Next Article in Journal
Antibiotic Exposure during the Preceding Six Months Is Related to Intestinal ESBL-Producing Enterobacteriaceae Carriage in the Elderly
Next Article in Special Issue
Revealing Genome-Based Biosynthetic Potential of Streptomyces sp. BR123 Isolated from Sunflower Rhizosphere with Broad Spectrum Antimicrobial Activity
Previous Article in Journal
Overcoming Methicillin-Resistance Staphylococcus aureus (MRSA) Using Antimicrobial Peptides-Silver Nanoparticles
Previous Article in Special Issue
Emerging Computational Approaches for Antimicrobial Peptide Discovery
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with rAMPage

1
Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada
2
British Columbia Centre for Disease Control, Public Health Laboratory, Vancouver, BC V6Z R4R, Canada
3
Department of Pathology and Laboratory Medicine, University of British Columbia, Vancouver, BC V6T 1Z4, Canada
4
Bioinformatics Graduate Program, University of British Columbia, Vancouver, BC V6T 1Z4, Canada
5
Department of Biochemistry and Microbiology, University of Victoria, Victoria, BC V8P 5C2, Canada
*
Author to whom correspondence should be addressed.
Antibiotics 2022, 11(7), 952; https://doi.org/10.3390/antibiotics11070952
Submission received: 9 June 2022 / Revised: 12 July 2022 / Accepted: 13 July 2022 / Published: 15 July 2022

Abstract

Antibiotic resistance is a global health crisis increasing in prevalence every day. To combat this crisis, alternative antimicrobial therapeutics are urgently needed. Antimicrobial peptides (AMPs), a family of short defense proteins, are produced naturally by all organisms and hold great potential as effective alternatives to small molecule antibiotics. Here, we present rAMPage, a scalable bioinformatics discovery platform for identifying AMP sequences from RNA sequencing (RNA-seq) datasets. In our study, we demonstrate the utility and scalability of rAMPage, running it on 84 publicly available RNA-seq datasets from 75 amphibian and insect species—species known to have rich AMP repertoires. Across these datasets, we identified 1137 putative AMPs, 1024 of which were deemed novel by a homology search in cataloged AMPs in public databases. We selected 21 peptide sequences from this set for antimicrobial susceptibility testing against Escherichia coli and Staphylococcus aureus and observed that seven of them have high antimicrobial activity. Our study illustrates how in silico methods such as rAMPage can enable the fast and efficient discovery of novel antimicrobial peptides as an effective first step in the strenuous process of antimicrobial drug development.

1. Introduction

Due in large part to the overuse and misuse of antibiotics, the prevalence of multidrug-resistant bacteria is rapidly growing at a rate that cannot be matched by antibiotic discovery efforts [1]. As a consequence, the world is currently in an arms race and is at the cusp of a post-antibiotic era [1]. The slow pace of new antibiotic drug discovery, development, and regulation, combined with the accelerated emergence of resistance to existing antibiotics creates what is referred to as the “discovery void” [2]. This gap between discovery and emergence of resistance highlights an urgency to develop new antimicrobial therapeutics. One such alternative is formulations based on the antimicrobial peptides (AMPs) [3].
AMPs are short amphipathic host defense peptides that are produced in all multicellular organisms as part of the innate immune system [3]. Many AMPs operate through nonspecific mechanisms [4], such as direct electrostatic interactions with the cell membrane and immunomodulation [3], allowing for a broad spectrum of efficacy against bacteria [5], viruses [6], and fungi [7]. Furthermore, pathogens develop a slower rate of resistance to AMPs compared to conventional antibiotics [8]. It is these qualities that position AMPs as attractive alternatives to conventional antibiotics [9].
AMPs are often produced as precursor peptides within cells that consist of an N-terminal signal peptide, followed by an acidic pro-sequence, and a C-terminal basic bioactive mature peptide sequence [3]. The acidic pro-sequence neutralizes the basic mature peptide to keep the AMP in its inactive form and the signal peptide and acidic pro-sequence together are referred to as the prepro domain [3]. AMPs are then activated by proteolytic cleavage of the prepro sequence and the release of the mature peptide [3]. While the signal peptide is often highly conserved, the acidic pro-sequence and mature AMP can be quite variable [10]. However, there is evidence that the prepro sequence can vary across different organisms [3] and even within organisms [11].
Past research has shown that amphibians, such as the American bullfrog Rana [Lithobates] catesbeiana, possess a rich diversity of AMPs due to their aquatic and terrestrial life cycle, where the species encounter a wide spectrum of pathogens in these two environments [11]. In amphibians, AMPs such as ranatuerin are secreted at the skin surface upon pathogen exposure and can also stimulate an adaptive immune response [12]. In contrast, insects lack a sophisticated adaptive immune system and yet are highly tolerant to bacterial infection [13,14]. This may be due to the production of AMPs by the innate immune system [14]. In insects, AMPs are found in venom or salivary gland secretions. For example, melittin, a 26 amino acid (AA) peptide is the main component of honeybee venom [13]. While there are many known amphibian AMPs, there are far fewer known insect AMPs. Amphibian AMPs have their own designated database of 1923 peptides in the Database of Anuran Defense Peptides (DADP) [15]. Additionally, they also comprise 34% (1128 sequences) of the curated Antimicrobial Peptide Database 3 (APD3) [16]. Insect AMPs, however, only contribute 10% (325 sequences) in APD3, despite being the next largest non-mammalian classification. Better characterization of these AMP arsenals holds great potential in aiding the discovery of novel AMPs.
Because most AMPs under therapeutic investigation are derived from naturally occurring AMPs in various organisms [2], effective methods to discover natural AMPs would expand the number of potential candidates. Current wet lab screening protocols consist of extraction, isolation, and purification of AMPs through laborious methods such as the collection of skin secretions followed by liquid chromatography and sequence identification using mass spectrometry [17,18,19,20,21]. However, these protocols are costly, time-consuming, and expertise intensive. To resolve this, a scalable, rapid, high throughput in silico methodology built on genomics technologies and able to mine RNA sequencing (RNA-seq) datasets, would greatly aid in the discovery of AMPs funneling into drug development and enhancement processes. There are in silico AMP discovery methodologies presented in earlier studies [22,23,24,25,26], most of which start with processed data such as assembled genomic or protein sequences. Additionally, there are several state-of-the-art tools that perform AMP prediction [27]. Because AMP precursor genes have conserved sequence characteristics, these properties can be leveraged for filtering, and their inferred mature products can be classified as an AMP or not using machine learning methods. With the current unprecedented expansion of data generation and large amounts of sequencing data available in public repositories [28], there exists a rich untapped resource for AMP discovery.
To help fill the antibiotic discovery void, we offer rAMPage: Rapid Antimicrobial Peptide Annotation and Gene Estimation, a homology-based AMP discovery pipeline to mine for putative AMP sequences in publicly available genomic resources. To classify AMP sequences, rAMPage employs AMPlify [27], an attentive deep learning model. Currently, existing AMP databases, (e.g., APD3, DADP) contain less than 4000 validated nonredundant AMP sequences in total. In comparison, we have found over 1000 putative mature AMPs in the present study, with the potential to discover thousands more. Realizing the full potential of such pipelines would require the synthesis and validation of AMP candidates. Herein, we report our results on a select list of 21 peptides we detected using rAMPage.

2. Results

2.1. Identification of Putative AMPs

Using rAMPage, we assembled ~53 million transcripts from 84 RNA-seq datasets derived from the transcriptomes of 38 amphibian (33 frogs, five toads; anurans) and 37 hymenopteran insect (eight ants, five bees, 24 wasps) species and flagged 203,758 candidate peptide sequences to be classified (Figure 1). To select a list of high-confidence putative AMPs, we collapsed duplicates from multiple samples and applied three filters: AMPlify prediction score, peptide charge, and peptide length to obtain 1137 peptide sequences. Of these, 795 originate from amphibians, and 342 from insects. Running rAMPage on all 84 datasets took one week, with all datasets (comprising < 1 billion reads) taking less than 24 h (see Supplementary Materials Figure S1 for details on the computational platform and resource usage statistics).
For each sequence, AMPlify [27] reports a prediction score s from 0 to 80, where s is a log-transformation of the AMPlify probability score p
s = −10 log10(1 − p),
and 80 represents the highest confidence.
We note that the training data set for the AMPlify model had an over-representation of AMPs from amphibian species [27]; hence, it is biased towards assigning higher scores for amphibian AMPs. To compensate, we have applied separate score cut-offs for the two groups: 10 for amphibians and 7 for insects. Since the majority of AMPs are positively charged, a net charge threshold of + 2 was applied. As for length, we filtered for sequences that are ≤30 AA, because shorter peptides are more cost-effective to synthesize for downstream validation studies. Figure S2 shows that the length filter used is the most restrictive filter of the three, with only 4.28% and 1.45% of the sequences for amphibians and insects, respectively, meeting this criterion.
Score, charge, length distributions, and AA compositions of the 1137 putative AMPs are characterized in Figures S1 and S4. From this set, 21 AMPs were selected for synthesis and validation, using three prioritization strategies: “Species Count”, “Insect Peptide”, and “AMPlify Score” (see Section 4). The peptides have been named after the species they were discovered from (Table S1), then numbered in order using their AMPlify scores.

2.2. Antimicrobial Susceptibility Testing (AST) Results

A total of 21 of the 1137 putative AMPs (Table S2) were synthesized (Genscript Biotech, Piscataway, NJ, USA) and tested for their antimicrobial activity against Escherichia coli ATCC 25922 and Staphylococcus aureus ATCC 29213 in a minimum of three independent experiments (see Figure S5 for a full set of experimental results). In these antimicrobial susceptibility tests, AMP activity was assessed using two metrics: minimum inhibitory and bactericidal concentrations (MIC and MBC, respectively). Lower MIC and MBC values are desirable as they indicate that lower AMP concentrations are sufficient for inhibitory or bactericidal activity, respectively. AMP toxicity was measured by HC50 hemolytic concentration values—the concentration required to lyse   50% of porcine red blood cells. In contrast to MIC/MBC assays, it is desirable to have higher HC50 values. All 21 putative AMPs exhibited minimal to no hemolytic activity with HC50 values of 64 μg/mL or higher.
Of these 21 putative AMPs, three displayed moderate activity (MIC and MBC in the range 8–16 μg/mL) and four displayed high activity ( 4 μg/mL) against E. coli and/or S. aureus, all with minimal hemolytic activity, as shown in Figure 2. The characteristics of these seven sequences are described in Table 1. All seven AMPs with moderate to high antimicrobial activity have AMPlify scores greater than 25.

