Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides
Abstract
1. Introduction
2. AMPs from Plants
2.1. Groups of Plant AMPs
2.2. AMPs Present in Vegetables
2.2.1. AMPs in Tomato
2.2.2. AMPs in Onion
2.2.3. AMPs in Garlic
2.2.4. AMPs in Chili Pepper
3. AMPs from Animals
4. AMPs from Humans
5. Modes of Action and Mechanisms
5.1. Antiviral AMPs
5.2. Antibacterial AMPs
5.3. Antifungal AMPs
5.4. Membrane-Targeting AMPs
5.5. Non-Membrane Targeting
6. Discussion of the Benefits and Limitations of AMPs
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Li, X.; Zuo, S.; Wang, B.; Zhang, K.; Wang, Y. Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides. Molecules 2022, 27, 2675. [Google Scholar] [CrossRef] [Scilit]
- Chrom, C.L.; Renn, L.M.; Caputo, G.A. Characterization and Antimicrobial Activity of Amphiphilic Peptide AP3 and Derivative Sequences. Antibiotics 2019, 8, 20. [Google Scholar] [CrossRef] [Scilit]
- Chen, Y.; Wang, J.; Li, G.; Yang, Y.; Ding, W. Current Advancements in Sactipeptide Natural Products. Front. Chem. 2021, 9, 595991. [Google Scholar] [CrossRef] [Scilit]
- Iacovelli, R.; Bovenberg, R.A.L.; Driessen, A.J.M. Nonribosomal Peptide Synthetases and Their Biotechnological Potential in Penicillium Rubens. J. Ind. Microbiol. Biotechnol. 2021, 48, kuab045. [Google Scholar] [CrossRef] [Scilit]
- Mansour, S.C.; Pena, O.M.; Hancock, R.E. Host defense peptides: Front-line immunomodulators. Trends Immunol. 2014, 35, 443–450. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bin Hafeez, A.; Jiang, X.; Bergen, P.J.; Zhu, Y. Antimicrobial Peptides: An Update on Classifications and Databases. Int. J. Mol. Sci. 2021, 22, 11691. [Google Scholar] [CrossRef] [Scilit]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Li, J.; Hu, S.; Jian, W.; Xie, C.; Yang, X. Plant antimicrobial peptides: Structures, functions, and applications. Bot. Stud. 2021, 62, 5. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pizzo, E.; Cafaro, V.; Donato, A.D.; Notomista, E. Cryptic Antimicrobial Peptides: Identification Methods and Current Knowledge of Their Immunomodulatory Properties. Curr. Pharm. Des. 2018, 24, 1054–1066. [Google Scholar] [CrossRef] [Scilit]
- Fesenko, I.; Azarkina, R.; Kirov, I.; Kniazev, A.; Filippova, A.; Grafskaia, E.; Lazarev, V.; Zgoda, V.; Butenko, I.; Bukato, O.; et al. Phytohormone Treatment Induces Generation of Cryptic Peptides with Antimicrobial Activity in the Moss Physcomitrella patens. BMC Plant Biol. 2019, 19, 9. [Google Scholar] [CrossRef] [Scilit]
- De Oliveira Costa, B.; Franco, O.L. Cryptic Host Defense Peptides: Multifaceted Activity and Prospects for Medicinal Chemistry. Curr. Top. Med. Chem. 2020, 20, 1274–1290. [Google Scholar] [CrossRef] [Scilit]
- Bosso, A.; Maro, A.D.; Cafaro, V.; Donato, A.D.; Notomista, E.; Pizzo, E. Enzymes as a Reservoir of Host Defence Peptides. Curr. Top. Med. Chem. 2020, 20, 1310–1323. [Google Scholar] [CrossRef] [Scilit]
- Bosso, A.; Gaglione, R.; Di Girolamo, R.; Veldhuizen, E.J.A.; García-Vello, P.; Fusco, S.; Cafaro, V.; Monticelli, M.; Culurciello, R.; Notomista, E.; et al. Human Cryptic Host Defence Peptide GVF27 Exhibits Anti-Infective Properties against Biofilm Forming Members of the Burkholderia Cepacia Complex. Pharmaceuticals 2022, 15, 260. [Google Scholar] [CrossRef] [Scilit]
- Ciociola, T.; Zanello, P.P.; D’Adda, T.; Galati, S.; Conti, S.; Magliani, W.; Giovati, L. A Peptide Found in Human Serum, Derived from the C-Terminus of Albumin, Shows Antifungal Activity In Vitro and In Vivo. Microorganisms 2020, 8, 1627. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pizzo, E.; Pane, K.; Bosso, A.; Landi, N.; Ragucci, S.; Russo, R.; Gaglione, R.; Torres, M.D.T.; de la Fuente-Nunez, C.; Arciello, A.; et al. Novel Bioactive Peptides from PD-L1/2, a Type 1 Ribosome Inactivating Protein from Phytolacca dioica L. Evaluation of Their Antimicrobial Properties and Anti-Biofilm Activities. Biochim. Biophys. Acta BBA Biomembr. 2018, 1860, 1425–1435. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Luo, Y.; Song, Y. Mechanism of Antimicrobial Peptides: Antimicrobial, Anti-Inflammatory and Antibiofilm Activities. Int. J. Mol. Sci. 2021, 22, 11401. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- NCBI—National Center for Biotechnology Information. Nih.gov. Available online: https://www.ncbi.nlm.nih.gov (accessed on 22 December 2023).
