CDR1 Composition Can Affect Nanobody Recombinant Expression Yields
Abstract
:1. Introduction
2. Materials and Methods
2.1. PROSS-Based Nanobody Variant Identification and Production
2.2. Surface Plasmon Resonance (SPR) Experiments
2.3. SeqDesign Analysis of Nanobody Sequences)
2.4. PEP-FOLD3-Based Analysis
2.5. Molecular Dynamics Simulations (Free Nanobodies)
2.6. Prediction of Binding Free Energy Change upon Mutation
3. Results and Discussion
4. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Muyldermans, S. Nanobodies: Natural single-domain antibodies. Annu. Rev. Biochem. 2013, 82, 775–797. [Google Scholar] [CrossRef] [Green Version]
- Goldman, E.R.; Anderson, G.; Liu, J.L.; Delehanty, J.B.; Sherwood, L.J.; Osborn, L.E.; Cummins, L.B.; Hayhurst, A. Facile generation of heat-stable antiviral and antitoxin single domain antibodies from a semisynthetic llama library. Anal. Chem. 2006, 78, 8245–8255. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Monegal, A.; Ami, D.; Martinelli, C.; Huang, H.; Aliprandi, M.; Capasso, P.; Francavilla, C.; Ossolengo, G.; de Marco, A. Immunological applications of single-domain llama recombinant antibodies isolated from a naïve library. Protein Eng. Des. Sel. 2009, 22, 273–280. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Moutel, S.; Bery, N.; Bernard, V.; Keller, L.; Lemesre, E.; de Marco, A.; Ligat, L.; Rain, J.C.; Favre, G.; Olichon, A.; et al. NaLi-H1: A universal synthetic library of humanized nanobodies providing highly functional antibodies and intrabodies. eLife 2016, 5, e16228. [Google Scholar] [CrossRef] [PubMed]
- Sevy, A.M.; Chen, M.-T.; Castor, M.; Sylvia, T.; Krishnamurthy, H.; Ishchenko, A.; Hsieh, C.-M. Structure- and sequence-based design of synthetic single-domain antibody libraries. Protein Eng. Des. Sel. 2020, 33, gzaa028. [Google Scholar] [CrossRef] [PubMed]
- Van Campenhout, R.; Muyldermans, S.; Vinken, M.; Devoogdt, N.; De Groof, T.W. Therapeutic nanobodies targeting cell plasma membrane transport proteins: A high-risk/high-gain endeavor. Biomololecules 2021, 11, 63. [Google Scholar] [CrossRef] [PubMed]
- De Marco, A. Recombinant expression of nanobodies and nanobody-derived immunoreagents. Protein Expr. Purif. 2020, 172, 105645. [Google Scholar] [CrossRef]
- Duhoo, Y.; Girault, V.; Turchetto, J.; Ramond, L.; Durbesson, F.; Fourquet, P.; Nominé, Y.; Cardoso, V.; Sequeira, A.F.; Brás, J.L.A.; et al. High-throughput production of a new library of human single and tandem PDZ domains allows quantitative PDZ-peptide interaction screening through high-throughput holdup assay. Cardiovasc. Dev. 2019, 2025, 439–476. [Google Scholar] [CrossRef]
- Soler, M.A.; Medagli, B.; Semrau, M.S.; Storici, P.; Bajc, G.; de Marco, A.; Laio, A.; Fortuna, S. A consensus protocol for the In Silico optimisation of antibody fragments. Chem. Commun. 2019, 55, 14043–14046. [Google Scholar] [CrossRef] [PubMed]
- Cheng, X.; Wang, J.; Kang, G.; Hu, M.; Yuan, B.; Zhang, Y.; Huang, H. Homology modeling-based In Silico affinity maturation improves the affinity of a nanobody. Int. J. Mol. Sci. 2019, 20, 4187. [Google Scholar] [CrossRef] [Green Version]