2.3. Novelty of Discovered AMPs

To assess if the putative AMPs discovered using rAMPage are novel, a BLASTp [29] (basic local alignment search tool) protein search was performed using the 1137 sequences that met our selection criteria. Of these, 1024 sequences are reported as novel, providing no antimicrobial characterization or exact match (sequence identity = 100%; query coverage = 100%) within the NCBI non-redundant protein database [29]. The novelty analysis results for the seven moderately to highly active AMPs are presented in Table 2. Four of the queried putative AMPs (AmMa1, OdMa12, PeNi10, and PeNi14) are novel in sequence, aligning with high sequence identity ( 90%) to existing NCBI annotations [29]. Two putative AMPs (PeNi11 and TeBi1) are known and published AMPs, aligning with 100% sequence identity of the precursor protein and across the prepro and mature regions. One putative AMP (TeRu4) aligns with high sequence identity to an uncharacterized protein in the NCBI non-redundant protein database.
AmMa1, derived from the Mouping sucker frog, A. mantzorum, aligned with 97% sequence identity to Palustrin-2GN3 [30] from a species of the same genus, A. granulosus, differing only by two AA in the mature region (Figure S3a). Similarly, OdMa12, found in the green odorous frog, O. margaretae, aligned with 98% sequence identity to odorranain-F2 [31] from a species of the same genus, O. grahami, differing only by one AA in the mature region (Figure S3b). While these two sequences (AmMa1 and OdMa2) are very similar to known sequences, we have additionally discovered each of them in a different species of the same genus.
PeNi10 was detected in the dark-spotted frog P. nigromaculatus, and aligned with 82% identity to pelophylaxin-1 [32] from a species of the same genus, P. fukienensis (Figure S3c). We also identified PeNi10 in four other species of frogs: L. boringii, P. megacephalus, R. dennysi, R. omeimontis (Figure S4a). Although the PeNi10 precursor aligns best to pelophylaxin-1, the mature region aligns with complete sequence identity to ranatuerin-2N (unpublished).
PeNi14, also derived from the dark-spotted frog, P. nigromaculatus, aligned with 90% sequence identity to palustrin-2HB1 [33] from a species of the same genus, P. hubeiensis (Figure S6d). PeNi14 was also detected in three other species of frogs: B. gargarizans, P. megacephalus, R. omeimontis (Figure S7b).
Originating from the dark-spotted frog, P. nigromaculatus, PeNi11 aligned with 100% sequence identity to pelophylaxin-1 [32] from a species of the same genus, P. fukienensis, meaning it is identical to a known AMP precursor (Figure S6e). However, in addition to P. nigromaculatus, we also detected PeNi11 in four other species of frogs: L. boringii, P. megacephalus, R. dennysi, R. omeimontis (Figure S7c).
Found in the venom of tramp ant, T. bicarinatum, TeBi1 aligned with 100% sequence identity with bicarinalin [34,35] of the same species (Figure S6f). In the case of TeBi1, its precursor was partial on the 5′ end, accounting for no alignments in the prepro sequence.
TeRu4, discovered in the brain of the small myrmicine ant, T. rugatulus, aligned with 100% sequence identity to an uncharacterized protein [36] from a species of the same genus, T. longispinosus (Figure S6g). While TeRu4 is not a novel protein, it is a novel mature AMP as it has not been previously characterized to have antimicrobial properties.
Additional annotation of the seven bioactive peptides (five amphibians, two insects) can be found in Table S3. The underrepresentation of insect AMPs in the literature, compared to amphibians, is further demonstrated here; while the amphibian peptides have been annotated with “frog antimicrobial peptide” domains in both InterProScan [37] and Pfam [38], the insect sequences have no protein family annotations. Figure S8 illustrates the sequence identity between AMPs identified by rAMPage and known AMPs for amphibian and insect AMPs. Although the majority of putative AMPs from rAMPage were novel sequences, previously reported AMP sequences were also identified and are a good demonstration and internal validation of the robustness of this methodology.

3. Discussion

Using rAMPage, we analyzed 84 RNA-seq datasets of 38 amphibian and 37 insect species to discover 1137 putative AMPs, 1024 of which are novel. In the present study we report our validation results on 21 putative AMPs, with over 1000 additional peptide sequences left to investigate. This list is by no means exhaustive; adjusting the described filtering parameters may yield thousands more discoveries (Table S4). Further, the rAMPage pipeline can be readily used on other transcriptome sequencing datasets, though this might call for modifications in experimental designs. For instance, in the case of bacterial RNA-seq datasets with reduced post-transcriptional polyadenylation, RNA-seq data from rRNA depleted libraries would be recommended as input for the pipeline, as opposed to data from poly(A) enriched libraries [39,40].
While the sensitivity (proportion of reference AMPs captured by the three putative AMP filters) of rAMPage is <50% (Table S5 and Figure S9) with the default filtering thresholds, the filters are implemented to select for high confidence predictions that are also easier and more cost-effective to synthesize for validation. However, as more putative AMPs are discovered and the number of reference AMPs increase in public databases, the rAMPage filters can be adjusted accordingly to report more novel AMPs.
Although rAMPage captures most putative AMPs in their complete mature form, their associated precursor sequences may be incomplete, as shown using multiple sequence alignments with Clustal Omega v1.2.4 [41] (Figure S7). However, most partial transcripts are missing sequence on the 5′ end. Therefore, while the AMP precursors may be partial, the mature AMPs at the C-termini are more likely to be complete, thereby still detectable by rAMPage.
Because progress is rapid in bioinformatics, rAMPage is designed to be flexible as new technologies are developed. The pipeline is implemented as a Makefile with each step as a separate target, making the pipeline modular and providing analysis checkpoints. The tools for each step can be substituted with newer/improved tools if needed. Similarly, the pipeline is versatile and can be adapted for other sequencing technologies, for instance by assembling RNA/cDNA long reads from Pacific Biosciences of California (Menlo Park, CA, USA) or Oxford Nanopore Technologies Ltd. (Oxford, UK) instruments.
Recently, our group released AMPlify and compared its performance to other state-of-the-art tools for AMP prediction [27]. Other machine learning methods included iAMPpred [42], iAMP-2L [43], AMP Scanner Vr. 2 [44], with AMPlify outperforming all previously described AMP prediction tools in metrics of accuracy, sensitivity, and specificity [27]. For this reason, rAMPage employs AMPlify as its AMP prediction step, and will continue to until it is surpassed in performance. Machine learning in AMP discovery is a dynamic study, ranging from AMP sequence prediction and structure classification to de novo AMP sequence generation and design [45,46,47]. While there are existing methods to mine protein databases [48,49], rAMPage is an all-in-one tool to mine next-generation sequencing data directly from reads to AMP prediction.
While rAMPage can find a substantial number of putative AMPs, its main limitation lies in the fact that it uses homology-based sequence selection and machine learning-based sequence classification steps. These two steps are limited by the quantity and quality of data currently available for training the tools. The homology-based step of rAMPage would be less sensitive when there are more divergent signal sequences in the precursor genes. Similarly, the sequence classification engine in the pipeline, AMPlify, may be biased by known (and limited) classes of AMPs in the databases. However, this limitation is not restricted to only AMPlify, but all approaches dependent on AMP databases for training data sets [48,49,50].
Despite these limitations, which are expected to resolve over time as curated AMP sequence databases grow, a sizeable number (>1000 from 84 RNA-seq datasets) of AMPs were reported by the pipeline with the filters described herein. In the tested set of 21 peptides, seven demonstrated antimicrobial activity against a defined set of bacteria in vitro and 15 did not. We note that AST experiments can assess activity against the tested pathogens but cannot rule in or out an activity against other targets. Further, AMPs have multiple modes of action, and the AST protocol used in our study only validates direct action and does not test the putative immunomodulatory effects of these peptides, for instance. Of the seven active putative AMPs, three were moderately active, and all three are expressed in multiple amphibian species, potentially signaling the evolutionary significance of these AMPs.
An AMP of particular interest in the present study is TeRu4, due to its novelty and specificity in bioactivity. The precursor sequence of TeRu4 is 234 AA long, indicating that TeRu4 may be a multi-functional protein, such as a histone whose subsequence includes antimicrobial properties [51]. Additionally, TeRu4 showed a 36.84% sequence similarity to the spaetzle protein from the fruit fly Drosophila melanogaster, a protein in the insect Toll pathway, which triggers AMP production [52]. TeRu4 is also the most specific of the active putative AMPs we tested. While all the other active peptides tested are active against both E. coli and S. aureus, TeRu4 is active only against E. coli, a Gram-negative bacterium. This specificity may indicate a unique mechanism of action.
Despite the great promise of discovering putative AMPs with rAMPage, AMP-based drug development still faces some biological challenges, such as peptide stability and bacterial resistance. AMPs in their mature form are considered more unstable and more easily degraded by proteases. While synthesizing precursors for testing would increase stability, doing so would drive up the cost of synthesis using conventional synthetic chemistry methods. Although resistance to AMPs emerges at a slower rate compared to resistance to antibiotics, bacteria may develop resistance to AMPs through surface remodeling, modulation of AMP gene expression, proteolytic degradation, trapping, efflux pumps, and biofilms [4,53,54,55]. To combat specific mechanisms of resistance, targeted AMP discovery methods are being developed. A method to discover AMPs with anti-biofilm activity is described in a preprint [26], and a curated 3D structural and functional repository of AMPs relevant to biofilm studies called B-AMP was recently published [26]. Finding solutions to these and other challenges in developing AMPs as replacements for conventional small molecule antibiotics is an active field of research [56,57,58].

4. Materials and Methods

rAMPage is an AMP discovery pipeline that takes short RNA-seq reads as input, and outputs candidate putative AMPs for wet lab validation. Since it is a homology-based method to select a list of candidates for classification, a set of reference AMPs is required. Here, we describe how input datasets and reference AMPs are collated, as well as each step of rAMPage.