- Almeida, P.F.; Pokorny, A. 5.10 Interactions of Antimicrobial Peptides with Lipid Bilayers. ScienceDirect. Available online: https://www.sciencedirect.com/science/article/abs/pii/B9780123749208005154 (accessed on 6 November 2023).
- Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef] [Scilit]
- Guha, S.; Ferrie, R.P.; Ghimire, J.; Ventura, C.R.; Wu, E.; Sun, L.; Kim, S.Y.; Wiedman, G.R.; Hristova, K.; Wimley, W.C. Applications and Evolution of Melittin, the Quintessential Membrane Active Peptide. Biochem. Pharmacol. 2021, 193, 114769. [Google Scholar] [CrossRef] [Scilit]
- Park, C.B.; Yi, K.S.; Matsuzaki, K.; Kim, M.S.; Kim, S.C. Structure-Activity Analysis of Buforin II, a Histone H2A-Derived Antimicrobial Peptide: The Proline Hinge Is Responsible for the Cell-Penetrating Ability of Buforin II. Proc. Natl. Acad. Sci. USA 2000, 97, 8245–8250. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Li, S.; Wang, Y.; Zhou, J.; Wang, J.; Zhang, M.; Chen, H. Structural Characterization, Cytotoxicity, and the Antifungal Mechanism of a Novel Peptide Extracted from Garlic (Allium sativa L.). Molecules 2023, 28, 3098. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Culver, K.D.; Allen, J.L.; Shaw, L.N.; Hicks, L.M. Too Hot to Handle: Antibacterial Peptides Identified in Ghost Pepper. J. Nat. Prod. 2021, 84, 2200–2208. [Google Scholar] [CrossRef] [Scilit]
- Morris, C.F. The Antimicrobial Properties of the Puroindolines, a Review. World J. Microbiol. Biotechnol. 2019, 35, 86. [Google Scholar] [CrossRef] [Scilit]
- Colilla, F.J.; Rocher, A.; Mendez, E. γ-Purothionins: Amino Acid Sequence of Two Polypeptides of a New Family of Thionins from Wheat Endosperm. FEBS Lett. 1990, 270, 191–194. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Shanmugaraj, B.; Bulaon, C.J.I.; Malla, A.; Phoolcharoen, W. Biotechnological Insights on the Expression and Production of Antimicrobial Peptides in Plants. Molecules 2021, 26, 4032. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dini, I.; De Biasi, M.-G.; Mancusi, A. An Overview of the Potentialities of Antimicrobial Peptides Derived from Natural Sources. Antibiotics 2022, 11, 1483. [Google Scholar] [CrossRef] [Scilit]
- Tam, J.P.; Wang, S.; Wong, K.H.; Tan, W.L. Antimicrobial Peptides from Plants. Pharmaceuticals 2015, 8, 711–757. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Höng, K.; Austerlitz, T.; Bohlmann, T.; Bohlmann, H. The Thionin Family of Antimicrobial Peptides. PLoS ONE 2021, 16, e0254549. [Google Scholar] [CrossRef] [Scilit]
- Kovaleva, V.; Bukhteeva, I.; Kit, O.Y.; Nesmelova, I.V. Plant Defensins from a Structural Perspective. Int. J. Mol. Sci. 2020, 21, 5307. [Google Scholar] [CrossRef] [Scilit]
- Pinheiro-Aguiar, R.; do Amaral, V.S.G.; Pereira, I.B.; Kurtenbach, E.; Almeida, F.C.L. Nuclear Magnetic Resonance Solution Structure of Pisum sativum Defensin 2 Provides Evidence for the Presence of Hydrophobic Surface-Clusters. Proteins 2020, 88, 242–246. [Google Scholar] [CrossRef] [Scilit]
- Slavokhotova, A.A.; Rogozhin, E.A. Defense Peptides from the α-Hairpinin Family Are Components of Plant Innate Immunity. Front. Plant Sci. 2020, 11, 465. [Google Scholar] [CrossRef] [Scilit]
- Su, T.; Han, M.; Cao, D.; Xu, M. Molecular and Biological Properties of Snakins: The Foremost Cysteine-Rich Plant Host Defense Peptides. J. Fungi 2020, 6, 220. [Google Scholar] [CrossRef] [Scilit]
- Chan, Y.L.; Prasad, V.; Sanjaya Chen, K.H.; Liu, P.C.; Chan, M.T.; Cheng, C.P. Transgenic Tomato Plants Expressing an Arabidopsis Thionin (Thi2.1) Driven by Fruit-Inactive Promoter Battle against Phytopathogenic Attack. Planta 2005, 221, 386–393. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Prasad, B.D.; Jha, S.; Chattoo, B.B. Transgenic Indica Rice Expressing Mirabilis Jalapa Antimicrobial Protein (Mj-AMP2) Shows Enhanced Resistance to the Rice Blast Fungus Magnaporthe Oryzae. Plant Sci. 2008, 175, 364–371. [Google Scholar] [CrossRef] [Scilit]