- Hu, M.; Kang, G.; Cheng, X.; Wang, J.; Li, R.; Bai, Z.; Yang, D.; Huang, H. In Vitro affinity maturation to improve the efficacy of a hypoxia-inducible factor 1α single-domain intrabody. Biochem. Biophys. Res. Commun. 2020, 529, 936–942. [Google Scholar] [CrossRef]
- Soler, M.; Medagli, B.; Wang, J.; Oloketuyi, S.; Bajc, G.; Huang, H.; Fortuna, S.; Marco, A. Effect of humanizing mutations on the stability of the llama single-domain variable region. Biomololecules 2021, 11, 163. [Google Scholar] [CrossRef] [PubMed]
- Peleg, Y.; Vincentelli, R.; Collins, B.M.; Chen, K.-E.; Livingstone, E.K.; Weeratunga, S.; Leneva, N.; Guo, Q.; Remans, K.; Perez, K.; et al. Community-wide experimental evaluation of the PROSS stability-design method. J. Mol. Biol. 2021, 433, 166964. [Google Scholar] [CrossRef]
- Mitchell, L.S.; Colwell, L.J. Comparative analysis of nanobody sequence and structure data. Proteins Struct. Funct. Bioinform. 2018, 86, 697–706. [Google Scholar] [CrossRef] [PubMed]
- Ubbiali, D.; Orlando, M.; Kovačič, M.; Iacobucci, C.; Semrau, M.S.; Bajc, G.; Fortuna, S.; Ilc, G.; Medagli, B.; Oloketuyi, S.; et al. An anti-HER2 nanobody binds to its antigen HER2 via two independent paratopes. Int. J. Biol. Macromol. 2021, 182, 502–511. [Google Scholar] [CrossRef]
- Weinstein, J.J.; Goldenzweig, A.; Hoch, S.; Fleishman, S.J. PROSS 2: A new server for the design of stable and highly expressed protein variants. Bioinformatics 2020, 26, 123–125. [Google Scholar] [CrossRef]
- Djender, S.; Schneider, A.; Beugnet, A.; Crepin, R.; Even Desrumeaux, K.; Romani, C.; Moutel, S.; Perez, F.; de Marco, A. Bacterial cytoplasm as an effective cell compartment for producing functional VHH-based affinity reagents and Camelidae IgG-like recombinant antibodies. Microb. Cell Fact. 2014, 13, 140. [Google Scholar] [CrossRef] [PubMed]
- Hopf, T.A.; Ingraham, J.B.; Poelwijk, F.J.; Schärfe, C.P.; Springer, M.; Sander, C.; Marks, D.S. Mutation effects predicted from sequence co-variation. Nat. Biotechnol. 2017, 35, 128–135. [Google Scholar] [CrossRef] [Green Version]
- Riesselman, A.J.; Ingraham, J.B.; Marks, D.S. Deep generative models of genetic variation capture the effects of mutations. Nat. Methods 2018, 15, 816–822. [Google Scholar] [CrossRef]
- Shin, J.-E.; Riesselman, A.J.; Kollasch, A.W.; McMahon, C.; Simon, E.; Sander, C.; Manglik, A.; Kruse, A.C.; Marks, D.S. Protein design and variant prediction using autoregressive generative models. Nat. Commun. 2021, 12, 2403. [Google Scholar] [CrossRef]
- Shen, Y.; Maupetit, J.; Derreumaux, P.; Tufféry, P. Improved PEP-FOLD approach for peptide and miniprotein structure prediction. J. Chem. Theory Comput. 2014, 10, 4745–4758. [Google Scholar] [CrossRef]
- Soler, M.A.; Fortuna, S.; de Marco, A.; Laio, A. Binding affinity prediction of nanobody–protein complexes by scoring of molecular dynamics trajectories. Phys. Chem. Chem. Phys. 2018, 20, 3438–3444. [Google Scholar] [CrossRef]