4.1. Collating Input RNA-Seq Datasets

The RNA-seq reads from 38 amphibian and 37 insect species were downloaded from the Sequence Read Archive (SRA) [59] using fasterq-dump v2.10.5 (http://ncbi.github.io/sra-tools/, accessed on 4 November 2019) from the NCBI SRA Tool Kit. Analyzing RNA-seq (transcriptomic) reads enables the discovery of expressed putative AMPs. Because some RNA-seq experiments were conducted with multiple tissues or treatments, there are 75 species in total, but 84 datasets are shown in Tables S6 and S7.

4.2. Collating Reference AMP Datasets

A set of 3306 AMP sequences were collated from two high-quality AMP databases: the Database of Anuran Defense Peptides (DADP; http://split4.pmfst.hr/dadp/, accessed on 6 December 2018) [15] and the Antimicrobial Peptide Database 3 (APD3; https://aps.unmc.edu, accessed on 14 September 2020) [16]. These databases are highly curated, where sequences have been validated for efficacy. To complement this list, 3835 precursor and mature AMP sequences of amphibian and insect origin were downloaded from the NCBI non-redundant (nr) protein database [29]. These sequences are less curated, including partial sequences and sequences with only in silico prediction, etc., accounting for the difference between numbers from DADP/APD3 and NCBI in Table S8.

4.3. rAMPage Pipeline

rAMPage is implemented as a Makefile and written in bash, Python3, and R. It is publicly available on GitHub (https://github.com/bcgsc/rAMPage, v1.0 accessed on 14 February 2021). The pipeline was tested for the dependencies listed in Tables S9 and S10, and is highly customizable, with its major parameter options listed in Table S4. Command and parameters for each step can be found in Table S11. A flowchart of the rAMPage pipeline is shown in Figure 3.
Because the datasets used for rAMPage originate from publicly available genomic resources and we have no control over the experimental design or protocols used, we performed rigorous quality control. The RNA-seq reads were trimmed to remove adapter sequences using fastp v0.20.0 [60], which does not require the adapter sequences to be known, and instead infers adapter sequences from sequence overlaps between reads. This is particularly convenient when dealing with multiple datasets that possibly have different sequencing protocols.
To assemble the RNA-seq reads into transcripts we used RNA-Bloom v1.3.1 [61], a de novo transcriptome assembler that works with single and paired-end reads. RNA-Bloom is able to assemble transcriptomes without a reference but also allows for reference-guided assembly if a reference is available. It also allows for multi-sample pooling, where, for instance, reads describing multiple tissues from the same individual or different treatments for the same species are assembled together while retaining the tissues or treatment specificity of assembled transcripts.
We note that the transcripts with a smaller number of reads have less reconstruction evidence; thus, assembled sequences with lower measured expression levels may be enriched for misassemblies. To exclude such sequences from downstream analysis, we used Salmon v1.3.0 [62] to quantify assembled transcript expression levels, and filtered out transcripts with less than 1 TPM (transcripts per million) expression.
To obtain translated peptide sequences from the transcripts, TransDecoder v5.5.0 [63] was used to conduct an in silico six-frame open reading frame (ORF) translation, and ORFs that are at least 50 AA were selected for downstream analysis. In the case of nesting ORFs, the longest ORF was chosen.
To select putative AMP precursors from this vast pool of assembled and translated sequences, we conducted a homology search against our curated reference AMP dataset (Table S8) using HMMER v3.3.1 [64] and assigned an Expect (E) value to every sequence. The E-value describes the number of hits expected by chance when searching a database of a particular size [65]. Sequences that share a certain degree of identity, with E-values of less than 10−5, were selected as putative AMP precursors.
These putative precursor (or partial precursor) sequences were then cleaved in silico using ProP v1.0c [66] to obtain putative mature AMP sequences, to be further classified. However, cleavage prediction tools only predict where the cleavage occurs, not what each resulting cleaved peptide represents, and the AMP precursor organization shows inter- and intra-species variability [13,67,68]. While amphibian AMPs are typically cleaved at a lysine–arginine (KR) motif and their precursor structure follows a conserved structure (prepro sequence containing acidic AA residues and a mature bioactive AMP) [67], insect AMPs are typically cleaved at an RXXR motif (two arginine residues surrounding two optional AA) and the precursor structure is not always conserved [68]. Insect AMPs are more variable in structure [13], increasing the difficulty in identifying the putative mature peptide. This difficulty is especially present in precursor structures with multiple acidic regions (UniProtKB P54684.1) or multiple bioactive regions (UniProtKB P35581.1). In such multi-peptide precursors, it is unclear whether each bioactive region is its own isoform or part of a larger mature peptide. To account for this and to possibly discover novel but perhaps not naturally occurring putative AMPs, cleaved peptides were also recombined in a manner similar to alternative splicing (Figure S10). In this procedure, the order and orientation of the cleaved peptides were maintained, and cleaved peptides that originally share cleavage sites were not recombined, with a maximum of three cleaved peptides within recombination. This recombination feature can be turned off in rAMPage’s options.
The collected candidate peptide sequences were classified with AMPlify v1.0.3 [27] as AMP or non-AMP sequences. When given a sequence, AMPlify calculates a score between 0 to 80, with the score ≈ 3.0103 corresponding to the classification probability cutoff of 50% through Equation (1).
To facilitate AMP synthesis for the validation experiments, we filtered the putative AMPs by length and charge, in addition to the AMPlify score. A maximum length of 30 AA was imposed to control the cost of peptide synthesis and to reduce the number of spurious hits from recombined sequences. A minimum charge of +2 was imposed as a proxy to assess the effectiveness of an AMP, as past evidence indicates that more positively charged AMPs show higher activity, especially when their mechanism of action is membrane disruption [69]. Because AMPlify was trained on mostly amphibian AMPs, different score thresholds were imposed for amphibian ( 10) and insect ( 7) datasets to compensate for the dearth of insect training AMPs.
To annotate the final set of filtered putative AMPs, ENTAP v0.10.7, Eukaryotic Non-Model Transcriptome Annotation Pipeline [70], were used, along with UniProtKB (release 2020_06, accessed on 15 December 2020) [71], RefSeq (release 203, accessed on 15 December 2020) [72], and NCBI non-redundant (nr) (v5, accessed on 12 December 2020) [29] protein databases. For AMPs that ENTAP failed to annotate, InterProScan 5 v5.30-69.0 [37] was run separately to annotate protein families, functions, and domains. Exonerate v2.4.0 [73] was used to align the filtered putative AMPs against the reference AMPs to assess how many of the labeled AMPs were already known AMPs. Finally, SABLE v4.0 [74] was optionally used to predict secondary structures of the filtered putative AMPs, for visualization.

4.4. Selecting Filtered Putative AMPs for Validation

To select peptides to validate from the filtered putative AMPs, we ranked their sequences using AMPlify and chose peptides based upon three selection criteria (Figure 3): “Species Count” (n = 7), “Insect Peptide” (n = 12), or “AMPlify Score” (n = 2), for a final total of 21 AMPs (Table S2). The sequences were first clustered using CD-HIT [75] v4.8.1 with a sequence similarity cutoff of 100%. We chose the longest sequence for each of these clusters, removing duplicate and subsumed sequences to obtain a non-redundant sequence set.
In the first selection strategy of “Species Count”, sequences that were present in more than two species were chosen. In the “Insect Peptide” strategy, to balance the training bias of AMPlify towards AMPs of amphibian origin, we specifically selected insect-originating sequences using a reduced AMPlify score cutoff of >20. In the “AMPlify Score” strategy, the two highest-scoring peptides (AMPlify score = 80.0, 69.9) with the highest charge (+4) were chosen for validation.

4.5. Antimicrobial Susceptibility Testing (AST)

Twenty-one putative AMP sequences identified using the rAMPage pipeline were validated through a minimum of three AST experiments performed independently on separate days. In these tests, the AMP activity was assessed using two metrics: minimum inhibitory concentration and minimum bactericidal concentration (MIC and MBC, respectively). MIC and MBC values were determined using procedures outlined by the Clinical and Laboratory Standards Institute (CLSI), with the recommended adaptations for the testing of cationic AMPs described previously [76]. “Wild-type” strains of Escherichia coli (E. coli 25922) and Staphylococcus aureus (S. aureus 29213) were purchased from the American Type Culture Collection (ATCC; Manassas, VA, USA) and were used for screening of antimicrobial activity. Briefly, putative AMPs were synthesized by Genscript (Piscataway, NJ, USA) and received in lyophilized format. These peptides were suspended using ultrapure water (Life Technologies, Grand Island, NY, USA; Invitrogen cat# 10977-015), and an 11 μL two-fold serial dilution of 1280 to 2.5 μg/mL was prepared in duplicate rows in a 96-well microtiter plate, before being combined with 100 μL standardized bacterial inoculum yielding a final duplicate testing range of 128 to 0.25 μg/mL. The bacterial inoculum was prepared using colonies isolated on non-selective agar and combined with Mueller Hinton Broth. This suspension was measured and adjusted to achieve an optical density of 0.08–0.1, equivalent to a 0.5 McFarland standard (1–2 × 108 cfu/mL). The inoculum was then diluted to a target concentration of 5 ± 3 × 105 cfu/mL; total viable counts from the final inoculum were routinely performed to confirm the target bacterial density was achieved. MIC values were reported at the concentrations in which no visible growth was detected following 20–24-h incubation at 37 °C. The MIC and adjacent wells were plated onto non-selective agar; the concentration in which killed 99.9% of the inoculum following additional overnight incubation was determined to be the MBC.

4.6. Hemolysis Experiments

The twenty-one putative AMPs were evaluated for toxicity using three independent hemolysis experiments performed on separate days. Whole blood from healthy donor pigs was purchased from Lampire Biological Laboratories (Pipersville, PA, USA). Red blood cells (RBCs) were washed and isolated by centrifugation, using Roswell Park Memorial Institute medium (RPMI) (Life Technologies, Grand Island, NY, USA; Gibco cat# 11835-030). Lyophilized AMPs were suspended and serially diluted from 128–1 μg/mL using RPMI in a 96-well plate, before being combined with 100 μL of a 1% RBC solution. Following a minimum 30 min incubation at 37 °C, plates were centrifuged and ½ volume from each supernatant was transferred to a new 96-well plate. The absorbance of these wells was measured at 415 nm. To quantify hemolytic activity and determine the AMP concentration that kills 50% of the RBCs (HC50), absorbance readings from wells containing RBCs treated with 11 μL of a 2% Triton-X100 solution or RPMI (AMP solvent-only) were used to define 100% and 0% hemolysis, respectively. All centrifugation steps were performed at 500× g for five minutes in an Allegra-6R centrifuge (Beckman Coulter, CA, USA).