- Sarowar, S.; Kim, Y.J.; Kim, K.D.; Hwang, B.K.; Ok, S.H.; Shin, J.S. Overexpression of Lipid Transfer Protein (LTP) Genes Enhances Resistance to Plant Pathogens and LTP Functions in Long-Distance Systemic Signaling in Tobacco. Plant Cell Rep. 2008, 28, 419–427. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ghag, S.B.; Shekhawat, U.K.S.; Ganapathi, T.R. Petunia Floral Defensins with Unique Prodomains as Novel Candidates for Development of Fusarium Wilt Resistance in Transgenic Banana Plants. PLoS ONE 2012, 7, e39557. [Google Scholar] [CrossRef] [Scilit]
- Verma, S.S.; Yajima, W.R.; Rahman, M.H.; Shah, S.; Liu, J.J.; Ekramoddoullah, A.K.; Kav, N.N. A Cysteine-Rich Antimicrobial Peptide from Pinus Monticola (PmAMP1) Confers Resistance to Multiple Fungal Pathogens in Canola (Brassica napus). Plant Mol. Biol. 2012, 79, 61–74. [Google Scholar] [CrossRef] [Scilit]
- Rong, W.; Qi, L.; Wang, J.; Du, L.; Xu, H.; Wang, A.; Zhang, Z. Expression of a Potato Antimicrobial Peptide SN1 Increases Resistance to Take-All Pathogen Gaeumannomyces graminis Var. Tritici in Transgenic Wheat. Funct. Integr. Genom. 2013, 13, 403–409. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vetchinkina, E.M.; Komakhina, V.V.; Vysotskii, D.A.; Zaitsev, D.V.; Smirnov, A.N.; Babakov, A.V.; Komakhin, R.A. Expression of Plant Antimicrobial Peptide Pro-SmAMP2 Gene Increases Resistance of Transgenic Potato Plants to Alternaria and Fusarium Pathogens. Genetika 2016, 52, 1055–1068. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Diz, M.S.S.; Carvalho, A.O.; Rodrigues, R.; Neves-Ferreira, A.G.C.; Da Cunha, M.; Alves, E.W.; Okorokova-Façanha, A.L.; Oliveira, M.A.; Perales, J.; Machado, O.L.T.; et al. Antimicrobial Peptides from Chili Pepper Seeds Causes Yeast Plasma Membrane Permeabilization and Inhibits the Acidification of the Medium by Yeast Cells. Biochim. Biophys. Acta 2006, 1760, 1323–1332. [Google Scholar] [CrossRef] [Scilit]
- Herbel, V.; Sieber-Frank, J.; Wink, M. The Antimicrobial Peptide Snakin-2 Is Upregulated in the Defense Response of Tomatoes (Solanum lycopersicum) as Part of the Jasmonate-Dependent Signaling Pathway. J. Plant Physiol. 2017, 208, 1–6. [Google Scholar] [CrossRef] [Scilit]
- Slezina, M.P.; Istomina, E.A.; Kulakovskaya, E.V.; Abashina, T.N.; Odintsova, T.I. Synthetic Oligopeptides Mimicking γ-Core Regions of Cysteine-Rich Peptides of Solanum lycopersicum Possess Antimicrobial Activity against Human and Plant Pathogens. Curr. Issues Mol. Biol. 2021, 43, 1226–1242. [Google Scholar] [CrossRef] [Scilit]
- Taggar, R.; Singh, S.; Bhalla, V.; Bhattacharyya, M.S.; Sahoo, D.K. Deciphering the Antibacterial Role of Peptide from Bacillus Subtilis Subsp. Spizizenii Ba49 against Staphylococcus Aureus. Front. Microbiol. 2021, 12, 708712. [Google Scholar] [CrossRef] [Scilit]
- Taggar, R.; Jangra, M.; Dwivedi, A.; Bansal, K.; Patil, P.B.; Bhattacharyya, M.S.; Nandanwar, H.; Sahoo, D.K. Bacteriocin Isolated from the Natural Inhabitant of Allium Cepa against Staphylococcus Aureus. World J. Microbiol. Biotechnol. 2021, 37, 20. [Google Scholar] [CrossRef] [Scilit]
- Chidike Ezeorba, T.P.; Ezugwu, A.L.; Chukwuma, I.F.; Anaduaka, E.G.; Udenigwe, C.C. Health-Promoting Properties of Bioactive Proteins and Peptides of Garlic (Allium sativum). Food Chem. 2024, 435, 137632. [Google Scholar] [CrossRef] [Scilit]