- Hess, B.; Bekker, H.; Berendsen, H.J.; Fraaije, J.G. LINCS: A linear constraint solver for molecular simulations. J. Comp. Chem. 1997, 18, 1463–1472. [Google Scholar] [CrossRef]
- Bussi, G.; Donadio, D.; Parrinello, M. Canonical sampling through velocity rescaling. J. Chem. Phys. 2007, 126, 014101. [Google Scholar] [CrossRef] [Green Version]
- Pronk, S.; Páll, S.; Schulz, R.; Larsson, P.; Bjelkmar, P.; Apostolov, R.; Shirts, M.R.; Smith, J.C.; Kasson, P.M.; Van der Spoel, D.; et al. GROMACS 4.5: A high-throughput and highly parallel open source molecular simulation toolkit. Bioinformatics 2013, 29, 845–854. [Google Scholar] [CrossRef] [PubMed]
- Webb, B.; Sali, A. Comparative protein structure modeling using Modeller. Curr. Protoc. Protein Sci. 2016, 86, 2.9.1–2.9.37. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Huang, J.; Rauscher, S.; Nawrocki, G.; Ran, T.; Feig, M.; de Groot, B.L.; Grubmüller, H.; MacKerell, A.D., Jr. CHARMM36m: An improved force field for folded and intrinsically disordered proteins. Nat. Methods 2017, 14, 71–73. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Dolinsky, T.J.; Czodrowski, P.; Li, H.; Nielsen, J.E.; Jensen, J.H.; Klebe, G.; Baker, N.A. PDB2PQR: Expanding and upgrading automated preparation of biomolecular structures for molecular simulations. Nucleic Acids Res. 2007, 35, W522–W525. [Google Scholar] [CrossRef]
- Søndergaard, C.R.; Olsson, M.; Rostkowski, M.; Jensen, J.H. Improved treatment of ligands and coupling effects in empirical calculation and rationalization of pKa values. J. Chem. Theory Comput. 2011, 7, 2284–2295. [Google Scholar] [CrossRef]
- Olsson, M.; Søndergaard, C.R.; Rostkowski, M.; Jensen, J.H. PROPKA3: Consistent treatment of internal and surface residues in empirical pKa predictions. J. Chem. Theory Comput. 2010, 7, 525–537. [Google Scholar] [CrossRef]
- Lindahl, E.R. Molecular dynamics simulations. Methods Mol. Biol. 2008, 443, 3–23. [Google Scholar]
- Miller, B.R., III; McGee, T.D., Jr.; Swails, J.M.; Homeyer, N.; Gohlke, H.; Roitberg, A.E. MMPBSA.py: An efficient program for end-state free energy calculations. J. Chem. Theory Comput. 2012, 8, 3314–3321. [Google Scholar] [CrossRef]
- Genheden, S.; Ryde, U. The MM/PBSA and MM/GBSA methods to estimate ligand-binding affinities. Expert Opin. Drug Discov. 2015, 10, 449–461. [Google Scholar] [CrossRef] [PubMed]
- Onufriev, A.; Bashford, D.; Case, D.A. Exploring protein native states and large-scale conformational changes with a modified generalized born model. Proteins Struct. Funct. Bioinform. 2004, 55, 383–394. [Google Scholar] [CrossRef] [Green Version]
- Scheurer, M.; Rodenkirch, P.; Siggel, M.; Bernardi, R.C.; Schulten, K.; Tajkhorshid, E.; Rudack, T. PyContact: Rapid, customizable, and visual analysis of noncovalent interactions in MD simulations. Biophys. J. 2018, 114, 577–583. [Google Scholar] [CrossRef] [Green Version]
- Goddard, T.D.; Huang, C.C.; Meng, E.C.; Pettersen, E.F.; Couch, G.S.; Morris, J.; Ferrin, T.E. UCSF ChimeraX: Meeting modern challenges in visualization and analysis. Protein Sci. 2018, 27, 14–25. [Google Scholar] [CrossRef]
- Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Meng, E.C.; Couch, G.S.; Croll, T.I.; Morris, J.H.; Ferrin, T.E. UCSF ChimeraX: Structure visualization for researchers, educators, and developers. Protein Sci. 2021, 30, 70–82. [Google Scholar] [CrossRef]
- Warszawski, S.; Katz, A.B.; Lipsh, R.; Khmelnitsky, L.; Ben Nissan, G.; Javitt, G.; Dym, O.; Unger, T.; Knop, O.; Albeck, S.; et al. Optimizing antibody affinity and stability by the automated design of the variable light-heavy chain interfaces. PLoS Comput. Biol. 2019, 15, e1007207. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Honegger, A.; Malebranche, A.D.; Röthlisberger, D.; Plückthun, A. The influence of the framework core residues on the biophysical properties of immunoglobulin heavy chain variable domains. Protein Eng. Des. Sel. 2009, 22, 121–134. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hackel, B.J.; Ackerman, M.E.; Howland, S.; Wittrup, K.D. Stability and CDR composition biases enrich binder functionality landscapes. J. Mol. Biol. 2010, 401, 84–96. [Google Scholar] [CrossRef] [Green Version]
Variants | Mutations | Amino Acid Sequences | Yields (mg/L) | KD (nM) |
---|---|---|---|---|
A10 wt | / | MAEVQLQASGGGFVQPGGSLRLSCAASGATSNISNMGWFRQAPGKEREFVSAISRAESRPLYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAYMPLVRHKAYWGQGTQVTVSSA | 5.2 | 4.9 |
A10 mutG0 | G31a | MAEVQLQASGGGFVQPGGSLRLSCAASGATSGNISNMGWFRQAPGKEREFVSAISRAESRPLYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAYMPLVRHKAYWGQGTQVTVSSA | 6.9 | 23.5 |
A10 mutKG | G29a | MAEVQLQASGGGFVQPGGSLRLSCAASGAGTSNISNMGWFRQAPGKEREFVSAISRAESRPLYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAYMPLVRHKAYWGQGTQVTVSSA | 9.6 | 34.7 |
A10 mutKG.1 | Q8E, F13L, G29a, S51A, R90K, A91P | MAEVQLQESGGGLVQPGGSLRLSCAASGAGTSNISNMGWFRQAPGKEREFVAAISRAESRPLYYADSVKGRFTISRDNSKNTVYLQMNSLKPEDTATYYCAYMPLVRHKAYWGQGTQVTVSSA | 12.8 | 9.9 |
A10 mutKG.2 | Q8E, F13L, G29a, S51A, R90K, A91P, K109L | MAEVQLQESGGGLVQPGGSLRLSCAASGAGTSNISNMGWFRQAPGKEREFVAAISRAESRPLYYADSVKGRFTISRDNSKNTVYLQMNSLKPEDTATYYCAYMPLVRHLAYWGQGTQVTVSSA | 1.2 | / |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Orlando, M.; Fortuna, S.; Oloketuyi, S.; Bajc, G.; Goldenzweig, A.; de Marco, A. CDR1 Composition Can Affect Nanobody Recombinant Expression Yields. Biomolecules 2021, 11, 1362. https://doi.org/10.3390/biom11091362
Orlando M, Fortuna S, Oloketuyi S, Bajc G, Goldenzweig A, de Marco A. CDR1 Composition Can Affect Nanobody Recombinant Expression Yields. Biomolecules. 2021; 11(9):1362. https://doi.org/10.3390/biom11091362
Chicago/Turabian StyleOrlando, Marco, Sara Fortuna, Sandra Oloketuyi, Gregor Bajc, Adi Goldenzweig, and Ario de Marco. 2021. "CDR1 Composition Can Affect Nanobody Recombinant Expression Yields" Biomolecules 11, no. 9: 1362. https://doi.org/10.3390/biom11091362
APA StyleOrlando, M., Fortuna, S., Oloketuyi, S., Bajc, G., Goldenzweig, A., & de Marco, A. (2021). CDR1 Composition Can Affect Nanobody Recombinant Expression Yields. Biomolecules, 11(9), 1362. https://doi.org/10.3390/biom11091362