5. Conclusions

rAMPage is a bioinformatics pipeline for high throughput identification of putative AMPs in RNA-seq datasets. It fills a current void in the AMP discovery process, bridging the gap between in silico and in vitro methods. The pipeline has the potential to accelerate the discovery of novel antibiotics, with the possibility to enrich existing AMP sequence repositories. The easy-to-run pipeline design with various checkpoints and the low computational resources required to run rAMPage increase its accessibility to users. By executing rAMPage on publicly available amphibian and insect transcriptome sequencing data, we have identified over 1000 putative AMPs. Of those, we performed functional tests on twenty-one putative AMPs and demonstrated that seven have moderate to high activity against E. coli ATCC 25922 and/or S. aureus ATCC 29213. As the number of tested peptides increases, the wet lab validation results can feed back into rAMPage by augmenting the reference AMP datasets, helping refine the underlying homology and machine learning approaches. We expect rAMPage to have broad utility in the discovery of novel antimicrobials from a wide variety of transcriptome sequencing datasets.

6. Patents

Patent applications pending on the reported novel peptides.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/antibiotics11070952/s1, Figure S1: Putative AMP filters used for amphibians and insects; Figure S2: Runtime and memory of each dataset through rAMPage; Figure S3: Score, length, and charge distribution of filtered putative AMPs; Figure S4: Amino acid composition of filtered putative AMPs; Figure S5: Antimicrobial susceptibility and hemolysis testing of 21 putative AMPs; Figure S6: Multiple sequence alignments of moderately to highly active AMPs; Figure S7: Multiple sequence alignments of moderately to highly active AMP precursors; Figure S8: Distribution of alignment of filtered putative AMPs to mature reference AMPs; Figure S9: Distribution of reference mature AMPs; Figure S10: Approach for peptides with multiple cleavage sites; Table S1: Peptide naming convention; Table S2: Subset of 21 putative AMPs synthesized and validated against E. coli and S. aureus; Table S3: Annotation of moderately to highly active putative mature AMPs; Table S4: Major options for rAMPage; Table S5: Sensitivity of all putative AMP filter combinations; Table S6: Amphibian RNA-seq datasets; Table S7: Insect RNA-seq datasets; Table S8: Breakdown of AMP sequences in AMP databases; Table S9: Shell scripting dependencies of rAMPage; Table S10: Bioinformatic tool dependencies of rAMPage; Table S11: Command and parameters for each step of rAMPage. References [11,27,29,30,41,59,60,61,62,63,64,73,74,75,77,78,79,80,81,82,83,84,85,86,87,88,89,90,91,92,93,94,95,96,97,98,99,100,101,102,103,104,105,106,107,108,109,110,111,112,113,114,115,116,117] are cited in the supplementary materials.

Author Contributions

Conceptualization, I.B., C.C.H. and L.M.N.H.; methodology, I.B., R.L.W., L.C., D.L. and D.S.; software, D.L., S.I.A., K.M.N. and C.L.; validation, D.S., A.Y. and N.L.; data curation, D.L. and C.L.; writing—original draft preparation, D.L.; writing—review and editing, I.B., R.L.W., L.C., D.S., A.Y., C.L., D.L. and C.C.H., funding acquisition, I.B., C.C.H. and L.M.N.H. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by funds from Genome Canada, and Genome BC as part of the PeptAid (291PEP) and AnnoVis (281ANV) projects. Additional support was provided by the Canadian Agricultural Partnership, a federal–provincial–territorial initiative. The program is delivered by the Investment Agriculture Foundation of BC (INV106). Further funds were received from the Office of the Vice President, Research and Innovation of the University of British Columbia. Opinions expressed in this document are those of the author and not necessarily those of the Governments of Canada and British Columbia or the Investment Agriculture Foundation of BC. The Governments of Canada and British Columbia, and the Investment Agriculture Foundation of BC, and their directors, agents, employees, or contractors will not be liable for any claims, damages, or losses of any kind whatsoever arising out of the use of, or reliance upon, this information.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Accessions for input RNA-seq datasets can be found in Tables S6 and S7. rAMPage code is publicly available at https://github.com/bcgsc/rAMPage (v1.0, accessed on 14 February 2021).

Acknowledgments

This work was based on a prototype pipeline created by S. Austin Hammond.

Conflicts of Interest

I.B. is the founder of, and a shareholder in, Amphoraxe Life Sciences Inc.