- Gao, X.; Chen, Y.; Chen, Z.; Xue, Z.; Jia, Y.; Guo, Q.; Ma, Q.; Zhang, M.; Chen, H. Identification and Antimicrobial Activity Evaluation of Three Peptides from Laba Garlic and the Related Mechanism. Food Funct. 2019, 10, 4486–4496. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ribeiro, S.F.F.; Carvalho, A.O.; Da Cunha, M.; Rodrigues, R.; Cruz, L.P.; Melo, V.M.M.; Vasconcelos, I.M.; Melo, E.J.T.; Gomes, V.M. Isolation and Characterization of Novel Peptides from Chilli Pepper Seeds: Antimicrobial Activities against Pathogenic Yeasts. Toxicon 2007, 50, 600–611. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- De Azevedo dos Santos, L.; Taveira, G.; da Silva, M.; da Silva Gebara, R.; da Silva Pereira, L.; Perales, J.; Teixeira-Ferreira, A.; de Oliveira Mello, É.; de Oliveira Carvalho, A.; Rodrigues, R.; et al. Antimicrobial Peptides from Capsicum chinense Fruits: Agronomic Alternatives against Phytopathogenic Fungi. Biosci. Rep. 2020, 40, BSR20200950. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Elgamoudi, B.A.; Korolik, V. Campylobacter Biofilms: Potential of Natural Compounds to Disrupt Campylobacter jejuni Transmission. Int. J. Mol. Sci. 2021, 22, 12159. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pérez-Gregorio, R.; Soares, S.; Mateus, N.; de Freitas, V. Bioactive Peptides and Dietary Polyphenols: Two Sides of the Same Coin. Molecules 2020, 25, 3443. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Satchanska, G. Antibacterial Activity of Plant Polyphenols. In Secondary Metabolites—Trends and Reviews; IntechOpen: London, UK, 2022. [Google Scholar] [CrossRef] [Scilit]
- Kościuczuk, E.M.; Lisowski, P.; Jarczak, J.; Strzałkowska, N.; Jóźwik, A.; Horbańczuk, J.; Krzyżewski, J.; Zwierzchowski, L.; Bagnicka, E. Cathelicidins: Family of Antimicrobial Peptides. A Review. Mol. Biol. Rep. 2012, 39, 10957–10970. [Google Scholar] [CrossRef] [Scilit]
- Chang, T.L.; Vargas, J.; DelPortillo, A.; Klotman, M.E. Dual Role of α-Defensin-1 in Anti–HIV-1 Innate Immunity. J. Clin. Investig. 2005, 115, 765–773. [Google Scholar] [CrossRef]
- Shafee, T.M.A.; Lay, F.T.; Phan, T.K.; Anderson, M.A.; Hulett, M.D. Convergent Evolution of Defensin Sequence, Structure and Function. Cell. Mol. Life Sci. 2016, 74, 663–682. [Google Scholar] [CrossRef] [Scilit]
- Matos, G.; Fabiano, R. On the Silver Jubilee of Crustacean Antimicrobial Peptides. Rev. Aquac. 2021, 14, 594–612. [Google Scholar] [CrossRef] [Scilit]
- Saucedo-Vázquez, J.P.; Gushque, F.; Vispo, N.S.; Rodriguez, J.; Gudiño-Gomezjurado, M.E.; Albericio, F.; Tellkamp, M.P.; Alexis, F. Marine Arthropods as a Source of Antimicrobial Peptides. Mar. Drugs 2022, 20, 501. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bruno, R.; Boidin-Wichlacz, C.; Melnyk, O.; Zeppilli, D.; Landon, C.; Thomas, F.; Cambon, M.-A.; Lafond, M.; Mabrouk, K.; Massol, F.; et al. The Diversification of the Antimicrobial Peptides from Marine Worms Is Driven by Environmental Conditions. Sci. Total Environ. 2023, 879, 162875. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mylonakis, E.; Podsiadlowski, L.; Muhammed, M.; Vilcinskas, A. Diversity, Evolution and Medical Applications of Insect Antimicrobial Peptides. Philos. Trans. R. Soc. B Biol. Sci. 2016, 371, 20150290. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Le, C.-F.; Fang, C.-M.; Sekaran, S.D. Intracellular Targeting Mechanisms by Antimicrobial Peptides. Antimicrob. Agents Chemother. 2017, 61, e02340-16. [Google Scholar] [CrossRef] [Scilit]
- Patocka, J.; Nepovimova, E.; Klimova, B.; Wu, Q.; Kuca, K. Antimicrobial Peptides: Amphibian Host Defense Peptides. Curr. Med. Chem. 2019, 26, 5924–5946. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gesell, J.; Zasloff, M.; Opella, S.J.J. Two-dimensional 1H NMR experiments show that the 23-residue magainin antibiotic peptide is an α-helix in dodecylphosphocholine micelles, sodium dodecylsulfate micelles, and trifluoroethanol/water solution. Biomol. NMR 1997, 9, 127–135. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rozek, A.; Friedrich, C.L.; Hancock, R.E. Structure of the Bovine Antimicrobial Peptide Indolicidin Bound to Dodecylphosphocholine and Sodium Dodecyl Sulfate Micelles. Biochemistry 2000, 39, 15765–15774. [Google Scholar] [CrossRef] [Scilit]
