalene | −3.74 | −36.03 | −1.80 | −28.95 | −1.38 | −27.35 | −0.43 | −25.73 | −2.78 | −34.60 | −2.95 | −39.73 |
| (−)-Epigallocatechin gallate | −6.19 | −56.64 | −4.94 | −53.06 | −5.60 | −69.05 | −4.50 | −53.02 | −1.83 | −45.05 | −5.51 | −57.02 |
| 24-Ethylcholest-5-en-3beta-ol | −4.64 | −33.31 | −3.47 | −19.58 | −3.42 | −30.49 | −2.18 | −22.95 | −2.75 | −31.31 | −5.06 | −40.60 |
| Andrograpanin | −4.76 | −31.75 | −4.08 | −24.78 | −3.84 | −33.38 | −3.07 | −25.77 | −2.59 | −25.57 | −4.80 | −38.85 |
| Andrographiside | −5.42 | −48.93 | −5.18 | −42.37 | −4.40 | −54.06 | −4.50 | −43.42 | −3.88 | −50.19 | −5.64 | −61.76 |
| Apigetrin (Cosmosiin) | −6.41 | −58.72 | −5.47 | −52.83 | −5.15 | −56.57 | −5.17 | −51.21 | −3.80 | −39.29 | −6.21 | −64.47 |
| Arctigenin | −5.82 | −49.76 | −4.60 | −36.57 | −4.71 | −52.73 | −2.98 | −30.92 | −3.12 | −37.74 | −4.90 | −52.28 |
| Baicalin | −6.56 | −57.72 | −5.79 | −64.00 | −5.40 | −54.77 | −5.68 | −71.75 | −3.70 | −50.33 | −6.59 | −69.05 |
| Berberine | - | - | −4.27 | −28.5 | −4.26 | −38.60 | −2.79 | −30.34 | −3.44 | −37.07 | −4.89 | −42.25 |
| Betulonal | −4.64 | −30.53 | −3.25 | −26.69 | −3.24 | −39.21 | −1.93 | −23.81 | −2.60 | −37.09 | −5.22 | −40.34 |
| Cerevisterol | −4.90 | −28.61 | −4.20 | −29.31 | −3.70 | −28.68 | −3.45 | −33.72 | −3.24 | −26.82 | −5.23 | −47.31 |
| Chrysin | −5.78 | −39.01 | −5.14 | −37.68 | −4.81 | −37.87 | −3.51 | −29.7 | −3.61 | −35.94 | −5.30 | −43.68 |
| Clivimine | - | - | - | - | −3.81 | −54.26 | −3.58 | −48.31 | −2.84 | −28.49 | −3.12 | −41.28 |
| Ethyl Ferulate | −5.72 | −39.35 | −4.09 | −26.24 | −3.08 | −31.06 | −2.63 | −26.45 | −2.60 | −26.24 | −4.32 | −37.72 |
| Ferulic acid | −5.18 | −31.36 | −4.45 | −27.23 | −3.69 | −28.63 | −3.85 | −30.05 | −2.87 | −25.40 | −4.31 | −32.13 |
| Fucoidan from Fucus vesiculosus | −5.01 | −33.09 | −5.36 | −39.24 | −4.51 | −35.52 | −6.20 | −58.45 | −4.03 | −29.66 | −5.35 | −33.01 |
| Gnidicin | −5.39 | −52.85 | −2.11 | −31.83 | −3.39 | −47.45 | −2.75 | −35.15 | −2.58 | −34.15 | −3.66 | −48.61 |
| Hesperidin | −6.09 | −62.01 | −3.67 | −45.39 | −5.57 | −56.62 | −5.69 | −70.44 | −5.26 | −71.63 | −6.34 | −77.63 |
| Honokiol | −5.58 | −43.98 | −4.23 | −33.62 | −3.72 | −38.67 | −2.47 | −30.25 | −2.77 | −30.51 | −4.91 | −42.44 |
| Kaempferol | −3.13 | −43.96 | −5.71 | −44.83 | −4.61 | −41.55 | −3.89 | −35.11 | −3.16 | −33.24 | −6.12 | −52.25 |
| Liquiritin | −6.83 | −53.66 | −5.11 | −50.62 | −5.14 | −55.51 | −4.22 | −47.62 | −4.02 | −42.59 | −6.42 | −66.96 |
| Lycorine | −7.08 | −48.82 | −5.79 | −39.82 | −6.12 | −46.13 | −3.80 | −33.97 | −4.34 | −39.51 | −6.41 | −50.84 |
| Neohesperidin | −5.84 | −55.75 | −3.60 | −23.29 | −5.64 | −57.75 | −5.42 | −68.27 | −5.12 | −65.39 | −6.39 | −72.01 |
| Piceatannol | −4.89 | −12.54 | −5.33 | −38.69 | −5.04 | −36.70 | −4.16 | −34.80 | −4.04 | −32.36 | −5.48 | −49.47 |
| Rosmarinic acid | −5.53 | −52.06 | −5.44 | −52.15 | −4.95 | −59.89 | −4.87 | −54.99 | −3.88 | −39.13 | −5.05 | −56.03 |
| Theaflavine-3,3′-digallate-3,3′-digallate | - | - | - | - | −5.57 | −68.47 | −6.43 | −79.69 | −5.53 | −56.23 | −6.50 | −103.39 |
| Ursolic acid | −3.46 | −35.24 | −3.78 | −31.9 | −2.93 | −32.34 | 0.01 | −31.42 | −2.31 | −32.93 | −4.54 | −38.30 |
| α-Mangostin | −4.29 | −50.96 | −1.03 | −37.36 | −3.48 | −41.76 | −0.63 | −38.95 | −3.57 | −45.4 | −4.69 | −52.43 |
| Compound Name | DNA Polymerase | TFIIS | ATPase 1 | ATPase 2 | Ankyrin Repeat-Containing Protein | MCP | Selected for In Vitro Evaluation | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | Docking | E-Model | ||
| Fludarabine | −6.48 | −46.42 | −5.11 | −39.17 | −5.48 | −49.01 | −5.68 | −52.06 | −4.57 | −34.15 | −6.78 | −52.95 | Yes |