References

  1. Hede, K. Antibiotic Resistance: An Infectious Arms Race. Nature 2014, 509, S2–S3. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Koo, H.B.; Seo, J. Antimicrobial Peptides under Clinical Investigation. Pept. Sci. 2019, 111, e24122. [Google Scholar] [CrossRef] [Scilit]
  3. Zhang, L.; Gallo, R.L. Antimicrobial Peptides. Curr. Biol. 2016, 26, R14–R19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Andersson, D.I.; Hughes, D.; Kubicek-Sutherland, J.Z. Mechanisms and Consequences of Bacterial Resistance to Antimicrobial Peptides. Drug Resist. Updat. 2016, 26, 43–57. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Brandenburg, K.; Heinbockel, L.; Correa, W.; Lohner, K. Peptides with Dual Mode of Action: Killing Bacteria and Preventing Endotoxin-Induced Sepsis. Biochim. Biophys. Acta BBA-Biomembr. 2016, 1858, 971–979. [Google Scholar] [CrossRef] [Scilit]
  6. Klotman, M.E.; Chang, T.L. Defensins in Innate Antiviral Immunity. Nat. Rev. Immunol. 2006, 6, 447–456. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. De Lucca, A.J.; Walsh, T.J. Antifungal Peptides: Novel Therapeutic Compounds against Emerging Pathogens. Antimicrob. Agents Chemother. 1999, 43, 1–11. [Google Scholar] [CrossRef] [Scilit]
  8. Hancock, R.E.W.; Sahl, H.-G. Antimicrobial and Host-Defense Peptides as New Anti-Infective Therapeutic Strategies. Nat. Biotechnol. 2006, 24, 1551–1557. [Google Scholar] [CrossRef] [Scilit]
  9. Moravej, H.; Moravej, Z.; Yazdanparast, M.; Heiat, M.; Mirhosseini, A.; Moosazadeh Moghaddam, M.; Mirnejad, R. Antimicrobial Peptides: Features, Action, and Their Resistance Mechanisms in Bacteria. Microb. Drug Resist. 2018, 24, 747–767. [Google Scholar] [CrossRef] [Scilit]
  10. Vanhoye, D.; Bruston, F.; Nicolas, P.; Amiche, M. Antimicrobial Peptides from Hylid and Ranin Frogs Originated from a 150-Million-Year-Old Ancestral Precursor with a Conserved Signal Peptide but a Hypermutable Antimicrobial Domain. Eur. J. Biochem. 2003, 270, 2068–2081. [Google Scholar] [CrossRef] [Scilit]
  11. Helbing, C.C.; Hammond, S.A.; Jackman, S.H.; Houston, S.; Warren, R.L.; Cameron, C.E.; Birol, I. Antimicrobial Peptides from Rana [Lithobates] Catesbeiana: Gene Structure and Bioinformatic Identification of Novel Forms from Tadpoles. Sci. Rep. 2019, 9, 1529. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Conlon, J.M.; Mechkarska, M. Host-Defense Peptides with Therapeutic Potential from Skin Secretions of Frogs from the Family Pipidae. Pharmaceuticals 2014, 7, 58–77. [Google Scholar] [CrossRef] [Scilit]
  13. Wu, Q.; Patočka, J.; Kuča, K. Insect Antimicrobial Peptides, a Mini Review. Toxins 2018, 10, 461. [Google Scholar] [CrossRef] [Scilit]
  14. Sheehan, G.; Farrell, G.; Kavanagh, K. Immune Priming: The Secret Weapon of the Insect World. Virulence 2020, 11, 238–246. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Novković, M.; Simunić, J.; Bojović, V.; Tossi, A.; Juretić, D. DADP: The Database of Anuran Defense Peptides. Bioinformatics 2012, 28, 1406–1407. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Wang, G.; Li, X.; Wang, Z. APD3: The Antimicrobial Peptide Database as a Tool for Research and Education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Zhang, R.-W.; Liu, W.-T.; Geng, L.-L.; Chen, X.-H.; Bi, K.-S. Quantitative Analysis of a Novel Antimicrobial Peptide in Rat Plasma by Ultra Performance Liquid Chromatography–Tandem Mass Spectrometry. J. Pharm. Anal. 2011, 1, 191–196. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Shen, W.; Chen, Y.; Yao, H.; Du, C.; Luan, N.; Yan, X. A Novel Defensin-like Antimicrobial Peptide from the Skin Secretions of the Tree Frog, Theloderma Kwangsiensis. Gene 2016, 576, 136–140. [Google Scholar] [CrossRef] [Scilit]
  19. Pei, J.; Feng, Z.; Ren, T.; Sun, H.; Han, H.; Jin, W.; Dang, J.; Tao, Y. Purification, Characterization and Application of a Novel Antimicrobial Peptide from Andrias Davidianus Blood. Lett. Appl. Microbiol. 2018, 66, 38–43. [Google Scholar] [CrossRef] [Scilit]
  20. Chen, W.; Hwang, Y.Y.; Gleaton, J.W.; Titus, J.K.; Hamlin, N.J. Optimization of a Peptide Extraction and LC–MS Protocol for Quantitative Analysis of Antimicrobial Peptides. Future Sci. OA 2019, 5, FSO348. [Google Scholar] [CrossRef] [Scilit]
  21. Chowdhury, T.; Mandal, S.M.; Kumari, R.; Ghosh, A.K. Purification and Characterization of a Novel Antimicrobial Peptide (QAK) from the Hemolymph of Antheraea Mylitta. Biochem. Biophys. Res. Commun. 2020, 527, 411–417. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Amaral, A.C.; Silva, O.N.; Mundim, N.C.C.R.; de Carvalho, M.J.A.; Migliolo, L.; Leite, J.R.S.A.; Prates, M.V.; Bocca, A.L.; Franco, O.L.; Felipe, M.S.S. Predicting Antimicrobial Peptides from Eukaryotic Genomes: In Silico Strategies to Develop Antibiotics. Peptides 2012, 37, 301–308. [Google Scholar] [CrossRef] [Scilit]
  23. Prichula, J.; Primon-Barros, M.; Luz, R.C.Z.; Castro, Í.M.S.; Paim, T.G.S.; Tavares, M.; Ligabue-Braun, R.; d’Azevedo, P.A.; Frazzon, J.; Frazzon, A.P.G.; et al. Genome Mining for Antimicrobial Compounds in Wild Marine Animals-Associated Enterococci. Mar. Drugs 2021, 19, 328. [Google Scholar] [CrossRef] [Scilit]
  24. De la Lastra, J.M.P.; Garrido-Orduña, C.; Borges, A.A.; Jiménez-Arias, D.; García-Machado, F.J.; Hernández, M.; González, C.; Boto, A. Bioinformatics discovery of vertebrate cathelicidins from the mining of available genomes. In Drug Discovery—Concepts to Market; Bobbarala, V., Ed.; InTech: London, UK, 2018; ISBN 978-1-78923-696-5. [Google Scholar]
  25. Tomazou, M.; Oulas, A.; Anagnostopoulos, A.K.; Tsangaris, G.T.; Spyrou, G.M. In Silico Identification of Antimicrobial Peptides in the Proteomes of Goat and Sheep Milk and Feta Cheese. Proteomes 2019, 7, 32. [Google Scholar] [CrossRef] [Scilit]
  26. Mhade, S.; Panse, S.; Tendulkar, G.; Awate, R.; Kadam, S.; Kaushik, K.S. AMPing Up the Search: A Structural and Functional Repository of Antimicrobial Peptides for Biofilm Studies, and a Case Study of Its Application to Corynebacterium striatum, an Emerging Pathogen. Front. Cell. Infect. Microbiol. 2021, 11, 803774. [Google Scholar] [CrossRef] [Scilit]
  27. Li, C.; Sutherland, D.; Hammond, S.A.; Yang, C.; Taho, F.; Bergman, L.; Houston, S.; Warren, R.L.; Wong, T.; Hoang, L.M.N.; et al. AMPlify: Attentive Deep Learning Model for Discovery of Novel Antimicrobial Peptides Effective against WHO Priority Pathogens. BMC Genom. 2022, 23, 77. [Google Scholar] [CrossRef] [Scilit]
  28. Muir, P.; Li, S.; Lou, S.; Wang, D.; Spakowicz, D.J.; Salichos, L.; Zhang, J.; Weinstock, G.M.; Isaacs, F.; Rozowsky, J.; et al. The Real Cost of Sequencing: Scaling Computation to Keep Pace with Data Generation. Genome Biol. 2016, 17, 53. [Google Scholar] [CrossRef] [Scilit]
  29. NCBI Resource Coordinators. Database Resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2016, 44, D7–D19. [Google Scholar] [CrossRef] [Scilit]
  30. Guo, R.; Chen, D.; Diao, Q.; Xiong, C.; Zheng, Y.; Hou, C. Transcriptomic Investigation of Immune Responses of the Apis Cerana Cerana Larval Gut Infected by Ascosphaera Apis. J. Invertebr. Pathol. 2019, 166, 107210. [Google Scholar] [CrossRef] [Scilit]
  31. Li, J.; Xu, X.; Xu, C.; Zhou, W.; Zhang, K.; Yu, H.; Zhang, Y.; Zheng, Y.; Rees, H.H.; Lai, R.; et al. Anti-Infection Peptidomics of Amphibian Skin. Mol. Cell. Proteom. 2007, 6, 882–894. [Google Scholar] [CrossRef] [Scilit]
  32. Song, Y.; Ji, S.; Liu, W.; Yu, X.; Meng, Q.; Lai, R. Different Expression Profiles of Bioactive Peptides in Pelophylax Nigromaculatus from Distinct Regions. Biosci. Biotechnol. Biochem. 2013, 77, 1075–1079. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Wang, X.; Ren, S.; Guo, C.; Zhang, W.; Zhang, X.; Zhang, B.; Li, S.; Ren, J.; Hu, Y.; Wang, H. Identification and Functional Analyses of Novel Antioxidant Peptides and Antimicrobial Peptides from Skin Secretions of Four East Asian Frog Species. Acta Biochim. Biophys. Sin. 2017, 49, 550–559. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Rifflet, A.; Gavalda, S.; Téné, N.; Orivel, J.; Leprince, J.; Guilhaudis, L.; Génin, E.; Vétillard, A.; Treilhou, M. Identification and Characterization of a Novel Antimicrobial Peptide from the Venom of the Ant Tetramorium Bicarinatum. Peptides 2012, 38, 363–370. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Téné, N.; Bonnafé, E.; Berger, F.; Rifflet, A.; Guilhaudis, L.; Ségalas-Milazzo, I.; Pipy, B.; Coste, A.; Leprince, J.; Treilhou, M. Biochemical and Biophysical Combined Study of Bicarinalin, an Ant Venom Antimicrobial Peptide. Peptides 2016, 79, 103–113. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Kaur, R.; Stoldt, M.; Jongepier, E.; Feldmeyer, B.; Menzel, F.; Bornberg-Bauer, E.; Foitzik, S. Ant Behaviour and Brain Gene Expression of Defending Hosts Depend on the Ecological Success of the Intruding Social Parasite. Philos. Trans. R. Soc. Lond. B Biol. Sci. 2019, 374, 20180192. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Jones, P.; Binns, D.; Chang, H.-Y.; Fraser, M.; Li, W.; McAnulla, C.; McWilliam, H.; Maslen, J.; Mitchell, A.; Nuka, G.; et al. InterProScan 5: Genome-Scale Protein Function Classification. Bioinformatics 2014, 30, 1236–1240. [Google Scholar] [CrossRef] [Scilit]
  38. Finn, R.D.; Bateman, A.; Clements, J.; Coggill, P.; Eberhardt, R.Y.; Eddy, S.R.; Heger, A.; Hetherington, K.; Holm, L.; Mistry, J.; et al. Pfam: The Protein Families Database. Nucleic Acids Res. 2014, 42, D222–D230. [Google Scholar] [CrossRef] [Scilit]
  39. Sarkar, N. Polyadenylation of MRNA in Prokaryotes. Annu. Rev. Biochem. 1997, 66, 173–197. [Google Scholar] [CrossRef] [Scilit]
  40. Wangsanuwat, C.; Heom, K.A.; Liu, E.; O’Malley, M.A.; Dey, S.S. Efficient and Cost-Effective Bacterial MRNA Sequencing from Low Input Samples through Ribosomal RNA Depletion. BMC Genom. 2020, 21, 717. [Google Scholar] [CrossRef] [Scilit]
  41. Sievers, F.; Wilm, A.; Dineen, D.; Gibson, T.J.; Karplus, K.; Li, W.; Lopez, R.; McWilliam, H.; Remmert, M.; Söding, J.; et al. Fast, Scalable Generation of High-Quality Protein Multiple Sequence Alignments Using Clustal Omega. Mol. Syst. Biol. 2011, 7, 539. [Google Scholar] [CrossRef] [Scilit]
  42. Meher, P.K.; Sahu, T.K.; Saini, V.; Rao, A.R. Predicting Antimicrobial Peptides with Improved Accuracy by Incorporating the Compositional, Physico-Chemical and Structural Features into Chou’s General PseAAC. Sci. Rep. 2017, 7, 42362. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Xiao, X.; Wang, P.; Lin, W.-Z.; Jia, J.-H.; Chou, K.-C. IAMP-2L: A Two-Level Multi-Label Classifier for Identifying Antimicrobial Peptides and Their Functional Types. Anal. Biochem. 2013, 436, 168–177. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Veltri, D.; Kamath, U.; Shehu, A. Deep Learning Improves Antimicrobial Peptide Recognition. Bioinformatics 2018, 34, 2740–2747. [Google Scholar] [CrossRef] [Scilit]
  45. Das, P.; Wadhawan, K.; Chang, O.; Sercu, T.; Santos, C.D.; Riemer, M.; Chenthamarakshan, V.; Padhi, I.; Mojsilovic, A. PepCVAE: Semi-Supervised Targeted Design of Antimicrobial Peptide Sequences. arXiv 2018, arXiv:1810.07743. [Google Scholar] [CrossRef] [Scilit]
  46. Dean, S.N.; Alvarez, J.A.E.; Zabetakis, D.; Walper, S.A.; Malanoski, A.P. PepVAE: Variational Autoencoder Framework for Antimicrobial Peptide Generation and Activity Prediction. Front. Microbiol. 2021, 12, 725727. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Szymczak, P.; Możejko, M.; Grzegorzek, T.; Bauer, M.; Neubauer, D.; Michalski, M.; Sroka, J.; Setny, P.; Kamysz, W.; Szczurek, E. HydrAMP: A Deep Generative Model for Antimicrobial Peptide Discovery. bioRxiv 2022. [Google Scholar] [CrossRef] [Scilit]