- Pärn, K.; Eriste, E.; Langel, Ü. The Antimicrobial and Antiviral Applications of Cell-Penetrating Peptides. In Cell-Penetrating Peptides; Springer: Berlin/Heidelberg, Germany, 2015; pp. 223–245. [Google Scholar] [CrossRef] [Scilit]
- Gubatan, J.; Holman, D.R.; Puntasecca, C.J.; Polevoi, D.; Rubin, S.J.; Rogalla, S. Antimicrobial Peptides and the Gut Microbiome in Inflammatory Bowel Disease. World J. Gastroenterol. 2021, 27, 7402–7422. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ahmed, A.; Siman-Tov, G.; Hall, G.; Bhalla, N.; Narayanan, A. Human Antimicrobial Peptides as Therapeutics for Viral Infections. Viruses 2019, 11, 704. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, G. Human Antimicrobial Peptides and Proteins. Pharmaceuticals 2014, 7, 545–594. [Google Scholar] [CrossRef] [Scilit]
- Yarbrough, V.L.; Winkle, S.; Herbst-Kralovetz, M.M. Antimicrobial Peptides in the Female Reproductive Tract: A Critical Component of the Mucosal Immune Barrier with Physiological and Clinical Implications. Hum. Reprod. Update 2015, 21, 353–377. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yenugu, S.; Hamil, K.G.; French, F.S.; Hall, S.H. Antimicrobial actions of the human epididymis 2 (HE2) protein isoforms, HE2alpha, HE2beta1 and HE2beta2. Reprod. Biol. Endocrinol. 2004, 2, 61. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Satchanska, G.; Doycheva, A.; Stefanov, R.; Georgiev, B.; Taushanova, P.; Kacheva, D.; Satchansky, B. Antibacterial Activity of Human Ejaculate by Healthy Man. J. Balk. Ecol. 2016, 19, 397–407. [Google Scholar]
- Zhang, Q.-Y.; Yan, Z.-B.; Meng, Y.-M.; Hong, X.-Y.; Shao, G.; Ma, J.-J.; Cheng, X.-R.; Liu, J.; Kang, J.; Fu, C.-Y. Antimicrobial Peptides: Mechanism of Action, Activity and Clinical Potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [Scilit]
- Kapil, S.; Sharma, V. D-Amino Acids in Antimicrobial Peptides: A Potential Approach to Treat and Combat Antimicrobial Resistance. Can. J. Microbiol. 2020, 67, 119–137. [Google Scholar] [CrossRef] [Scilit]
- Olleik, H.; Perrier, J.; Hijazi, A.; Baydoun, E.; Maresca, M. Antimicrobial Peptides and Peptidomimetics as Treatment Option for Helicobacter pylori Infection. In Peptide and Protein Engineering for Biotechnological and Therapeutic Applications; World Scientific: Singapore, 2023; pp. 25–56. [Google Scholar] [CrossRef] [Scilit]
- Buda De Cesare, G.; Cristy, S.A.; Garsin, D.A.; Lorenz, M.C. Antimicrobial Peptides: A New Frontier in Antifungal Therapy. mBio 2020, 11, e02123-20. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Fernández de Ullivarri, M.; Arbulu, S.; Garcia-Gutierrez, E.; Cotter, P.D. Antifungal Peptides as Therapeutic Agents. Front. Cell. Infect. Microbiol. 2020, 10, 105. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mahlapuu, M.; Håkansson, J.; Ringstad, L.; Björn, C. Antimicrobial Peptides: An Emerging Category of Therapeutic Agents. Front. Cell. Infect. Microbiol. 2016, 6, 194. [Google Scholar] [CrossRef] [Scilit]
- Moretta, A.; Scieuzo, C.; Petrone, A.M.; Salvia, R.; Manniello, M.D.; Franco, A.; Lucchetti, D.; Vassallo, A.; Vogel, H.; Sgambato, A.; et al. Antimicrobial Peptides: A New Hope in Biomedical and Pharmaceutical Fields. Front. Cell. Infect. Microbiol. 2021, 11, 668632. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rai, M.; Pandit, R.; Gaikwad, S.; Kövics, G. Antimicrobial Peptides as Natural Bio-Preservative to Enhance the Shelf-Life of Food. J. Food Sci. Technol. 2016, 53, 3381–3394. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Czelej, M.; Czernecki, T.; Garbacz, K.; Wawrzykowski, J.; Jamioł, M.; Michalak, K.; Walczak, N.; Wilk, A.; Waśko, A. Egg Yolk as a New Source of Peptides with Antioxidant and Antimicrobial Properties. Foods 2023, 12, 3394. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mahlapuu, M.; Björn, C.; Ekblom, J. Antimicrobial Peptides as Therapeutic Agents: Opportunities and Challenges. Crit. Rev. Biotechnol. 2020, 40, 978–992. [Google Scholar] [CrossRef] [Scilit]