| Liquiritin | −6.83 | −53.66 | −5.11 | −50.62 | −5.14 | −55.51 | −4.22 | −47.62 | −4.02 | −42.59 | −6.42 | −66.96 | Yes |
| Lycorine | −7.08 | −48.82 | −5.79 | −39.82 | −6.12 | −46.13 | −3.80 | −33.97 | −4.34 | −39.51 | −6.41 | −50.84 | Yes |
| Target Protein | Compound | Hydrogen Bond Residues | Hydrophobic Interaction Residues |
|---|---|---|---|
| DNA polymerase | Fludarabine | Tyr221, Tyr274 | Ile207, Ile223, Val216, Val220, Val365, Leu277, Leu421, Tyr221, Tyr274 |
| Liquiritin | Tyr221, Lys219 | Tyr221, Tyr274, Ile207, Ile223, Val216, Val220, Val222, Val365, Cys211, Leu421 | |
| Lycorine | Tyr221, Lys219 | Tyr221, Tyr274, Val216, Val220, Val365, Ile207, Ile223, Cys211, Leu421 | |
| TFIIS | Fludarabine | Glu15, Gln18, Ala66 | Ala16, Ala22, Ala66, Val65, Leu21 |
| Liquiritin | Glu15, Asp19, Lys43 | Ala22, Ala66, Val65, Leu21, Tyr12 | |
| Lycorine | Gln18, Ala66, Val65 | Ala22, Ala66, Val65, Phe26 | |
| ATPase 1 | Fludarabine | Arg12, Thr204, Arg207, Asp212, Arg215 | Leu11, Tyr200, Met20, Met23, Met213, Leu6 |
| Liquiritin | Glu10, Asp18, Asp202, Asp212, Arg215 | Met20, Met213, Val14, Leu6, Leu11, Tyr200 | |
| Lycorine | Glu10, Asp202, Arg207 | Met20, Met23, Leu6, Leu11, Val14, Tyr200 | |
| ATPase 2 | Fludarabine | Asp110, Asp146 | Met112, Tyr143 |
| Liquiritin | Asp110, Asp113, Lys171, Gln142 | Met112, Tyr143, Pro31, Cys168 | |
| Lycorine | Asp110, Asp113 | Met112, Tyr143 | |
| Ankyrin repeat-containing protein | Fludarabine | Leu195, Asp190, Arg221 | Leu195, Pro194, Phe217 |
| Liquiritin | Asp190, Arg221 | Phe187, Val204, Ala205, Phe217, Leu195, Pro194 | |
| Lycorine | Glu197, Arg221 | Pro194, Leu195, Phe217 | |
| MCP | Fludarabine | Glu369, Asn133, Asn146, Asp130 | Met151, Met370, Leu129, Leu326, Val373, Tyr312, Ala134 |
| Liquiritin | Leu326, Asn103, Asn133, Asn146 | Met151, Met370, Ala134, Ile149, Leu326, Val324, Val373, Tyr312 | |
| Lycorine | Glu369, Asn103, Asn133 | Met151, Met370, Ala134, Val373, Phe131, Tyr312, Leu326 |
| Compound Name | Concentrations (μg/mL) | MCP Inhibition Rate (%) (Mean ± SD) | ATPase Inhibition Rate (%) (Mean ± SD) | DNA Polymerase Inhibition Rate (%) (Mean ± SD) |
|---|---|---|---|---|
| Fludarabine | 100 | 91.67 ± 0.72 | 90.66 ± 0.35 | 86.11 ± 0.82 |
| Liquiritin | 100 | 52.11 ± 5.60 | 50.33 ± 5.16 | 56.41 ± 2.59 |
| Lycorine | 0.5 | 99.81 ± 0.08 | 99.66 ±0.09 | 85.46 ± 4.33 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2026 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license.
Share and Cite
Baek, E.-J.; Choi, H.-D.; Jeong, Y.-J.; Kim, K.-I. Structure-Based Screening of Antiviral Candidates Against Infectious Spleen and Kidney Necrosis Virus (ISKNV) Using Molecular Docking and In Vitro Evaluation. Biomolecules 2026, 16, 1022. https://doi.org/10.3390/biom16071022
Baek E-J, Choi H-D, Jeong Y-J, Kim K-I. Structure-Based Screening of Antiviral Candidates Against Infectious Spleen and Kidney Necrosis Virus (ISKNV) Using Molecular Docking and In Vitro Evaluation. Biomolecules. 2026; 16(7):1022. https://doi.org/10.3390/biom16071022
Chicago/Turabian StyleBaek, Eun-Jin, Hyun-Deok Choi, Ye-Jin Jeong, and Kwang-Il Kim. 2026. "Structure-Based Screening of Antiviral Candidates Against Infectious Spleen and Kidney Necrosis Virus (ISKNV) Using Molecular Docking and In Vitro Evaluation" Biomolecules 16, no. 7: 1022. https://doi.org/10.3390/biom16071022
APA StyleBaek, E.-J., Choi, H.-D., Jeong, Y.-J., & Kim, K.-I. (2026). Structure-Based Screening of Antiviral Candidates Against Infectious Spleen and Kidney Necrosis Virus (ISKNV) Using Molecular Docking and In Vitro Evaluation. Biomolecules, 16(7), 1022. https://doi.org/10.3390/biom16071022