  48. Porto, W.F.; Pires, A.S.; Franco, O.L. Computational Tools for Exploring Sequence Databases as a Resource for Antimicrobial Peptides. Biotechnol. Adv. 2017, 35, 337–349. [Google Scholar] [CrossRef] [Scilit]
  49. Ramazi, S.; Mohammadi, N.; Allahverdi, A.; Khalili, E.; Abdolmaleki, P. A Review on Antimicrobial Peptides Databases and the Computational Tools. Database 2022, 2022, baac011. [Google Scholar] [CrossRef] [Scilit]
  50. Aronica, P.G.A.; Reid, L.M.; Desai, N.; Li, J.; Fox, S.J.; Yadahalli, S.; Essex, J.W.; Verma, C.S. Computational Methods and Tools in Antimicrobial Peptide Research. J. Chem. Inf. Model. 2021, 61, 3172–3196. [Google Scholar] [CrossRef] [Scilit]
  51. Cho, J.H.; Sung, B.H.; Kim, S.C. Buforins: Histone H2A-Derived Antimicrobial Peptides from Toad Stomach. Biochim. Biophys. Acta BBA-Biomembr. 2009, 1788, 1564–1569. [Google Scholar] [CrossRef] [Scilit]
  52. De Gregorio, E.; Spellman, P.T.; Tzou, P.; Rubin, G.M.; Lemaitre, B. The Toll and Imd Pathways Are the Major Regulators of the Immune Response in Drosophila. EMBO J. 2002, 21, 2568–2579. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Guilhelmelli, F.; Vilela, N.; Albuquerque, P.; Derengowski, L.D.S.; Silva-Pereira, I.; Kyaw, C.M. Antibiotic Development Challenges: The Various Mechanisms of Action of Antimicrobial Peptides and of Bacterial Resistance. Front. Microbiol. 2013, 4, 353. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Rodríguez-Rojas, A.; Baeder, D.Y.; Johnston, P.; Regoes, R.R.; Rolff, J. Bacteria Primed by Antimicrobial Peptides Develop Tolerance and Persist. PLoS Pathog. 2021, 17, e1009443. [Google Scholar] [CrossRef] [Scilit]
  55. da Cunha, N.B.; Cobacho, N.B.; Viana, J.F.C.; Lima, L.A.; Sampaio, K.B.O.; Dohms, S.S.M.; Ferreira, A.C.R.; de la Fuente-Núñez, C.; Costa, F.F.; Franco, O.L.; et al. The next Generation of Antimicrobial Peptides (AMPs) as Molecular Therapeutic Tools for the Treatment of Diseases with Social and Economic Impacts. Drug Discov. Today 2017, 22, 234–248. [Google Scholar] [CrossRef] [Scilit]
  56. Cao, J.; de la Fuente-Nunez, C.; Ou, R.W.; Torres, M.D.T.; Pande, S.G.; Sinskey, A.J.; Lu, T.K. Yeast-Based Synthetic Biology Platform for Antimicrobial Peptide Production. ACS Synth. Biol. 2018, 7, 896–902. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Hazam, P.K.; Goyal, R.; Ramakrishnan, V. Peptide Based Antimicrobials: Design Strategies and Therapeutic Potential. Prog. Biophys. Mol. Biol. 2019, 142, 10–22. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Hirano, M.; Saito, C.; Goto, C.; Yokoo, H.; Kawano, R.; Misawa, T.; Demizu, Y. Rational Design of Helix-Stabilized Antimicrobial Peptide Foldamers Containing α,α-Disubstituted AAs or Side-Chain Stapling. ChemPlusChem 2020, 85, 2731–2736. [Google Scholar] [CrossRef] [Scilit]
  59. Leinonen, R.; Sugawara, H.; Shumway, M.; On behalf of the International Nucleotide Sequence Database Collaboration. Sequence Read Archive. Nucleic Acids Res. 2011, 39, D19–D21. [Google Scholar] [CrossRef] [Scilit]
  60. Chen, S.; Zhou, Y.; Chen, Y.; Gu, J. Fastp: An Ultra-Fast All-in-One FASTQ Preprocessor. Bioinformatics 2018, 34, i884–i890. [Google Scholar] [CrossRef] [Scilit]
  61. Nip, K.M.; Chiu, R.; Yang, C.; Chu, J.; Mohamadi, H.; Warren, R.L.; Birol, I. RNA-Bloom Enables Reference-Free and Reference-Guided Sequence Assembly for Single-Cell Transcriptomes. Genome Res. 2020, 30, 1191–1200. [Google Scholar] [CrossRef] [Scilit]
  62. Patro, R.; Duggal, G.; Love, M.I.; Irizarry, R.A.; Kingsford, C. Salmon Provides Fast and Bias-Aware Quantification of Transcript Expression. Nat. Methods 2017, 14, 417–419. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Haas, B.J.; Papanicolaou, A.; Yassour, M.; Grabherr, M.; Blood, P.D.; Bowden, J.; Couger, M.B.; Eccles, D.; Li, B.; Lieber, M.; et al. De Novo Transcript Sequence Reconstruction from RNA-Seq Using the Trinity Platform for Reference Generation and Analysis. Nat. Protoc. 2013, 8, 1494–1512. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Johnson, L.S.; Eddy, S.R.; Portugaly, E. Hidden Markov Model Speed Heuristic and Iterative HMM Search Procedure. BMC Bioinform. 2010, 11, 431. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Finn, R.D.; Clements, J.; Eddy, S.R. HMMER Web Server: Interactive Sequence Similarity Searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [Scilit]
  66. Duckert, P.; Brunak, S.; Blom, N. Prediction of Proprotein Convertase Cleavage Sites. Protein Eng. Des. Sel. 2004, 17, 107–112. [Google Scholar] [CrossRef] [Scilit]
  67. Wang, X.; Song, Y.; Li, J.; Liu, H.; Xu, X.; Lai, R.; Zhang, K. A New Family of Antimicrobial Peptides from Skin Secretions of Rana Pleuraden. Peptides 2007, 28, 2069–2074. [Google Scholar] [CrossRef] [Scilit]
  68. Yi, H.-Y.; Chowdhury, M.; Huang, Y.-D.; Yu, X.-Q. Insect Antimicrobial Peptides and Their Applications. Appl. Microbiol. Biotechnol. 2014, 98, 5807–5822. [Google Scholar] [CrossRef] [Scilit]
  69. Jiang, Z.; Vasil, A.I.; Hale, J.D.; Hancock, R.E.W.; Vasil, M.L.; Hodges, R.S. Effects of Net Charge and the Number of Positively Charged Residues on the Biological Activity of Amphipathic Alpha-Helical Cationic Antimicrobial Peptides. Biopolymers 2008, 90, 369–383. [Google Scholar] [CrossRef] [Scilit]
  70. Hart, A.J.; Ginzburg, S.; Xu, M.; Fisher, C.R.; Rahmatpour, N.; Mitton, J.B.; Paul, R.; Wegrzyn, J.L. EnTAP: Bringing Faster and Smarter Functional Annotation to Non-model Eukaryotic Transcriptomes. Mol. Ecol. Resour. 2020, 20, 591–604. [Google Scholar] [CrossRef] [Scilit]
  71. The UniProt Consortium; Bateman, A.; Martin, M.-J.; Orchard, S.; Magrane, M.; Agivetova, R.; Ahmad, S.; Alpi, E.; Bowler-Barnett, E.H.; Britto, R.; et al. UniProt: The Universal Protein Knowledgebase in 2021. Nucleic Acids Res. 2021, 49, D480–D489. [Google Scholar] [CrossRef] [Scilit]
  72. O’Leary, N.A.; Wright, M.W.; Brister, J.R.; Ciufo, S.; Haddad, D.; McVeigh, R.; Rajput, B.; Robbertse, B.; Smith-White, B.; Ako-Adjei, D.; et al. Reference Sequence (RefSeq) Database at NCBI: Current Status, Taxonomic Expansion, and Functional Annotation. Nucleic Acids Res. 2016, 44, D733–D745. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  73. Slater, G.; Birney, E. Automated Generation of Heuristics for Biological Sequence Comparison. BMC Bioinform. 2005, 6, 31. [Google Scholar] [CrossRef] [Scilit]
  74. Adamczak, R.; Porollo, A.; Meller, J. Combining Prediction of Secondary Structure and Solvent Accessibility in Proteins. Proteins 2005, 59, 467–475. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Fu, L.; Niu, B.; Zhu, Z.; Wu, S.; Li, W. CD-HIT: Accelerated for Clustering the next-Generation Sequencing Data. Bioinformatics 2012, 28, 3150–3152. [Google Scholar] [CrossRef] [Scilit]
  76. Wiegand, I.; Hilpert, K.; Hancock, R.E.W. Agar and Broth Dilution Methods to Determine the Minimal Inhibitory Concentration (MIC) of Antimicrobial Substances. Nat. Protoc. 2008, 3, 163–175. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  77. Sanchez, E.; Rodríguez, A.; Grau, J.H.; Lötters, S.; Künzel, S.; Saporito, R.A.; Ringler, E.; Schulz, S.; Wollenberg Valero, K.C.; Vences, M. Transcriptomic Signatures of Experimental Alkaloid Consumption in a Poison Frog. Genes 2019, 10, 733. [Google Scholar] [CrossRef] [Scilit]
  78. Siu-Ting, K.; Torres-Sánchez, M.; San Mauro, D.; Wilcockson, D.; Wilkinson, M.; Pisani, D.; O’Connell, M.J.; Creevey, C.J. Inadvertent Paralog Inclusion Drives Artifactual Topologies and Timetree Estimates in Phylogenomics. Mol. Biol. Evol. 2019, 36, 1344–1356. [Google Scholar] [CrossRef] [Scilit]
  79. Xia, Y.; Luo, W.; Yuan, S.; Zheng, Y.; Zeng, X. Microsatellite Development from Genome Skimming and Transcriptome Sequencing: Comparison of Strategies and Lessons from Frog Species. BMC Genom. 2018, 19, 886. [Google Scholar] [CrossRef] [Scilit]
  80. Fan, W.; Jiang, Y.; Zhang, M.; Yang, D.; Chen, Z.; Sun, H.; Lan, X.; Yan, F.; Xu, J.; Yuan, W. Comparative Transcriptome Analyses Reveal the Genetic Basis Underlying the Immune Function of Three Amphibians’ Skin. PLoS ONE 2017, 12, e0190023. [Google Scholar] [CrossRef] [Scilit]
  81. Reilly, B.D.; Schlipalius, D.I.; Cramp, R.L.; Ebert, P.R.; Franklin, C.E. Frogs and Estivation: Transcriptional Insights into Metabolism and Cell Survival in a Natural Model of Extended Muscle Disuse. Physiol. Genom. 2013, 45, 377–388. [Google Scholar] [CrossRef] [Scilit]
  82. Liscano Martinez, Y.; Arenas Gómez, C.M.; Smith, J.; Delgado, J.P. A Tree Frog (Boana Pugnax) Dataset of Skin Transcriptome for the Identification of Biomolecules with Potential Antimicrobial Activities. Data Brief 2020, 32, 106084. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  83. Grogan, L.F.; Mulvenna, J.; Gummer, J.P.A.; Scheele, B.C.; Berger, L.; Cashins, S.D.; McFadden, M.S.; Harlow, P.; Hunter, D.A.; Trengove, R.D.; et al. Survival, Gene and Metabolite Responses of Litoria Verreauxii Alpina Frogs to Fungal Disease Chytridiomycosis. Sci. Data 2018, 5, 180033. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Qiao, L.; Yang, W.; Fu, J.; Song, Z. Transcriptome Profile of the Green Odorous Frog (Odorrana Margaretae). PLoS ONE 2013, 8, e75211. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  85. Chang, L.; Zhu, W.; Shi, S.; Zhang, M.; Jiang, J.; Li, C.; Xie, F.; Wang, B. Plateau Grass and Greenhouse Flower? Distinct Genetic Basis of Closely Related Toad Tadpoles Respectively Adapted to High Altitude and Karst Caves. Genes 2020, 11, 123. [Google Scholar] [CrossRef] [Scilit]
  86. Caty, S.N.; Alvarez-Buylla, A.; Byrd, G.D.; Vidoudez, C.; Roland, A.B.; Tapia, E.E.; Budnik, B.; Trauger, S.A.; Coloma, L.A.; O’Connell, L.A. Molecular Physiology of Chemical Defenses in a Poison Frog. J. Exp. Biol. 2019, 222, jeb.204149. [Google Scholar] [CrossRef] [Scilit]
  87. Shu, Y.; Xia, J.; Yu, Q.; Wang, G.; Zhang, J.; He, J.; Wang, H.; Zhang, L.; Wu, H. Integrated Analysis of MRNA and MiRNA Expression Profiles Reveals Muscle Growth Differences between Adult Female and Male Chinese Concave-Eared Frogs (Odorrana Tormota). Gene 2018, 678, 241–251. [Google Scholar] [CrossRef] [Scilit]
  88. Yoshida, N.; Kaito, C. Dataset for de Novo Transcriptome Assembly of the African Bullfrog Pyxicephalus Adspersus. Data Brief 2020, 30, 105388. [Google Scholar] [CrossRef] [Scilit]
  89. Bossuyt, F.; Schulte, L.M.; Maex, M.; Janssenswillen, S.; Novikova, P.Y.; Biju, S.D.; Van de Peer, Y.; Matthijs, S.; Roelants, K.; Martel, A.; et al. Multiple Independent Recruitment of Sodefrin Precursor-Like Factors in Anuran Sexually Dimorphic Glands. Mol. Biol. Evol. 2019, 36, 1921–1930. [Google Scholar] [CrossRef] [Scilit]
  90. Zhang, Y.; Li, Y.; Qin, Z.; Wang, H.; Li, J. A Screening Assay for Thyroid Hormone Signaling Disruption Based on Thyroid Hormone-Response Gene Expression Analysis in the Frog Pelophylax Nigromaculatus. J. Environ. Sci. 2015, 34, 143–154. [Google Scholar] [CrossRef] [Scilit]
  91. Eskew, E.A.; Shock, B.C.; LaDouceur, E.E.B.; Keel, K.; Miller, M.R.; Foley, J.E.; Todd, B.D. Gene Expression Differs in Susceptible and Resistant Amphibians Exposed to Batrachochytrium Dendrobatidis. R. Soc. Open sci. 2018, 5, 170910. [Google Scholar] [CrossRef] [Scilit]
  92. Stuckert, A.M.M.; Chouteau, M.; McClure, M.; LaPolice, T.M.; Linderoth, T.; Nielsen, R.; Summers, K.; MacManes, M.D. The Genomics of Mimicry: Gene Expression throughout Development Provides Insights into Convergent and Divergent Phenotypes in a Müllerian Mimicry System. Mol. Ecol. 2021, 30, 4039–4061. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  93. Christenson, M.K.; Trease, A.J.; Potluri, L.-P.; Jezewski, A.J.; Davis, V.M.; Knight, L.A.; Kolok, A.S.; Davis, P.H. De Novo Assembly and Analysis of the Northern Leopard Frog Rana Pipiens Transcriptome. J. Genom. 2014, 2, 141–149. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  94. Price, S.J.; Garner, T.W.J.; Balloux, F.; Ruis, C.; Paszkiewicz, K.H.; Moore, K.; Griffiths, A.G.F. A de Novo Assembly of the Common Frog (Rana Temporaria) Transcriptome and Comparison of Transcription Following Exposure to Ranavirus and Batrachochytrium Dendrobatidis. PLoS ONE 2015, 10, e0130500. [Google Scholar] [CrossRef] [Scilit]