- Lai, Z.; Yuan, X.; Chen, H.; Zhu, Y.; Dong, N.; Shan, A. Strategies Employed in the Design of Antimicrobial Peptides with Enhanced Proteolytic Stability. Biotechnol. Adv. 2022, 59, 107962. [Google Scholar] [CrossRef] [Scilit]
- Tortorella, A.; Leone, L.; Lombardi, A.; Pizzo, E.; Bosso, A.; Winter, R.; Petraccone, L.; Del Vecchio, P.; Oliva, R. The Impact of N-Glycosylation on the Properties of the Antimicrobial Peptide LL-III. Sci. Rep. 2023, 13, 3733. [Google Scholar] [CrossRef] [Scilit]
- He, S.; Yang, Z.; Li, X.; Wu, H.; Zhang, L.; Shan, A.; Wang, J. Boosting Stability and Therapeutic Potential of Proteolysis-Resistant Antimicrobial Peptides by End-Tagging β-Naphthylalanine. Acta Biomater. 2023, 164, 175–194. [Google Scholar] [CrossRef] [Scilit]
- Meinberger, D.; Drexelius, M.G.; Grabeck, J.; Hermes, G.; Roth, A.; Elezagic, D.; Neundorf, I.; Streichert, T.; Klatt, A.R. Modified CLEC3A-Derived Antimicrobial Peptides Lead to Enhanced Antimicrobial Activity against Drug-Resistant Bacteria. Antibiotics 2023, 12, 1532. [Google Scholar] [CrossRef] [Scilit]
- Cafaro, V.; Bosso, A.; Di Nardo, I.; D’Amato, A.; Izzo, I.; De Riccardis, F.; Siepi, M.; Culurciello, R.; D’Urzo, N.; Chiarot, E.; et al. The Antimicrobial, Antibiofilm and Anti-Inflammatory Activities of P13#1, a Cathelicidin-like Achiral Peptoid. Pharmaceuticals 2023, 16, 1386. [Google Scholar] [CrossRef] [Scilit]
- Chen, C.H.; Lu, T.K. Development and Challenges of Antimicrobial Peptides for Therapeutic Applications. Antibiotics 2020, 9, 24. [Google Scholar] [CrossRef] [Scilit]
- Lei, J.; Sun, L.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q. The Antimicrobial Peptides and Their Potential Clinical Applications. Am. J. Transl. Res. 2019, 11, 3919–3931. [Google Scholar] [PubMed]
- Malanovic, N.; Lohner, K. Antimicrobial Peptides Targeting Gram-Positive Bacteria. Pharmaceuticals 2016, 9, 59. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Shamseddine, L.; Roblin, C.; Veyrier, I.; Basset, C.; De Macedo, L.; Boyeldieu, A.; Maresca, M.; Nicoletti, C.; Brasseur, G.; Kieffer-Jaquinod, S.; et al. Mechanistic and functional aspectsof the Ruminococcin C sactipeptide isoforms. iScience 2023, 26, 107563. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Toke, O. Antimicrobial Peptides: New Candidates in the Fight against Bacterial Infections. Biopolymers 2005, 80, 717–735. [Google Scholar] [CrossRef] [Scilit]




| AMP | Source | Sequence | Reference |
|---|---|---|---|
| LL-37 | Human (Homo sapiens) | [LL-37, 37 aa] | [18] |
| Indolicidin | Cattle (Bos taurus) | ILPWKWPWWPWRR-amide | |
| Crotamine | South American rattlesnake (Crotalus durissus) | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG, Cys4-Cys36, Cys11-Cys30, Cys18-Cys37 | [18] |
| Cancrin | Crab-eating frog (Rana cancrivora) | GSAQPYKQLHKVVNWDPYG | [19] |
| Melittin | Honeybee (Apis mellifera) | GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 | [20] |
| Buforin II | Asian toad (Duttaphrynus melanostictus) | TRSSRAGLQFPVGRVHRLLRK | [21] |
| HNP-1 | Human (Homo sapiens) | ACYCRIPACIAGERRYGTCIpYQGRLWAFCC | [18] |
| HBD-2 | Human (Homo sapiens) | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP | [18] |
| Protegrin | Pig (Sus scrofa) | RGGRLCYCRRRFCVCVGR-amide | [18] |
| Magainin 2 | African clawed frog (Xenopus laevis) | GIGKFLHSAKKFGKAFVGEIMNS | [18] |
| Cecropin A | Cecropia moth (Hyalophora cecropia) | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-amide | [18] |
| NpRS | Garlic (Allium sativum) | RSLNLLMFR | [22] |
| SN1 | Potato (Solanum tuberosum) | MKLFLLTLLLVTLVITPSLIQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP | [17] |
| SN2 | Tomato (Solanum lycopersicum) | MAISKALFASLLLSLLLLEQVQSIQTDQVSSNAISEGADSYKKIDCGGACAARCRLSSRPRLCHRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP | [17] |
| CC-AMP1 | Ghost Pepper (Capsicum chinense × frutescens) | ZETLDPICMAKCVLKCGKKAWCLTKCIAGCVL | [23] |
| γ-Purothionin | Wheat (Triticum turgidum) | KICRRRSAGF KGPCMSNKNCAQVCQQEGWG GGNCDGPFRRCKCIRQC | [17,24,25] |
| α-1-Purothionin (precursor) | Bread wheat (Triticum aestivum) | MGSKGLKGVMVCLLILGLVL EQVQVEGKSCCRTTLGRNCYNLCRSRGAQK LCSTVCRCKLTSGLSCPKGFPKLALESNSDEPDTIEYCNLGCRSSVCDYMVNAAADDEEM KLYVENCGDACVNFCNGDAGLTSLDA | [17] |
| Thi2.1 | Thale cress (Arabidopsis thaliana) | MKGRILILSLLIMSLVMAQVQVEAKICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVNAILENSADATNEHCKLGCETSVCGAMNTLQNSDASEIVNGASEQCAKGCSIFCTKSYVVPPGPPKLL | [17] |
| Mj-AMP2 | Garden four-o’clock (Mirabilis jalapa) | MAKVPIAFLKFVIVLILFIAMSGMIEACIGNG GRCNENVGPPYCCSGFCLRQPNQGYGVCRNR | [17] |
| Lipid transfer protein | Common tobacco (Nicotiana tabacum) | MEMVGKIA CFVVLCMVVVAPHAEALSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ | [17] |
| Flower-derived plant defensin 2 | Petunia x hybrida | MARSICFFAVATLALMLFAAYEAEAATCKAECPTWDGICINKGPCVKCCKAQPEKFTDGHCSKVLRRCLCTKPCATEEATATLANEVKTMAEALVEEDMME | [17] |
| PmAMP1 | Western white pine (Pinus monticola) | METKHLAYVMFVLVSLFLAMAQPSQASYFSAWVGPGCNNHNARYNKCGCSNISHNVHGGYEFVYQGQAPTAYNTNNCKGVAQTRFSSNVNQACSNFAWKSVFIQC | [17] |
| SmAMP2 | Chickweed (Stellaria media) | MLNMKSFALLMLFATLVGVTIAYDPNGKCGRQYGKCRAGQCCSQYGYCGSGSKYCAHNTPLSEIEPTAAGQCYRGRCSGGLCCSKYGYCGSGPAYCGLGMCQGSCLPDMPNHPAQIQARTEAAQAEAQAEAYNQANEAAQVEAYYQAQTQAQPQVEPAVTKAP | [17] |
| Crustin | Red swamp crayfish (Procambarus clarkii) | MLRVLVLSMLVVAALGHLPRPKPPQPGCNYYCTKPEGPNKGAKYCCGPQFLPLIREEKHNGFCPPPLKDCTRILPPQVCPHDGHCPINQKCCFDTCLDLHTCKPAHFYIN | [17] |
| Hepicidin HAMP2.3 | Gilthead seabream (Sparus aurata) | MKTFSVAVAVAIVLTFICLQESSAVSFTEVQELEEPMSNDGPIAAYKEMPEDSWKMGYGSRRWKCRFCCRCCPRMRGCGLCCRF | [17] |
| Histone-derived, partial | Catla (Labeo catla) | MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP | [17] |
| Piscidin 2 | Schlegel’s black rockfish (Sebastes schlegelii) | MRFIMLFLVLSMVVLMAEPGEAFIHHIFGAIKRIFGDKQRDMADQQELDQRAFDRERAFN | [17] |
| Proline-rich AMP | Green mud crab (Scylla paramamosain) | MRLLWLLVALAAVVPAAMPASAGYFPGRPPFPRPFPRPPSRPFPRPPFPGPFPRPYPWR | [17] |
| Attacin | House fly (Musca domestica) | MFTKSIAIIVFLATLAVVNAQFGGSITSNS RGGADVFARLGHQFGDNKRNFGGGVFAAGNTLGGPVTRGAFLSGNADRFGGSLSHSRTDNFGSTFSQKLNANLFQNDKHKLDANAFHSRTNLDNGFKFNTVGGGLDYNHANGHGASVTASRIPQLNMNTVDVTGKANLWK SADRATSLDLTGGVSKNFGG PLDGQTNKHI GVGLSHDF | [17] |
| Oh-Cath | King cobra (Ophiophagus hannah) | MEGFFWKTLLVVGALAIGGTSSLPHKPLTY EEAVDLAVSIYNSKSGEDSLYRLLEAVPPPEWDPLSESNQELNFTIKETVCLVAEERSLEECDFQEDGAI MGCTGYYFFGESPPVLVLTCKPVGEEEEQK QEEGNEEEKEVEKEEKEEDEKDQPRRVKRF KKFFKKLKNSVKKRAKKFFKKPRVIGVSIPF | [17] |
| TBD-1 | European pond turtle (Emys orbicularis) | YDLSKNCRLRGGICYIGKCPRRFFRSGSCS RGNVCCLRFG | [17] |
| Pelovaterin | Chinese soft-shelled turtle (Pelodiscus sinensis) | DDTPSSRCGSGGWGPCLPIVDLLCIVHVTV GCSGGFGCCRIG | [17] |
| avian β-defensin 1 | Japanese quail (Coturnix japonica) | MKIVYLLFPFILLLAHGAAGSSRDLGKREQ CYRQKGFCAFLKCPSLTIISGKCSRFHVCCKNIWG | [17] |
| α-defensin 5, Paneth cell-specific | Human (Homo sapiens) | MRTIAILAAI LLVALQAQAESLQERADEAT TQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG RCATRESLSGVCEISGRLYRLCCR | [17] |