  95. Furman, B.L.S.; Evans, B.J. Sequential Turnovers of Sex Chromosomes in African Clawed Frogs (Xenopus) Suggest Some Genomic Regions Are Good at Sex Determination. G3 (Bethesda) 2016, 6, 3625–3633. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Birol, I.; Behsaz, B.; Hammond, S.A.; Kucuk, E.; Veldhoen, N.; Helbing, C.C. De Novo Transcriptome Assemblies of Rana (Lithobates) Catesbeiana and Xenopus Laevis Tadpole Livers for Comparative Genomics without Reference Genomes. PLoS ONE 2015, 10, e0130720. [Google Scholar] [CrossRef] [Scilit]
  97. Barbosa-Morais, N.L.; Irimia, M.; Pan, Q.; Xiong, H.Y.; Gueroussov, S.; Lee, L.J.; Slobodeniuc, V.; Kutter, C.; Watt, S.; Colak, R.; et al. The Evolutionary Landscape of Alternative Splicing in Vertebrate Species. Science 2012, 338, 1587–1593. [Google Scholar] [CrossRef] [Scilit]
  98. Arvidson, R.; Kaiser, M.; Lee, S.S.; Urenda, J.-P.; Dail, C.; Mohammed, H.; Nolan, C.; Pan, S.; Stajich, J.E.; Libersat, F.; et al. Parasitoid Jewel Wasp Mounts Multipronged Neurochemical Attack to Hijack a Host Brain. Mol. Cell. Proteom. 2019, 18, 99–114. [Google Scholar] [CrossRef] [Scilit]
  99. Yek, S.H.; Boomsma, J.J.; Schiøtt, M. Differential Gene Expression in Acromyrmex Leaf-Cutting Ants after Challenges with Two Fungal Pathogens. Mol. Ecol. 2013, 22, 2173–2187. [Google Scholar] [CrossRef] [Scilit]
  100. Yoon, K.A.; Kim, K.; Kim, W.-J.; Bang, W.Y.; Ahn, N.-H.; Bae, C.-H.; Yeo, J.-H.; Lee, S.H. Characterization of Venom Components and Their Phylogenetic Properties in Some Aculeate Bumblebees and Wasps. Toxins 2020, 12, 47. [Google Scholar] [CrossRef] [Scilit]
  101. McNamara-Bordewick, N.K.; McKinstry, M.; Snow, J.W. Robust Transcriptional Response to Heat Shock Impacting Diverse Cellular Processes despite Lack of Heat Shock Factor in Microsporidia. mSphere 2019, 4, e00219-19. [Google Scholar] [CrossRef] [Scilit]
  102. Becchimanzi, A.; Avolio, M.; Bostan, H.; Colantuono, C.; Cozzolino, F.; Mancini, D.; Chiusano, M.L.; Pucci, P.; Caccia, S.; Pennacchio, F. Venomics of the Ectoparasitoid Wasp Bracon Nigricans. BMC Genom. 2020, 21, 34. [Google Scholar] [CrossRef] [Scilit]
  103. de Bekker, C.; Ohm, R.A.; Loreto, R.G.; Sebastian, A.; Albert, I.; Merrow, M.; Brachmann, A.; Hughes, D.P. Gene Expression during Zombie Ant Biting Behavior Reflects the Complexity Underlying Fungal Parasitic Behavioral Manipulation. BMC Genom. 2015, 16, 620. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. von Wyschetzki, K.; Lowack, H.; Heinze, J. Transcriptomic Response to Injury Sheds Light on the Physiological Costs of Reproduction in Ant Queens. Mol. Ecol. 2016, 25, 1972–1985. [Google Scholar] [CrossRef] [Scilit]
  105. Zhao, W.; Shi, M.; Ye, X.; Li, F.; Wang, X.; Chen, X. Comparative Transcriptome Analysis of Venom Glands from Cotesia Vestalis and Diadromus Collaris, Two Endoparasitoids of the Host Plutella Xylostella. Sci. Rep. 2017, 7, 1298. [Google Scholar] [CrossRef] [Scilit]
  106. Coffman, K.A.; Harrell, T.C.; Burke, G.R. A Mutualistic Poxvirus Exhibits Convergent Evolution with Other Heritable Viruses in Parasitoid Wasps. J. Virol. 2020, 94, e02059-19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  107. Burke, G.R.; Strand, M.R. Systematic Analysis of a Wasp Parasitism Arsenal. Mol. Ecol. 2014, 23, 890–901. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  108. Robinson, S.D.; Mueller, A.; Clayton, D.; Starobova, H.; Hamilton, B.R.; Payne, R.J.; Vetter, I.; King, G.F.; Undheim, E.A.B. A Comprehensive Portrait of the Venom of the Giant Red Bull Ant, Myrmecia Gulosa, Reveals a Hyperdiverse Hymenopteran Toxin Gene Family. Sci. Adv. 2018, 4, eaau4640. [Google Scholar] [CrossRef] [Scilit]
  109. Martinson, E.O.; Mrinalini; Kelkar, Y.D.; Chang, C.-H.; Werren, J.H. The Evolution of Venom by Co-Option of Single-Copy Genes. Curr. Biol. 2017, 27, 2007–2013. [Google Scholar] [CrossRef] [Scilit]
  110. Cook, N.; Boulton, R.A.; Green, J.; Trivedi, U.; Tauber, E.; Pannebakker, B.A.; Ritchie, M.G.; Shuker, D.M. Differential Gene Expression Is Not Required for Facultative Sex Allocation: A Transcriptome Analysis of Brain Tissue in the Parasitoid Wasp Nasonia vitripennis. R. Soc. Open sci. 2018, 5, 171718. [Google Scholar] [CrossRef] [Scilit]
  111. Sim, A.D.; Wheeler, D. The Venom Gland Transcriptome of the Parasitoid Wasp Nasonia Vitripennis Highlights the Importance of Novel Genes in Venom Function. BMC Genom. 2016, 17, 571. [Google Scholar] [CrossRef] [Scilit]
  112. Kazuma, K.; Masuko, K.; Konno, K.; Inagaki, H. Combined Venom Gland Transcriptomic and Venom Peptidomic Analysis of the Predatory Ant Odontomachus Monticola. Toxins 2017, 9, 323. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  113. Smith, C.R.; Helms Cahan, S.; Kemena, C.; Brady, S.G.; Yang, W.; Bornberg-Bauer, E.; Eriksson, T.; Gadau, J.; Helmkampf, M.; Gotzek, D.; et al. How Do Genomes Create Novel Phenotypes? Insights from the Loss of the Worker Caste in Ant Social Parasites. Mol. Biol. Evol. 2015, 32, 2919–2931. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  114. Özbek, R.; Wielsch, N.; Vogel, H.; Lochnit, G.; Foerster, F.; Vilcinskas, A.; von Reumont, B.M. Proteo-Transcriptomic Characterization of the Venom from the Endoparasitoid Wasp Pimpla Turionellae with Aspects on Its Biology and Evolution. Toxins 2019, 11, 721. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  115. Yang, L.; Yang, Y.; Liu, M.-M.; Yan, Z.-C.; Qiu, L.-M.; Fang, Q.; Wang, F.; Werren, J.H.; Ye, G.-Y. Identification and Comparative Analysis of Venom Proteins in a Pupal Ectoparasitoid, Pachycrepoideus Vindemmiae. Front. Physiol. 2020, 11, 9. [Google Scholar] [CrossRef] [Scilit]
  116. Bouzid, W.; Verdenaud, M.; Klopp, C.; Ducancel, F.; Noirot, C.; Vétillard, A. De Novo Sequencing and Transcriptome Analysis for Tetramorium Bicarinatum: A Comprehensive Venom Gland Transcriptome Analysis from an Ant Species. BMC Genom. 2014, 15, 987. [Google Scholar] [CrossRef] [Scilit]
  117. Negroni, M.A.; Foitzik, S.; Feldmeyer, B. Long-Lived Temnothorax Ant Queens Switch from Investment in Immunity to Antioxidant Production with Age. Sci. Rep. 2019, 9, 7270. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Statistics and attrition as the sequencing data are processed by the rAMPage AMP discovery pipeline. rAMPage processes RNA-seq datasets from raw reads to transcripts to putative AMPs. In this case, a putative AMP is defined as a sequence with an AMPlify score 10 for amphibians or 7 for insects, a length 30 AA, and a charge 2. Datasets with a reference transcriptome used during assembly are indicated with an asterisk. The total number of putative AMPs (n = 1478, including 341 duplicates) are shown in purple, discovered from a total of ~53 million assembled transcripts.
Figure 1. Statistics and attrition as the sequencing data are processed by the rAMPage AMP discovery pipeline. rAMPage processes RNA-seq datasets from raw reads to transcripts to putative AMPs. In this case, a putative AMP is defined as a sequence with an AMPlify score 10 for amphibians or 7 for insects, a length 30 AA, and a charge 2. Datasets with a reference transcriptome used during assembly are indicated with an asterisk. The total number of putative AMPs (n = 1478, including 341 duplicates) are shown in purple, discovered from a total of ~53 million assembled transcripts.
Antibiotics 11 00952 g001
Figure 2. Antimicrobial susceptibility and hemolysis test results of seven moderately and highly active putative AMPs. AMPs were tested for their bioactivity against E. coli and S. aureus to determine minimum inhibitory and bactericidal concentrations (MIC and MBC, respectively). AMPs were also tested for their hemolytic activity using pig red blood cells to determine hemolytic concentration (HC50) values. Moderate activity (MIC and MBC in the range of 8–16 μg/mL) and high activity ( 4 μg/mL) thresholds indicated by the dashed lines. AMPs are ordered by increasing MIC values against E. coli ATCC 25922.
Figure 2. Antimicrobial susceptibility and hemolysis test results of seven moderately and highly active putative AMPs. AMPs were tested for their bioactivity against E. coli and S. aureus to determine minimum inhibitory and bactericidal concentrations (MIC and MBC, respectively). AMPs were also tested for their hemolytic activity using pig red blood cells to determine hemolytic concentration (HC50) values. Moderate activity (MIC and MBC in the range of 8–16 μg/mL) and high activity ( 4 μg/mL) thresholds indicated by the dashed lines. AMPs are ordered by increasing MIC values against E. coli ATCC 25922.
Antibiotics 11 00952 g002
Figure 3. rAMPage workflow. The rAMPage pipeline and downstream selection of putative AMPs for validation.
Figure 3. rAMPage workflow. The rAMPage pipeline and downstream selection of putative AMPs for validation.
Antibiotics 11 00952 g003
Table 1. Characteristics of putative AMP sequences with moderate to high in vitro bioactivity against E. coli or S. aureus. Each sequence is separated into the prepro sequence and the predicted mature peptide sequence. Conserved proteolytic cleavage sites are underlined in the prepro sequences.
Table 1. Characteristics of putative AMP sequences with moderate to high in vitro bioactivity against E. coli or S. aureus. Each sequence is separated into the prepro sequence and the predicted mature peptide sequence. Conserved proteolytic cleavage sites are underlined in the prepro sequences.
Prepro-SequencePutative Mature Peptide
SequenceLengthChargeAMPlify ScoreMIC
(μg/mL) *
Peptide ID
E. coli S. aureus
MFTMKKSLLVLFFLGIVSLSLCEEERNADEDDGEMTEEVKRGILDTLKQLGKAAVQGLLSKAACKLAKTC29480.02–44–8AmMa1
LGIVSLSLCQEERSADDEEGEVIEEEVKRGFMDTAKNVAKNVAVTLLYNLKCKITKAC29469.2464OdMa12
MFTMKKSLLFFFLGTIALSLCEEERGADEEENGGEITDEEVKRGLLLDTVKGAAKNVAGILLNKLKCKVTGDC30361.8816–32PeNi10
MFTMKKSLLLVFFLGTIALSLCEEERGADDDNGGEITDEEIKRGILTDTLKGAAKNVAGVLLDKLKCKITGGC30361.88–1632–128PeNi11
MFTLRKSLLLLFFLGMVSLSLCEQERDADEDEGEVTEEVKRGLWTTIKEGVKNFSVGVLDKIRCKITGGC29367.54–816–64PeNi14
MKLLALVLVLSCVVAYTTARKRGQYWPTNTKIFTTPYRFRREADQGSIVANLKNTPQLPFDDNENLRLVLFDNDPTVDLGEDDKEIPGPQSQPNALSNNLHLIDENDYFSSYTSQPGTYRSFPRNFGTSGRYRWRREAGGHVEPRLRFDAETQRGNSFFTDFADLQRRANGRGIEPTVSATAGIRFRQEADQINPLAVRRERRSWLSKSVKKLVNKKNYTRLEKLAKKKLFNE30825.51–2>128TeRu4
IFLVGCKLFGNFILQRMQLLLALADAVAKIKIPWGKVKDFLVGGMKAVGKK23645.01–42–8TeBi1
* MIC: Minimum inhibitory concentration. Escherichia coli ATCC 25922; Staphylococcus aureus ATCC 29213.
Table 2. Comparison of sequence identities (%) of the discovered AMPs with their best-known AMP blastp matches to the NCBI non-redundant (nr) protein database over the entire sequence (precursor), prepro or mature sequences.
Table 2. Comparison of sequence identities (%) of the discovered AMPs with their best-known AMP blastp matches to the NCBI non-redundant (nr) protein database over the entire sequence (precursor), prepro or mature sequences.
Peptide IDSource OrganismHighest Scoring Blastp MatchSequence Identity (%)
PrecursorPreproMature
AmMa1Amolops mantzorumPalustrin-2GN3 (ADM34231.1)
[Amolops granulosus]
9710093
OdMa12Odorrana margaretaeOdorranain-F2 (ABG76517.1)
[Odorrana grahami]
9810097
PeNi10Leptobrachium boringii
Polypedates megacephalus
Pelophylax nigromaculatus
Rhacophorus dennysi
Rhacophorus omeimontis
Pelophylaxin-1 (Q2WCN8.1)
[Pelophylax fukienensis]
Ranatuerin-2N (AEM68233.1) *
[Pelophylax nigromaculatus]
82