| θ-defensin-1 | Rhesus monkey (Macaca mulatta) | RCICTRGFCRCLCRRGVC | [17] |
| AMP | Plant Species | Size in kDa | Application and Activity | Reference |
|---|---|---|---|---|
| Thi2.1 (thionin) | Tomato (Lycopersicon esculentum) | 5 | Crop protection | [26,34] |
| Mj-AMP2 (knottin) | Rice (Oryza sativa) | 80 | Resistance to fungal pathogens | [26,35] |
| Lipid Transfer Proteins (LTPs) | Tobacco (Nicotina tabacum) | 9 | Resistance to pathogens | [26,36] |
| Petunia floral defensins | Banana (Musa spp.) | 5 | Effective resistance against pathogenic fungal Fusarium oxysporum | [26,37] |
| PmAMP1 (cysteine-rich protein) | Canola (Brassica napus) | 10.6 | Resistance against fungal pathogens (Leptosphaeria maculans) | [26,38] |
| SN-1 (snakin) | Wheat (Triticum aestivum) | 6.9 | Antifungal activity in vitro and enhanced resistance to fungus (Gaeumannomyces graminis) | [26,39] |
| Pro-SmAMP2 (hevein-like peptide) | Potato (Solanum tuberosum) | 2–6 | Crop protection from Alternaria sp. and Fusarium sp. | [26,40] |
| Vegetable AMPs | Mode of Action | Active Against |
|---|---|---|
| Tomato (snakin SN2) | Pore formation, agglomeration of cells | S. cerevisiae |
| Onion (Ba-49) | Disruption of the cell membrane, triggering the production of ROS *, preventing the formation of biofilms, and degrading the formation of mature biofilms | S. aureus |
| Garlic (F3-3-a, F3-3-b, F3-3-c) | Disruption of the cell membrane | E. coli, S. aureus, Salmonella enteritidis, B. subtilis |
| Chili pepper (F3 fraction) | Membrane permeabilization, production of ROS | S. cerevisiae, C. guilliermondii, C. parapsilosis, K. marxiannus, P. membranifaciens, C. tropicalis, C. albicans |
| Vegetable/Plant Vegetative Organ | Inhibition Zone d on B. subtilis NIBMCC 8752 | Inhibition Zone d on E. coli NIBMCC 8751 |
|---|---|---|
| Parsley (leaves) | 2 | 0 |
| Tomato (seeds) | 5 | 0 |
| Cayenne pepper (tissue discs) | 24 | 25 |
| Cayenne pepper (seeds) | 7 | 11 |
| Onion orange skin (mature bulbs) | 27 | 3 |
| Onion red skin (mature bulbs) | 25 | 3 |
| Onion young (fresh bulbs) | 0 | 0 |
| Garlic (mature bulbs) | 7 | 30 |
| Garlic young (fresh bulbs) | 2 | 0 |
| Animals | AMPs | Reference |
|---|---|---|
| Mammalians | Cathelicidins Defensins Platelet antimicrobial proteins Dermcidins Hepcidins | [6,27,53] |
| Reptiles | Defensins Cathelicidins | [6,27] |
| Fish | β-defensins Cathelicidins Hephecidins (HAMP1 and HAMP2) Histone-derived peptides Piscidins (1–7) | [6,27] |
| Amphibians | Magainins Cancrins | [1,6,27] |
| Crustaceans | Crustins | [6,27] |
| AMP | Structure | Size in kDa | Mode of Action/Target |
|---|---|---|---|
| HD-6 | β | 3–5 | Aggregate on bacterial surface |
| HBD-3 | αβ | 5.1 | Bacterial cell wall (lipid II) |
| HNP-1 | β | 3 | Bacterial cell wall (lipid II) |
| LL-37 | α | 18 | Bacterial membranes and/or DNA |
| Dermcidin | α | 9.5 | Membrane ion channels |
| Histatin 5 | α | 3 | Intracellular mitochondria |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Satchanska, G.; Davidova, S.; Gergova, A. Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides. Antibiotics 2024, 13, 202. https://doi.org/10.3390/antibiotics13030202
Satchanska G, Davidova S, Gergova A. Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides. Antibiotics. 2024; 13(3):202. https://doi.org/10.3390/antibiotics13030202
Chicago/Turabian StyleSatchanska, Galina, Slavena Davidova, and Alexandra Gergova. 2024. "Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides" Antibiotics 13, no. 3: 202. https://doi.org/10.3390/antibiotics13030202
APA StyleSatchanska, G., Davidova, S., & Gergova, A. (2024). Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides. Antibiotics, 13(3), 202. https://doi.org/10.3390/antibiotics13030202