98
86

97
77

100
PeNi11Leptobrachium boringii
Polypedates megacephalus
Pelophylax nigromaculatus
Rhacophorus dennysi
Rhacophorus omeimontis
Pelophylaxin-1 (Q2WCN8.1)
[Pelophylax fukienensis]
100100100
PeNi14Bufo gargarizans
Polypedates megacephalus
Pelophylax nigromaculatus
Rhacophorus omeimontis
Palustrin-2HB1 (AIU998997.1)
[Pelophylax hubeiensis]
909386
TeRu4Temnothorax rugatulusUncharacterized protein (XP_024884948.1)
[Temnothorax curvispinosus]
Uncharacterized protein (TGZ47385.1) *
[Temnothorax longispinosus]
94

91
93

90
97

97
TeBi1Tetramorium bicarinatumM-myrmicitoxin(01)-Tb1a (W8GNV3.1)
[Tetramorium bicarinatum]
100-100
* Highest scoring blastp match when query sequence consists of only the mature sequence instead of the whole precursor. -: no significant alignment.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Lin, D.; Sutherland, D.; Aninta, S.I.; Louie, N.; Nip, K.M.; Li, C.; Yanai, A.; Coombe, L.; Warren, R.L.; Helbing, C.C.; et al. Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with rAMPage. Antibiotics 2022, 11, 952. https://doi.org/10.3390/antibiotics11070952

AMA Style

Lin D, Sutherland D, Aninta SI, Louie N, Nip KM, Li C, Yanai A, Coombe L, Warren RL, Helbing CC, et al. Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with rAMPage. Antibiotics. 2022; 11(7):952. https://doi.org/10.3390/antibiotics11070952

Chicago/Turabian Style

Lin, Diana, Darcy Sutherland, Sambina Islam Aninta, Nathan Louie, Ka Ming Nip, Chenkai Li, Anat Yanai, Lauren Coombe, René L. Warren, Caren C. Helbing, and et al. 2022. "Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with rAMPage" Antibiotics 11, no. 7: 952. https://doi.org/10.3390/antibiotics11070952

APA Style

Lin, D., Sutherland, D., Aninta, S. I., Louie, N., Nip, K. M., Li, C., Yanai, A., Coombe, L., Warren, R. L., Helbing, C. C., Hoang, L. M. N., & Birol, I. (2022). Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with rAMPage. Antibiotics, 11(7), 952. https://doi.org/10.3390/antibiotics11070952

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop