Next Article in Journal
Pruritus as a Distinctive Feature of Type 2 Inflammation
Previous Article in Journal
Factors Associated with COVID-19 Vaccine Hesitancy
 
 
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Vaccine Efficacy of Self-Assembled Multimeric Protein Scaffold Particles Displaying the Glycoprotein Gn Head Domain of Rift Valley Fever Virus

1
Department of Virology, Wageningen Bioveterinary Research, 8221 RA Lelystad, The Netherlands
2
Institute of Novel and Emerging Infectious Diseases, Friedrich-Loeffler-Institut, 17493 Greifswald-Insel Riems, Germany
3
Boehringer Ingelheim Veterinary Research Center GmbH & Co. KG, 30559 Hannover, Germany
4
Boehringer Ingelheim, 69007 Lyon, France
5
Laboratory of Virology, Wageningen University and Research, 6708 PB Wageningen, The Netherlands
*
Author to whom correspondence should be addressed.
Current address: Department of Viroscience, Erasmus MC, 3015 CN Rotterdam, The Netherlands.
Vaccines 2021, 9(3), 301; https://doi.org/10.3390/vaccines9030301
Received: 19 February 2021 / Revised: 18 March 2021 / Accepted: 20 March 2021 / Published: 23 March 2021

Abstract

:
Compared to free antigens, antigens immobilized on scaffolds, such as nanoparticles, generally show improved immunogenicity. Conventionally, antigens are conjugated to scaffolds through genetic fusion or chemical conjugation, which may result in impaired assembly or heterogeneous binding and orientation of the antigens. By combining two emerging technologies—i.e., self-assembling multimeric protein scaffold particles (MPSPs) and bacterial superglue—these shortcomings can be overcome and antigens can be bound on particles in their native conformation. In the present work, we assessed whether this technology could improve the immunogenicity of a candidate subunit vaccine against the zoonotic Rift Valley fever virus (RVFV). For this, the head domain of glycoprotein Gn, a known target of neutralizing antibodies, was coupled on various MPSPs to further assess immunogenicity and efficacy in vivo. The results showed that the Gn head domain, when bound to the lumazine synthase-based MPSP, reduced mortality in a lethal mouse model and protected lambs, the most susceptible RVFV target animals, from viremia and clinical signs after immunization. Furthermore, the same subunit coupled to two other MPSPs (Geobacillus stearothermophilus E2 or a modified KDPG Aldolase) provided full protection in lambs as well.

1. Introduction

Protein-, lipid-, mineral-, and polymer-based scaffolds can be used to increase the immunogenicity of antigens. The coupling of antigens to the surface of these so-called nanoparticles enhances uptake by phagocytic cells, stimulating innate-, humoral-, and cellular immune responses [1]. Importantly, multimeric presentation of antigens enhances the activation of B cells via receptor crosslinking, greatly facilitating humoral immune responses [2,3,4,5,6]. When optimally designed, nanoparticle vaccines can even be efficacious in the absence of adjuvants.
Nanoparticles of different sizes and shapes have been developed, with variable display capacities. Three well-known proteins capable of self-assembly into higher order structures include Aquifex aeolicus lumazine synthase (LS) [7], Geobacillus stearothermophilus E2 [8], and a modified 2-dehydro-3-deoxy-phosphogluconate aldolase, commonly known as 2-Keto-3-deoxy-6-phosphogluconate (KDPG) aldolase, named I3-01 [9]. All three multimeric protein scaffold particles (MPSPs) require limited post-translational modifications and can be efficiently produced in E. coli (or in other expression systems). When the C- or N-terminal ends of the monomeric proteins in the assembled particle are surface-exposed, this facilitates fusion of antigens to tags or linker modules. Although antigen subunits can also be genetically fused to the C- and N-terminal ends of the proteins, nanoparticle assembly and integrity could be compromised with increasing structural complexity and size of the antigen. The need for a coordinated folding between the scaffold and the antigen subunit is circumvented when the components are produced separately and subsequently coupled. Chemical conjugation is a generally complex procedure, requiring specific conditions and reagents. Moreover, chemical coupling may result in a heterogeneous decoration of the nanoparticle, compromising efficient presentation to the immune system. Novel technologies are today available that enable highly efficient coupling of antigens to nanoparticles, maintaining their native conformation. A particularly promising technology is referred to as the SpyTag-SpyCatcher “bacterial superglue”, in which a covalent, intermolecular isopeptide bond is formed between the 13 amino acid “SpyTag” peptide and a small (12.3 kDa) “SpyCatcher” protein [10,11]. This two-component superglue is an extremely versatile tool to covalently decorate nanoparticles with antigens and is now being broadly applied to develop vaccines against viral, bacterial and parasitic diseases [12].
As part of the zoonoses anticipation and preparedness initiative project (ZAPI: www.zapi-imi.eu), effective vaccines and antibody therapies are being developed to enable swift response to major new infectious disease threats. The zoonotic Rift Valley fever virus (RVFV) is used as one of the model pathogens to assess the efficacy of the platforms. RVFV is a mosquito-borne bunyavirus (family Phenuiviridae, genus Phlebovirus) that is pathogenic to ruminants and humans. The virus contains a tri-segmented RNA genome, comprising a small (S), medium (M), and large (L) segment. The S and L segments encode the nucleocapsid and polymerase protein, respectively, involved in genome transcription and replication. The S segment additionally encodes a non-structural protein named NSs, which counteracts host innate immune responses [13]. The M segment encodes a polyprotein precursor protein that is co-translationally cleaved into the two structural glycoproteins Gn and Gc, which are involved in host cell binding and fusion of the viral and endosomal membrane. The M segment additionally encodes a 14-kDa non-structural protein named NSm, which was shown to counteract apoptosis and to be important for dissemination in mosquitoes [14,15,16,17].
The RVFV structural glycoproteins Gn and Gc are the only known targets of neutralizing antibodies (nAbs), and correlate with protection in animal models [18,19]. The elucidation of the cryo-electron microscopy structure of RVFV and the crystal structures of Gn and Gc, followed by the fitting of the protein structures into the T = 12 icosahedral virion, have demonstrated that the Gn head domain (Gnhead) is fully exposed on the virion surface, explaining that Gn is the dominant target of neutralizing antibodies [20]. However, before these structures were described, we reported the vaccine efficacy of the Gn ectodomain (Gnhead region + stem region) produced in insect cells, formulated with Stimune water-in-oil adjuvant, in the mouse and lamb model [21,22]. A single vaccination protected lambs from morbidity and mortality, although low levels of viral RNA were detected after challenge infection, suggestive of low-level viremia [21]. Whereas the latter is of little concern for non-pregnant animals, previous studies have demonstrated that even low-level viremia may result in vertical transmission of the virus in pregnant ewes [23]. A seemingly more efficacious candidate vaccine was developed by co-expression of Gn and Gc in insect cells, resulting in the formation of virus-like particles (VLPs) [22]. This candidate vaccine induced nAbs in mice after a single vaccination, even in the absence of adjuvant. However, the yields of these VLPs seemed insufficient to develop a cost-effective vaccine.
In order to develop a Gn-based vaccine with improved immunogenicity, we assessed in this work the immunogenicity of the Gnhead domain of RVFV following coupling of this antigen subunit to the surface of MPSPs. After demonstrating the proof of concept in a murine model, the efficacy of the candidate vaccine was evaluated in the lamb model. Our results show that two vaccinations with adjuvanted MPSPs induces sterile immunity and protects lambs from viremia and clinical signs.

2. Materials and Methods

2.1. Cells and Viruses

The virulent recombinant RVFV-35/74 strain (recRVFV-35/74) was propagated in BHK-21 cells, which were grown in CO2-independent medium (CIM, Gibco), supplemented with 5% fetal calf serum (FCS) (Gibco), 1% L-glutamine (Gibco), and 1% antibiotic/antimycotic (Gibco). For the virus neutralization assay, BHK-21 cells were used, which were grown in GMEM medium, supplemented with 5% FCS, 1% L-glutamine, and 1% antibiotic/antimycotic. Sf9ET cells (ATCC® CRL-3357™) were cultured in Insect-XPRESS medium (Lonza, Maastricht, The Netherlands) supplemented with 1% antibiotic/antimycotic. High Five cells were maintained in an Express Five medium supplemented with 1% glutamine and 1% antibiotic/antimycotic. Both insect cell lines were cultured in suspension at 28 °C in a shaking incubator.

2.2. Gnhead Antigens Production

DNA fragments encoding the Gnhead domain (with or without an N-terminal SpyCatcher domain) were flanked by an N-terminal GP64 signal sequence and a C-terminal twin Strep-Tag (Table 1) and synthesized by GenScript (Piscataway, NJ, USA), resulting in the following open reading frame (ORF) organization: GP64 signal sequence–SpyCatcher–10 GlySer linker–RVFV-Gnhead–enterokinase site–Twin Strep-tag (Table 1). Following the cloning of the fragment in a pBAC-3 baculovirus transfer vector, recombinant baculoviruses were generated with the flashBAC™ ULTRA baculovirus expression system (Oxford Expression Technologies, Oxford, UK). Briefly, transfection mixtures containing the pBAC-3 vector, a bacmid, and Cellfectin II were added to 24-wells plates containing 200,000 SF9-ET cells per well. Rescued viruses were subsequently amplified in SF9-ET suspension cultures infected at low multiplicity of infection (MOI). For protein production, High Five cells were infected at high MOI according to the manufacturer’s protocol (Thermo Fisher Scientific, Breda, The Netherlands). Proteins were purified from supernatants using Strep-Tactin® resin (IBA, Göttingen, Germany) according to the manufacturer’s instructions. Buffers were exchanged to Tris-buffered saline + 200 mM NaCl using Amicon® Ultra centrifugal filters (Merck-Millipore, Amsterdam, The Netherlands). Proteins were separated in 4–12% SDS gels (Thermo Fisher Scientific, Breda, The Netherlands) and stained with GelCode Blue Stain reagent (Thermo Fisher Scientific, Rockford, IL, USA).

2.3. LS-SpyTag Production

E. coli expression strain BL21(DE3) was transformed with a pET24a-based vector-plasmid harboring the expression cassette for the LS-SpyTag protein (Table 1). The plasmid was constructed by gene synthesis and NdeI and SalI restriction endonuclease-based cloning (Eurofins Genomics, Ebersberg, Germany). The transformed bacteria were grown in auto-induction media (AIM) at 37 °C and 180 RPM in the presence of 30 μg/mL kanamycin for approximately 8 h. Cells were harvested by centrifugation (10,000× g, 10 min, 4 °C) and pellets stored at −20 °C until further processing. For recombinant protein purification the cell pellet of 1 L culture was resuspended in 80 mL lysis buffer (50 mM Na Phosphate, 20 mM NaCl, 3 mM ethylenediaminetetraacetic acid (EDTA), pH 7.0) and subjected to 3 freeze-thaw cycles followed by 3 sonication cycles of 7 min each. Soluble and insoluble fractions were separated by centrifugation (15,000× g, 30 min, 4 °C) with the insoluble fraction stored at −20 °C until further processing. Subsequently, three washing steps were performed (buffer 1: 50 mM Sodium Phosphate pH 7.0, 2 M NaCl, buffer 2: 50 mM Sodium Phosphate pH 7.0, buffer 3: 2.0% Triton X100, 50 mM sodium phosphate pH 7.0), each followed by a centrifugation step (15,000× g, 30 min, 4 °C). The final pellet was solubilized in 50 mM glycine, 8 M Urea, pH 10.0 by overnight incubation with shaking, at 8 °C. Subsequently the solubilized fraction was separated by centrifugation (15,000× g, 60 min, 8 °C) and subjected to ion exchange chromatography (IEXC) (Q Sepharose High Performance, buffer A: 50 mM glycine, 8 M Urea, pH 10.0, buffer B: 50 mM glycine, 8 M Urea, pH 10.0, 1 M NaCl). Fractions containing the protein of interest were pooled, diluted twice in buffer (50 mM glycine, 8 M Urea, pH 10.0), dialyzed (molecular weight cut-off) 6–8 kDa, 50 mM Na Phosphate, 150 mM NaCl, pH 7.0), and sterile filtered. Additionally, size-exclusion chromatography (SEC) was performed (Sephacryl S200, buffer A: 50 mM Na Phosphate, 150 mM NaCl, pH 7.0). Relevant fractions were pooled, 10% glycerol added, sterile filtered, aliquoted, and stored frozen (−70 °C).

2.4. Aldolase-SpyTag Production

E. coli expression strain (BL21(DE3)) was transformed with pET24a-based vector-plasmid harboring the expression cassette for the Aldolase-SpyTag protein (Table 1). The plasmid was constructed via gene synthesis and NdeI and SalI restriction endonuclease-based cloning (Eurofins Genomics, Germany). The transformed bacteria were grown in 4 L of auto-induction media (AIM) at 37 °C and 170 RPM in the presence of 30 μg/mL kanamycin. After approximately 4 h, the temperature was reduced to 20 °C and the culture was further incubated overnight (final OD600 = 5.3). Cells were harvested by centrifugation (8000× g, 20 min, 4 °C) and pellets were stored at −20 °C until further processing. For recombinant protein purification, the cell pellet of 4 L culture was resuspended in a 160 mL lysis buffer (50 mM Na-Citrate, pH 5.5, 20 mM NaCl, 2 mM MgCl2, 1 μg/mL Leupeptine, 1 μg/mL Pepstatine, 5 U/mL Benzonase) and submitted to 3 freeze-thaw cycles followed by 3 sonication cycles of 7 min each. The lysate was subsequently clarified by centrifugation (15,000× g, 50 min, 4 °C). The supernatant was then subjected to IEXC (SP Sepharose FF, buffer A: 50 mM Na-Citrate, pH 5.5, 20 mM NaCl, buffer B: 50 mM Na Citrate, pH 5.5, 1.0 M NaCl). Fractions containing the protein of interest were pooled and concentrated (approximately 3X, Amicon 100 kDa). Further purification was performed by SEC (S200 Superdex, buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl). Relevant fractions were pooled and concentrated (approximately 4X, Amicon 100 kDa). Final material was sterile filtered, aliquoted, and stored frozen in liquid nitrogen.

2.5. E2-SpyTag Production

E. coli expression strain (BL21(DE3)) was transformed with pET24a-based vector-plasmid harboring the expression cassette for the E2-SpyTag (Table 1). The plasmid was constructed by gene synthesis and NdeI and SalI restriction endonuclease based cloning (Eurofins Genomics, Germany). The transformed bacteria were grown in 6 L of auto-induction media (AIM) at 37 °C and 180 RPM in the presence of 30 μg/mL kanamycin for approximately 24 h (final OD600 = 4.4). Cells were harvested by centrifugation (8000× g, 15 min, 4 °C) and pellets were stored at -20 °C until further processing. For recombinant protein purification the cell pellet of 6 L culture was resuspended in 240 mL lysis buffer (50 mM Na-Citrate, pH 5.5, 20 mM NaCl, 2 mM MgCl2, 1 μg/mL leupeptin, 1 μg/mL pepstatine, 5 U/mL benzonase), incubated for 4 °C and subjected to 3 freeze-thaw cycles followed by 3 sonication cycles of 7 min each. The lysate was subsequently clarified by centrifugation (15,000× g, 50 min, 4 °C). The supernatant was then subjected to IEXC (Eshmuno S Millipore™, buffer A: 50 mM Na citrate, pH 5.5, 20 mM NaCl, buffer B: 50 mM Na citrate, pH 5.5, 1.0 M NaCl). Fractions containing the protein of interest were pooled and concentrated (approximately 4X, Amicon 100 kDa). Further purification was performed by SEC (S200 Superdex, buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl). Relevant fractions were pooled and concentrated (approximately 4X, Amicon 100 kDa). Final material was sterile filtered, aliquoted and stored frozen in liquid nitrogen.

2.6. Transmission Electron Microscopy

In total, 5 μL of well-mixed specimen was added to a copper 400 mesh carbon/formvar grid (Electron Microscopy Sciences, Ebersberg, Germany) and incubated for 2 min at room temperature (RT) before being washed with MilliQ (Burlington, MA, USA). Specimen were subsequently stained with 2% phosphotungstic acid (PTA) for 30 s at RT, dried using blotting paper and air, and analyzed in a JEOL 1400Plus transmission electron microscope operated at 120 kV. Images were recorded using a JEOL CCD camera Ruby (8 M pixel).

2.7. Experiments with Mice

Six-week-old female BALB/cAnNCrl mice (Charles River Laboratories) were randomly divided into groups of 10 mice, kept in type III filter-top cages under BSL-3 conditions, and allowed to acclimatize for 6 days. Mice were vaccinated intramuscularly (hindleg) at day 0 and 14 with 20 μg Gnhead coupled to LS-MPSPs particles in the presence of Stimune, according to the manufactures instructions in 100 μL (Life technologies, Carlsbad, CA, USA). Two weeks after the second vaccination, mice were challenged via intraperitoneal route with 103 TCID50 of recRVFV-35/74 [24] in 100 μL medium. Challenged mice were closely monitored and humanely euthanized after reaching a humane endpoint.

2.8. Experiments with Lambs

2.8.1. Lamb Trial 1

Conventional 15–17 week-old Texel-German black-headed mutton crossbred lambs, clinically healthy as assessed by a veterinarian, were randomly distributed over 2 groups of 6 animals. After 1 week of acclimatization, lambs in group 1 were vaccinated via intramuscular (IM) route (M. deltoideus) with Gnhead conjugated to LS (LS:Gnhead) or 50 μg of unconjugated LS and Gnhead (LS + Gnhead) in 0.33 mL PBS which was formulated with 0.66 mL TS6 adjuvant. A second vaccination with the same antigen, dose, and route was applied two weeks later. Next, 10 days after the second vaccination, all lambs were challenged via the IM route (M. deltoideus opposite side to immunization) with 105 TCID50 of recRVFV 35/74, which was administrated in 1 mL complete medium. To ensure humane endpoints (HEP) were recognized timely, animals were clinically assessed daily and during critical periods twice per day. Rectal temperatures were determined daily and EDTA and serum blood samples were obtained every second day from half of the animals during the first week after immunization and daily during the first week after challenge, then every second day until the end of the experiment. At the end of the experiment (2 weeks post-challenge), animals were at first sedated with Xylazin (Xylazin 20 mg/mL, CP-Pharma Handelsgesellschaft mbH, Burgdorf, Germany) and finally euthanized with a combination of embutramid, tetracain hydrochloride, and mebezoniumiodid (T61, MSD, Kenilworth, NJ, USA) according to the manufacturer’s instructions. Plasma samples were analyzed for the presence of RVFV RNA with quantitative reverse-transcription PCR (RT-qPCR).

2.8.2. Lamb Trial 2

Conventional 8–10 week-old Texel-Swifter crossbred lambs, clinically healthy as assessed by a veterinarian, were randomly distributed over four groups of 8 animals. After 1 week of acclimatization, lambs of groups 1–3 were vaccinated via IM route (biceps femoris) with 50 μg RVFV-Gnhead conjugated to LS, E2, or Aldolase MPSPs in 0.33 mL TBS, which was formulated with 0.66 mL TS6 adjuvant. A second vaccination with the same dose and route was applied 2 weeks later. Lambs in group 4 were mock-vaccinated and also served as a control group for another vaccine trial [25]. Two weeks after the second vaccination, all lambs were challenged via the IV route (jugular vein) with 105 TCID50 of recRVFV 35/74, which was administrated in a 1 mL complete CIM medium. To ensure HEPs were recognized timely, animals were clinically assessed daily and during critical periods, two or three times per day. Rectal temperatures were determined daily and serum blood samples were obtained weekly. EDTA blood samples were taken weekly but during the first 6 days post-vaccination and 11 days post-challenge, additional daily EDTA blood samples were taken. At the end of the experiment (2 weeks post-challenge), animals were euthanized via exsanguination after being anesthetized with 50 mg/kg sodium pentobarbital (Euthasol®, ASTfarma BV, Oudewater, The Netherlands) applied via the IV route. Plasma samples were analyzed for the presence of RVFV RNA via RT-qPCR.

2.9. Preparation of Organ Suspensions

Ten % organ homogenates were prepared using the ULTRA-TURRAX system in combination with DT-20 tubes (IKA, Staufen, Germany). Briefly, 0.6 g tissue  was homogenized in 6 mL culture medium for 40 s followed by removal of cell debris by slow-speed centrifugation. The suspensions were used for virus detection by RT-qPCR and virus isolation.

2.10. RNA Isolation and RT-qPCR

Viral RNA was isolated with the NucliSENS easyMAG system, according to the manufacturer’s instructions (bioMerieux, France), from either 0.5 mL of plasma or 0.5 mL of 10% organ suspension. Briefly, 5 μL RNA was used in a RVFV RT-qPCR using the LightCycler one-tube RNA Amplification Kit HybProbe (Roche, Almere, The Netherlands) in combination with a LightCycler 480 real-time PCR system (Roche) and the RVS forward primers (AAAGGAACAATGGACTCTGGTCA), the RVAs (CACTTCTTACTACCATGTCCTCCAAT) reverse primer, and a fluorescein amidite (FAM)-labelled probe RVP (AAAGCTTTGATATCTCTCAGTGCCCCAA) [21]. Virus isolation was performed on RT-qPCR positive samples with a threshold above 105 RNA copies/mL as this has been previously shown to be a cut-off point below which no live virus can be isolated.

2.11. Serology

A virus neutralization test was performed as described [26], using a RVFV-4s variant encoding green fluorescent protein (RVFV-4s_GFP) [27]. Briefly, three-fold serial dilutions of inactivated (2 h at 56 °C) sera were mixed with a fixed amount of virus (~200 TCID50) in 96-wells plates. After a 2 h incubation period, 20,000 BHK-21 cells were added to each well and plates were incubated for 2 days at 37 °C and 5% CO2, followed by evaluation of GFP expression. Neutralizing titers were determined using the Spearman-Kärber algorithm.
A RVFV-Gnhead specific indirect ELISA was performed by coating ELISA plates (Greiner 655092) with 0.5 μg/mL RVFV-Gnhead in a coating buffer (pH 9.6, WBVR, 100 μL/well). Following overnight incubation at 4 °C, plates were washed with PBS supplemented with 0.05% Tween 20 (PBST20) using an ELISA washer (6 pulses). Plates were blocked with 200 μL/well of blocking buffer (PBS + 0.05% Tween 20 + 2% fresh-made skimmed milk) and incubated for 1h at RT. Plates were subsequently incubated with 100 μL/well of five-fold dilution series of sera samples in blocking buffer (starting at a dilution of 250×) for 1 h at RT and then washed with the ELISA washer. Horseradish peroxidase (HRP)-conjugated rabbit anti-sheep IgG antibody (ab6747, Abcam) in the blocking buffer was used as a secondary antibody (100 μL/well) for 1 h at RT. After a final washing step with the plate washer, 100 μL/well of BioFX® TMB One Component HPR Microwell Substrate (TMBW-1000-01, SurModics, Eden Prairie, MN, USA) was added as a substrate, followed by incubation for 10 min at RT. The reaction was stopped by adding 50 μL/well of 0.5 M H2SO4. Optical densities were measured at OD450 nm with a Mutiskan RC plate reader (Thermo Labsystems, Philadelphia, PA, USA) using Ascent Software Version 2.6 (Thermo Scientific, Waltham, MA, USA).

2.12. Statistical Analysis

Data were statistically analyzed using the Mann–Whitney test in GraphPad Prism. P values < 0.05 were taken as significant. Data were expressed as means with SD.

3. Results

3.1. Production of SpyCatcher-RVFV-Gnhead and SpyTag-MPSPs

The Gnhead domain is located at the virion surface, shielding the Gc protein [20], and is the main target of neutralizing antibodies [21,28,29,30,31]. The Gnhead domain consists of three subdomains: domain A (also called domain I), β-ribbon (domain II), and domain B (domain III) [20,30,32]. Here, we genetically fused a SpyCatcher domain to the N-terminus of Gnhead (SC-Gnhead) to facilitate conjugation to scaffolds displaying SpyTags, and additionally a C-terminal Twin-Strep-tag to facilitate purification (Figure 1). The fusion protein was expressed with the baculovirus expression system. As a control for conjugation experiments, the Gnhead domain was also expressed without a SpyCatcher domain. Both the Gnhead domain with and without the SpyCatcher were produced at a small scale in around 10–20 mg/L of a culture medium of baculovirus-infected High Five cells. Purity was analyzed via sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and proteins were found to be of the expected sizes (Figure 2a).
Three different scaffold proteins were produced as well; all three self-assembled as 60 monomers into MPSPs of different sizes (Figure 1). The first MPSP is based on Aquifex aeolicus lumazine synthase (LS), a 20-kDa protein that assembles via 12 pentamers into an icosahedral particle of 15 nm. The second nanocarrier is based on I3-01 (I3), a modified KDPG aldolase of 24-kDa, that assembles into a 25 nm dodecahedron. The third nanocarrier is based on Geobacillus stearothermophilus E2 of 26-kDa, which assembles into a pentagonal dodecahedral scaffold of 27 nm. All three MPSPs were produced in E. coli with a C-terminal SpyTag (Figure 1). Small scale production resulted in yields, after purification from E. coli fermentation pellets, of approximately 80, 30, and 20 mg/L, respectively, for LS, E2, and Aldolase. Purity was analyzed via SDS-PAGE and proteins were found to be of the expected sizes (Figure 2a).

3.2. Coupling of the RVFV-Gnhead Subunit Antigen to the MPSPs

In order to bind the SpyCatcher-Gnhead domain subunit to the MPSPs displaying SpyTags, the purified subunit was simply mixed with the different MPSPs, and incubated at RT for 1 h, followed by quality assessment via SDS-PAGE (Figure 2a) and transmission electron microscopy (TEM, Figure 2b). As a control, we took along Gnhead lacking the SpyCatcher domain. Optimal coupling, defined as achieving antigen-saturated particles, were obtained after mixing MPSP monomers with SC-Gnhead at a molar ratio of 1:2.6 for LS, 1:4 for Aldolase, and 1:3.9 for E2 (Figure 2). The TEM analysis of unconjugated particles subsequently showed particle morphologies in line with literature [33,34,35], and morphology was not visibly compromised by the coupling of antigen to the MPSPs.

3.3. Coupling to MPSPs Results in Improved Efficacy in a Lethal RVFV Mouse Model

To assess the in vivo efficacy of MPSP-Gnhead, groups of 10 mice were immunized twice, at a two-week interval, with either 20 μg of SC-Gnhead coupled to LS-ST (LS:Gnhead) or 20 μg of Gnhead combined with 20 μg LS-ST (without coupling: LS + Gnhead) in the presence or absence of Stimune water-in-oil adjuvant (Figure 3a). Vaccine doses were standardized based on the amount of Gnhead. Two weeks after the second vaccination, the mice were challenged via intraperitoneal route with 103 TCID50 of recRVFV-35/74. No injection site reactions or other untoward effects such as weight loss were noted following vaccination (Figure 3b). A RVF virus neutralization test (VNT) [36] revealed that following the second vaccination in the absence of Stimune, significantly higher neutralizing antibody titers were observed in the group vaccinated with LS:Gnhead as compared to the group vaccinated with unconjugated LS and Gnhead (Figure 3c). The observed VNT responses correlated with the survival rates following challenge. All mice succumbed to the infection or had to be euthanized after reaching a HEP within 5 days post challenge in the LS + Gnhead group, whereas 40% of mice survived the challenge in the LS:Gnhead group. In the presence of Stimune, all mice developed high VNT responses and survived the challenge, irrespective of coupling (Figure 3d).

3.4. Coupled Particles Show Improved Efficacy in the RVFV Lamb Model

After demonstrating vaccine efficacy in the mouse model, we evaluated the efficacy of LS:Gnhead versus LS + Gnhead in lambs, the most susceptible natural target species. As the results obtained with mice suggested that adjuvant is required to achieve complete protection, TS6 adjuvant, suitable for use in ruminants, was used. TS6 is an oil-in-water (O/W) emulsion that comprises in the oily-phase sorbitan monooleate, sorbitan trioleate, paraffin oil, and sodium mercurothiolate, monopotassium, and disodium phosphate in the aqueous phase. Lambs were immunized twice at a 14 day interval with either 50 μg of Gnhead conjugated to LS (LS:Gnhead) or 50 μg of unconjugated LS and Gnhead (LS + Gnhead). They were challenged 10 days after the second vaccination. The serological analysis revealed that VNT responses did not differ significantly between the LS:Gnhead and LS + Gnhead group before the challenge. However, complete protection from the RVFV challenge, as evidenced by prevention of pyrexia and viremia, was only achieved in the LS:Gnhead group (Figure 4).

3.5. The Type of MPSP Evaluated Does Not Determine Immunogenicity and Vaccine Efficacy

To assess whether the MPSP used as a scaffold influences immunogenicity and vaccine efficacy, we compared the efficacy of LS:Gnhead, E2:Gnhead, and Aldolase:Gnhead head-to-head in another lamb vaccination-challenge trial, again formulated with TS6 adjuvant (Figure 5). Lambs were immunized twice, with a two-week interval with 50 μg of Gnhead-conjugated MPSPs followed by RVFV challenge two weeks after the second vaccination (Figure 5a). The Gnhead ELISA and VNT results showed highly similar and robust immune responses in all animals, irrespective of the type of MPSP used. Following challenge, all vaccinated animals were protected with complete absence of viremia and clinical signs, whereas all mock-vaccinated animals developed high viremia with associated temperature increases (Figure 5). These results suggest that the type of the MPSP used in this experiment is not a key determinant in the induction of protective immune responses.

4. Discussion

We reported the vaccine efficacy of a MPSP-based RVF vaccine in mice and lambs. Protection was correlated with the induction of neutralizing antibodies in both species, which were boosted by a second vaccination. The antigen coupled MPSP vaccine complex was shown to induce superior immune responses and protection in both mice and lambs compared to the unconjugated variants. No significant differences were observed in immune responses between lambs vaccinated with the same antigen coupled to different MPSPs.
Although we observed a significant beneficial effect of coupling in our mouse experiment for the induction of neutralizing antibody responses in the absence of the adjuvant, immune responses in the presence of adjuvant (Stimune) were highly similar and all animals were protected. To assess the potential beneficial effect of coupling in the RVFV mouse model in more detail, a dose-titration experiment with coupled versus uncoupled antigen in the presence and absence of adjuvant should be conducted. Interestingly, for other targets, including SARS-CoV-2, vaccination with relatively low amounts of nanoparticle-coupled antigen showed promise [37,38,39,40,41,42]. The observed full protection in the presence of adjuvant also highlights that Gnhead is a potent immunogen, possibly even more potent than the complete Gn ectodomain [21,43,44].
Considering that ruminants are the most susceptible target animals of RVFV, we subsequently assessed whether vaccination with free Gnhead antigen or Gnhead coupled to MPSPs was efficacious in the lamb model. In the lamb trials, we made use of the TS6 O/W adjuvant. In the first lamb trial, complete protection from viremia and clinical signs was achieved, which depended on coupling to MPSPs. Despite the clear difference in vaccine efficacy between the two groups, neutralizing antibody levels did not significantly differ at the moment of challenge virus administration. This suggests that cellular immune responses contributed to vaccine efficacy, especially in animals vaccinated with antigen coupled to MPSPs. The induction of cellular immune responses following nanoparticle immunization is expected to be mediated by cytotoxic T-cells via major histocompatibility complex (MHC) cross-presentation [12,45,46].
In the second lamb trial, we assessed whether the type of the MPSP is an important determinant of vaccine immunogenicity and efficacy. As we did not observe significant differences in antibody responses and vaccine efficacy, we proposed prioritization among these three MPSPs based on large scale manufacturing yields, easiness of downstream purification, stability, and costs of goods. The results so far suggest that MPSPs E2 and I3-03 hold more promise. However, to conclude that the type of MPSP is a minor determinant with respect to immunogenicity, additional head-to-head comparisons are needed. Of note, the three MPSPs used in this study each result from assembling of monomeric scaffold proteins into 15–30 nm particles with 60 sites for antigen conjugation.
Besides the evaluation of additional MPSPs, several other optimizations could further improve the methodology. We here fused the SpyCatcher domain to the N-terminus of Gnhead, whereas fusion to the C-terminus of Gnhead may have resulted in a more optimal presentation of the Gn subunit. Domain A (I) and domain B (III) were considered the dominant targets of neutralizing antibodies in a virion context [30,32,47]. Whether the individual subdomains A (I) and B (III) are potent immunogens capable of inducing protective immunity awaits further study. In general, production yields of smaller antigens is superior to large antigens and smaller antigens are expected to face less spatial constrains with regard to conjugation to the MPSPs. However, from a veterinary vaccine perspective, we note that, in the current setup, a double vaccination regimen has to be used, which does not yet compete with live-attenuated vaccines or vector-based vaccines providing single-shot immunity [25] and data on long-term memory responses is still lacking. Nevertheless, further construct optimization combined with the use of novel production systems like Myceliophthora thermophila, also referred to as C1 [48], is likely to result in an efficacious and cost-effective MPSP-based RVF vaccine.

5. Conclusions

The results of this study show that a double vaccination with the Gnhead domain, when bound to lumazine synthase-based MPSPs, prevents mortality in a lethal mouse model and protects lambs, the most susceptible RVFV target animals, from viremia and clinical signs. Furthermore, similar vaccination with the same subunit coupled to two other MPSPs provides complete protection in lambs as well.

Author Contributions

Conceptualization, P.J.W.S., M.K., A.B., J.-C.A., M.H.G., and J.K. (Jeroen Kortekaas); funding acquisition, P.J.W.S., J.-C.A., M.H.G., and J.K. (Jeroen Kortekaas); investigation, P.J.W.S., M.T., B.G., M.K., L.v.K., J.K. (Jet Kant), S.v.d.W., Y.L., M.R., F.v.A., R.K. and A.B.; methodology, P.J.W.S., M.T., B.G., M.K., L.v.K., S.v.d.W., A.B., C.C., and M.H.G.; resources, M.E.; visualization, M.T.; writing—original draft, P.J.W.S., M.K., A.B., J.-C.A., and J.K. (Jeroen Kortekaas); writing—review and editing, P.J.W.S., M.T., B.G., M.K., L.v.K., M.E., M.R., A.B., C.C., J.-C.A., M.H.G., and J.K. (Jeroen Kortekaas) All authors have read and agreed to the published version of the manuscript.

Funding

This study was performed as part of the Zoonotic Anticipation and Preparedness Initiative (ZAPI project; IMI Grant Agreement no. 115760), with the assistance and financial support of IMI and the European Commission, and in-kind contributions from EFPIA partners. The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Institutional Review Board Statement

All animal experiments were conducted in accordance with European regulations (EU directive 2010/63/EU) and the Dutch or German Law on Animal Experiments. Permissions were granted by the Dutch Central Authority for Scientific Procedures on Animals (Permit Numbers: AVD401002016725) and the German Centre for the Protection of Laboratory Animals (LALLF Nr. 7221.3-1.1-048/17). Specific procedures were approved by the Animal Ethics Committees of Wageningen Research (WR) and the federal state Mecklenburg-Western Pomerania for the experiments conducted in the Netherlands and Germany, respectively.

Acknowledgments

We would like to thank the animal caretakers for providing assistance in the animal trials. Furthermore, we would like to thank Jelmer Vroom, Marcel Giesbers, and Jan van Lent (Wageningen Electron Microscopy Centre) for performing the EM analysis. Pablo Guardado-Calvo and Félix Rey (Institut Pasteur, France) are acknowledged for their assistance in designing the antigens.

Conflicts of Interest

The authors declare no conflict of interest. Jean-Christophe Audonnet, Alexander Brix and Catherine Charreyre are employees of Boehringer Ingelheim Animal Health.

References

  1. Pati, R.; Shevtsov, M.; Sonawane, A. Nanoparticle Vaccines Against Infectious Diseases. Front. Immunol. 2018, 9, 2224. [Google Scholar] [CrossRef] [PubMed][Green Version]
  2. Butkovich, N.; Li, E.; Ramirez, A.; Burkhardt, A.M.; Wang, S.W. Advancements in protein nanoparticle vaccine platforms to combat infectious disease. Wiley Interdiscip. Rev. Nanomed. Nanobiotechnol. 2020, e1681. [Google Scholar] [CrossRef]
  3. Kelly, H.G.; Tan, H.X.; Juno, J.A.; Esterbauer, R.; Ju, Y.; Jiang, W.; Wimmer, V.C.; Duckworth, B.C.; Groom, J.R.; Caruso, F.; et al. Self-assembling influenza nanoparticle vaccines drive extended germinal center activity and memory B cell maturation. JCI Insight 2020, 5. [Google Scholar] [CrossRef] [PubMed]
  4. Kanekiyo, M.; Wei, C.J.; Yassine, H.M.; McTamney, P.M.; Boyington, J.C.; Whittle, J.R.; Rao, S.S.; Kong, W.P.; Wang, L.; Nabel, G.J. Self-assembling influenza nanoparticle vaccines elicit broadly neutralizing H1N1 antibodies. Nature 2013, 499, 102–106. [Google Scholar] [CrossRef]
  5. Marcandalli, J.; Fiala, B.; Ols, S.; Perotti, M.; de van der Schueren, W.; Snijder, J.; Hodge, E.; Benhaim, M.; Ravichandran, R.; Carter, L.; et al. Induction of Potent Neutralizing Antibody Responses by a Designed Protein Nanoparticle Vaccine for Respiratory Syncytial Virus. Cell 2019, 176, 1420–1431.e1417. [Google Scholar] [CrossRef] [PubMed][Green Version]
  6. Rts, S.C.T.P. Efficacy and safety of RTS,S/AS01 malaria vaccine with or without a booster dose in infants and children in Africa: Final results of a phase 3, individually randomised, controlled trial. Lancet 2015, 386, 31–45. [Google Scholar] [CrossRef][Green Version]
  7. Ladenstein, R.; Morgunova, E. Second career of a biosynthetic enzyme: Lumazine synthase as a virus-like nanoparticle in vaccine development. Biotechnol. Rep. 2020, 27, e00494. [Google Scholar] [CrossRef] [PubMed]
  8. Caivano, A.; Doria-Rose, N.A.; Buelow, B.; Sartorius, R.; Trovato, M.; D’Apice, L.; Domingo, G.J.; Sutton, W.F.; Haigwood, N.L.; De Berardinis, P. HIV-1 Gag p17 presented as virus-like particles on the E2 scaffold from Geobacillus stearothermophilus induces sustained humoral and cellular immune responses in the absence of IFNgamma production by CD4+ T cells. Virology 2010, 407, 296–305. [Google Scholar] [CrossRef][Green Version]
  9. Hsia, Y.; Bale, J.B.; Gonen, S.; Shi, D.; Sheffler, W.; Fong, K.K.; Nattermann, U.; Xu, C.; Huang, P.S.; Ravichandran, R.; et al. Design of a hyperstable 60-subunit protein dodecahedron. Nature 2016, 535, 136–139. [Google Scholar] [CrossRef]
  10. Veggiani, G.; Zakeri, B.; Howarth, M. Superglue from bacteria: Unbreakable bridges for protein nanotechnology. Trends Biotechnol. 2014, 32, 506–512. [Google Scholar] [CrossRef][Green Version]
  11. Zakeri, B.; Fierer, J.O.; Celik, E.; Chittock, E.C.; Schwarz-Linek, U.; Moy, V.T.; Howarth, M. Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesin. Proc. Natl. Acad. Sci. USA 2012, 109, E690–E697. [Google Scholar] [CrossRef] [PubMed][Green Version]
  12. Brune, K.D.; Howarth, M. New Routes and Opportunities for Modular Construction of Particulate Vaccines: Stick, Click, and Glue. Front. Immunol. 2018, 9, 1432. [Google Scholar] [CrossRef] [PubMed]
  13. Wuerth, J.D.; Weber, F. Phleboviruses and the Type I Interferon Response. Viruses 2016, 8, 174. [Google Scholar] [CrossRef][Green Version]
  14. Kreher, F.; Tamietti, C.; Gommet, C.; Guillemot, L.; Ermonval, M.; Failloux, A.B.; Panthier, J.J.; Bouloy, M.; Flamand, M. The Rift Valley fever accessory proteins NSm and P78/NSm-GN are distinct determinants of virus propagation in vertebrate and invertebrate hosts. Emerg. Microbes Infect. 2014, 3, e71. [Google Scholar] [CrossRef] [PubMed]
  15. Kading, R.C.; Crabtree, M.B.; Bird, B.H.; Nichol, S.T.; Erickson, B.R.; Horiuchi, K.; Biggerstaff, B.J.; Miller, B.R. Deletion of the NSm virulence gene of Rift Valley fever virus inhibits virus replication in and dissemination from the midgut of Aedes aegypti mosquitoes. PLoS Negl. Trop. Dis. 2014, 8, e2670. [Google Scholar] [CrossRef] [PubMed]
  16. Won, S.; Ikegami, T.; Peters, C.J.; Makino, S. NSm protein of Rift Valley fever virus suppresses virus-induced apoptosis. J. Virol. 2007, 81, 13335–13345. [Google Scholar] [CrossRef] [PubMed][Green Version]
  17. Terasaki, K.; Won, S.; Makino, S. The C-terminal region of Rift Valley fever virus NSm protein targets the protein to the mitochondrial outer membrane and exerts antiapoptotic function. J. Virol. 2013, 87, 676–682. [Google Scholar] [CrossRef][Green Version]
  18. Warimwe, G.M.; Gesharisha, J.; Carr, B.V.; Otieno, S.; Otingah, K.; Wright, D.; Charleston, B.; Okoth, E.; Elena, L.G.; Lorenzo, G.; et al. Chimpanzee Adenovirus Vaccine Provides Multispecies Protection against Rift Valley Fever. Sci. Rep. 2016, 6, 20617. [Google Scholar] [CrossRef] [PubMed]
  19. Kortekaas, J.; de Boer, S.M.; Kant, J.; Vloet, R.P.; Antonis, A.F.; Moormann, R.J. Rift Valley fever virus immunity provided by a paramyxovirus vaccine vector. Vaccine 2010, 28, 4394–4401. [Google Scholar] [CrossRef] [PubMed]
  20. Halldorsson, S.; Li, S.; Li, M.; Harlos, K.; Bowden, T.A.; Huiskonen, J.T. Shielding and activation of a viral membrane fusion protein. Nat. Commun. 2018, 9, 349. [Google Scholar] [CrossRef][Green Version]
  21. Kortekaas, J.; Antonis, A.F.; Kant, J.; Vloet, R.P.; Vogel, A.; Oreshkova, N.; de Boer, S.M.; Bosch, B.J.; Moormann, R.J. Efficacy of three candidate Rift Valley fever vaccines in sheep. Vaccine 2012, 30, 3423–3429. [Google Scholar] [CrossRef]
  22. de Boer, S.M.; Kortekaas, J.; Antonis, A.F.; Kant, J.; van Oploo, J.L.; Rottier, P.J.; Moormann, R.J.; Bosch, B.J. Rift Valley fever virus subunit vaccines confer complete protection against a lethal virus challenge. Vaccine 2010, 28, 2330–2339. [Google Scholar] [CrossRef] [PubMed][Green Version]
  23. Antonis, A.F.; Kortekaas, J.; Kant, J.; Vloet, R.P.; Vogel-Brink, A.; Stockhofe, N.; Moormann, R.J. Vertical transmission of Rift Valley fever virus without detectable maternal viremia. Vector Borne Zoonotic Dis. 2013, 13, 601–606. [Google Scholar] [CrossRef] [PubMed][Green Version]
  24. Kortekaas, J.; Oreshkova, N.; Cobos-Jimenez, V.; Vloet, R.P.; Potgieter, C.A.; Moormann, R.J. Creation of a nonspreading Rift Valley fever virus. J. Virol. 2011, 85, 12622–12630. [Google Scholar] [CrossRef] [PubMed][Green Version]
  25. Wichgers Schreur, P.J.; Oreshkova, N.; van Keulen, L.; Kant, J.; van de Water, S.; Soos, P.; Dehon, Y.; Kollar, A.; Penzes, Z.; Kortekaas, J. Safety and efficacy of four-segmented Rift Valley fever virus in young sheep, goats and cattle. NPJ Vaccines 2020, 5, 65. [Google Scholar] [CrossRef] [PubMed]
  26. Wichgers Schreur, P.J.; Kant, J.; van Keulen, L.; Moormann, R.J.; Kortekaas, J. Four-segmented Rift Valley fever virus induces sterile immunity in sheep after a single vaccination. Vaccine 2015, 33, 1459–1464. [Google Scholar] [CrossRef]
  27. Wichgers Schreur, P.J.; Oreshkova, N.; Moormann, R.J.; Kortekaas, J. Creation of Rift Valley fever viruses with four-segmented genomes reveals flexibility in bunyavirus genome packaging. J. Virol. 2014, 88, 10883–10893. [Google Scholar] [CrossRef][Green Version]
  28. Kortekaas, J.; Dekker, A.; de Boer, S.M.; Weerdmeester, K.; Vloet, R.P.; de Wit, A.A.; Peeters, B.P.; Moormann, R.J. Intramuscular inoculation of calves with an experimental Newcastle disease virus-based vector vaccine elicits neutralizing antibodies against Rift Valley fever virus. Vaccine 2010, 28, 2271–2276. [Google Scholar] [CrossRef]
  29. Wichgers Schreur, P.J.; van de Water, S.; Harmsen, M.; Bermudez-Mendez, E.; Drabek, D.; Grosveld, F.; Wernike, K.; Beer, M.; Aebischer, A.; Daramola, O.; et al. Multimeric single-domain antibody complexes protect against bunyavirus infections. Elife 2020, 9, e52716. [Google Scholar] [CrossRef]
  30. Wu, Y.; Zhu, Y.; Gao, F.; Jiao, Y.; Oladejo, B.O.; Chai, Y.; Bi, Y.; Lu, S.; Dong, M.; Zhang, C.; et al. Structures of phlebovirus glycoprotein Gn and identification of a neutralizing antibody epitope. Proc. Natl. Acad. Sci. USA 2017, 114, E7564–E7573. [Google Scholar] [CrossRef][Green Version]
  31. Allen, E.R.; Krumm, S.A.; Raghwani, J.; Halldorsson, S.; Elliott, A.; Graham, V.A.; Koudriakova, E.; Harlos, K.; Wright, D.; Warimwe, G.M.; et al. A Protective Monoclonal Antibody Targets a Site of Vulnerability on the Surface of Rift Valley Fever Virus. Cell Rep. 2018, 25, 3750–3758.e3754. [Google Scholar] [CrossRef] [PubMed][Green Version]
  32. Wang, Q.; Ma, T.; Wu, Y.; Chen, Z.; Zeng, H.; Tong, Z.; Gao, F.; Qi, J.; Zhao, Z.; Chai, Y.; et al. Neutralization mechanism of human monoclonal antibodies against Rift Valley fever virus. Nat. Microbiol. 2019, 4, 1231–1241. [Google Scholar] [CrossRef]
  33. Sasaki, E.; Bohringer, D.; van de Waterbeemd, M.; Leibundgut, M.; Zschoche, R.; Heck, A.J.; Ban, N.; Hilvert, D. Structure and assembly of scalable porous protein cages. Nat. Commun. 2017, 8, 14663. [Google Scholar] [CrossRef] [PubMed][Green Version]
  34. Herzik, M.A., Jr.; Wu, M.; Lander, G.C. Achieving better-than-3-A resolution by single-particle cryo-EM at 200 keV. Nat. Methods 2017, 14, 1075–1078. [Google Scholar] [CrossRef][Green Version]
  35. Dalmau, M.; Lim, S.; Chen, H.C.; Ruiz, C.; Wang, S.W. Thermostability and molecular encapsulation within an engineered caged protein scaffold. Biotechnol. Bioeng. 2008, 101, 654–664. [Google Scholar] [CrossRef] [PubMed]
  36. Wichgers Schreur, P.J.; Paweska, J.T.; Kant, J.; Kortekaas, J. A novel highly sensitive, rapid and safe Rift Valley fever virus neutralization test. J. Virol. Methods 2017, 248, 26–30. [Google Scholar] [CrossRef]
  37. Janitzek, C.M.; Matondo, S.; Thrane, S.; Nielsen, M.A.; Kavishe, R.; Mwakalinga, S.B.; Theander, T.G.; Salanti, A.; Sander, A.F. Bacterial superglue generates a full-length circumsporozoite protein virus-like particle vaccine capable of inducing high and durable antibody responses. Malar. J. 2016, 15, 545. [Google Scholar] [CrossRef][Green Version]
  38. Thrane, S.; Janitzek, C.M.; Matondo, S.; Resende, M.; Gustavsson, T.; de Jongh, W.A.; Clemmensen, S.; Roeffen, W.; van de Vegte-Bolmer, M.; van Gemert, G.J.; et al. Bacterial superglue enables easy development of efficient virus-like particle based vaccines. J. Nanobiotechnol. 2016, 14, 30. [Google Scholar] [CrossRef][Green Version]
  39. Brune, K.D.; Leneghan, D.B.; Brian, I.J.; Ishizuka, A.S.; Bachmann, M.F.; Draper, S.J.; Biswas, S.; Howarth, M. Plug-and-Display: Decoration of Virus-Like Particles via isopeptide bonds for modular immunization. Sci. Rep. 2016, 6, 19234. [Google Scholar] [CrossRef][Green Version]
  40. Escolano, A.; Gristick, H.B.; Abernathy, M.E.; Merkenschlager, J.; Gautam, R.; Oliveira, T.Y.; Pai, J.; West, A.P., Jr.; Barnes, C.O.; Cohen, A.A.; et al. Immunization expands B cells specific to HIV-1 V3 glycan in mice and macaques. Nature 2019, 570, 468–473. [Google Scholar] [CrossRef]
  41. Wang, W.; Liu, Z.; Zhou, X.; Guo, Z.; Zhang, J.; Zhu, P.; Yao, S.; Zhu, M. Ferritin nanoparticle-based SpyTag/SpyCatcher-enabled click vaccine for tumor immunotherapy. Nanomed. Nanotechnol. Biol. Med. 2019, 16, 69–78. [Google Scholar] [CrossRef] [PubMed]
  42. Zhang, B.; Chao, C.W.; Tsybovsky, Y.; Abiona, O.M.; Hutchinson, G.B.; Moliva, J.I.; Olia, A.S.; Pegu, A.; Phung, E.; Stewart-Jones, G.B.E.; et al. A platform incorporating trimeric antigens into self-assembling nanoparticles reveals SARS-CoV-2-spike nanoparticles to elicit substantially higher neutralizing responses than spike alone. Sci. Rep. 2020, 10, 18149. [Google Scholar] [CrossRef] [PubMed]
  43. Chrun, T.; Lacote, S.; Urien, C.; Richard, C.A.; Tenbusch, M.; Aubrey, N.; Pulido, C.; Lakhdar, L.; Marianneau, P.; Schwartz-Cornil, I. A DNA Vaccine Encoding the Gn Ectodomain of Rift Valley Fever Virus Protects Mice via a Humoral Response Decreased by DEC205 Targeting. Front. Immunol. 2019, 10, 860. [Google Scholar] [CrossRef] [PubMed]
  44. Bhardwaj, N.; Heise, M.T.; Ross, T.M. Vaccination with DNA plasmids expressing Gn coupled to C3d or alphavirus replicons expressing gn protects mice against Rift Valley fever virus. PLoS Negl. Trop. Dis. 2010, 4, e725. [Google Scholar] [CrossRef][Green Version]
  45. Gomes, A.C.; Mohsen, M.; Bachmann, M.F. Harnessing Nanoparticles for Immunomodulation and Vaccines. Vaccines 2017, 5, 6. [Google Scholar] [CrossRef]
  46. Cruz, F.M.; Colbert, J.D.; Merino, E.; Kriegsman, B.A.; Rock, K.L. The Biology and Underlying Mechanisms of Cross-Presentation of Exogenous Antigens on MHC-I Molecules. Annu. Rev. Immunol. 2017, 35, 149–176. [Google Scholar] [CrossRef][Green Version]
  47. Hao, M.; Zhang, G.; Zhang, S.; Chen, Z.; Chi, X.; Dong, Y.; Fan, P.; Liu, Y.; Chen, Y.; Song, X.; et al. Characterization of Two Neutralizing Antibodies against Rift Valley Fever Virus Gn Protein. Viruses 2020, 12, 259. [Google Scholar] [CrossRef][Green Version]
  48. Singh, B. Myceliophthora thermophila syn. Sporotrichum thermophile: A thermophilic mould of biotechnological potential. Crit. Rev. Biotechnol. 2016, 36, 59–69. [Google Scholar] [CrossRef]
Figure 1. Graphical presentation of the multimeric protein scaffold particles (MPSPs)-based Rift Valley fever virus (RVFV) candidate vaccines. The RVFV-Gnhead domain comprising the A (I), β (II), and B (III) subdomain was N-terminally linked to a SpyCatcher domain and a C-terminal Twin-Strep-tag. Following expression using the baculovirus expression system, the subdomains were purified by Strep-Tactin column chromatography. Lumazine synthase (LS)-, Aldolase-, and E2-based MPSPs with C-terminal SpyTags were expressed in E. coli. Upon mixing, the SpyCatcher, fused to the N-terminus of Gnhead forms a spontaneous isopeptide bond with the SpyTag present on the MPSPs, yielding antigen-decorated nanoparticles for immunization.
Figure 1. Graphical presentation of the multimeric protein scaffold particles (MPSPs)-based Rift Valley fever virus (RVFV) candidate vaccines. The RVFV-Gnhead domain comprising the A (I), β (II), and B (III) subdomain was N-terminally linked to a SpyCatcher domain and a C-terminal Twin-Strep-tag. Following expression using the baculovirus expression system, the subdomains were purified by Strep-Tactin column chromatography. Lumazine synthase (LS)-, Aldolase-, and E2-based MPSPs with C-terminal SpyTags were expressed in E. coli. Upon mixing, the SpyCatcher, fused to the N-terminus of Gnhead forms a spontaneous isopeptide bond with the SpyTag present on the MPSPs, yielding antigen-decorated nanoparticles for immunization.
Vaccines 09 00301 g001
Figure 2. Confirmation of RVFV-Gnhead coupling to MPSPs. (a) SDS-PAGE of purified Gnhead and SpyCatcher-linked Gnhead; SC-Gnhead. Purified MPSPs with C-terminally-linked SpyTags (ST) and LS-ST, E2-ST, and Ald-ST MPSPs mixed with either Gnhead or SC-Gnhead for 1 h at room temperature (RT) at a ratio just above particle saturation. Coupled MPSP-derived monomers (*) and remaining free antigen (**) is indicated. The lowest band in the Ald-ST lanes most likely represents a proteolytic degradation product. The plus sign means that Gnhead or SC-Gnhead was present in the sample (b) TEM images (negative stain) of the SpyTag-linked MPSPs with or without conjugated SC-Gnhead antigen. Particles were uniformly dispersed and no evidence of aggregation was observed. The colon (:) represents coupling of antigen to MPSPs. Scale bar: 100 nm.
Figure 2. Confirmation of RVFV-Gnhead coupling to MPSPs. (a) SDS-PAGE of purified Gnhead and SpyCatcher-linked Gnhead; SC-Gnhead. Purified MPSPs with C-terminally-linked SpyTags (ST) and LS-ST, E2-ST, and Ald-ST MPSPs mixed with either Gnhead or SC-Gnhead for 1 h at room temperature (RT) at a ratio just above particle saturation. Coupled MPSP-derived monomers (*) and remaining free antigen (**) is indicated. The lowest band in the Ald-ST lanes most likely represents a proteolytic degradation product. The plus sign means that Gnhead or SC-Gnhead was present in the sample (b) TEM images (negative stain) of the SpyTag-linked MPSPs with or without conjugated SC-Gnhead antigen. Particles were uniformly dispersed and no evidence of aggregation was observed. The colon (:) represents coupling of antigen to MPSPs. Scale bar: 100 nm.
Vaccines 09 00301 g002
Figure 3. RVFV vaccination-challenge experiment with Gnhead-conjugated LS particles in mice. (a) Schematic presentation of the experimental setup. (b) Average body weights with SD following vaccination (day 0 and 14) and challenge (day 28; black arrow). (c) Neutralizing antibodies in serum following the first (day 14) and second vaccination (day 28). The x-axis is set to the limit of detection of the VNT. (d) Survival of vaccinated animals following RVFV challenge.
Figure 3. RVFV vaccination-challenge experiment with Gnhead-conjugated LS particles in mice. (a) Schematic presentation of the experimental setup. (b) Average body weights with SD following vaccination (day 0 and 14) and challenge (day 28; black arrow). (c) Neutralizing antibodies in serum following the first (day 14) and second vaccination (day 28). The x-axis is set to the limit of detection of the VNT. (d) Survival of vaccinated animals following RVFV challenge.
Vaccines 09 00301 g003
Figure 4. RVFV vaccination-challenge experiment with Gnhead-conjugated LS particles in lambs. (a) Schematic presentation of the vaccination regimen and vaccines. (b) Average rectal temperatures of vaccinated and mock-vaccinated lambs post RVFV challenge. (c) Gnhead-specific antibody responses as determined by ELISA. (d) Neutralizing antibody responses in weekly-obtained serum samples. The x-axis is set to the limit of detection of the VNT and wells were considered positive when >50% inhibition of viral growth was observed. (e) Monitoring of viral RNA in vaccinated and mock-vaccinated lambs using RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (1.3 log10 RNA copies/mL) (f) Viral RNA in liver and spleen samples of vaccinated and mock-vaccinated lambs using RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (2.3 log10 RNA copies/mL). No animals succumbed or reached a HEP in this experiment. Error bars in panels b, c, d and e represent SDs.
Figure 4. RVFV vaccination-challenge experiment with Gnhead-conjugated LS particles in lambs. (a) Schematic presentation of the vaccination regimen and vaccines. (b) Average rectal temperatures of vaccinated and mock-vaccinated lambs post RVFV challenge. (c) Gnhead-specific antibody responses as determined by ELISA. (d) Neutralizing antibody responses in weekly-obtained serum samples. The x-axis is set to the limit of detection of the VNT and wells were considered positive when >50% inhibition of viral growth was observed. (e) Monitoring of viral RNA in vaccinated and mock-vaccinated lambs using RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (1.3 log10 RNA copies/mL) (f) Viral RNA in liver and spleen samples of vaccinated and mock-vaccinated lambs using RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (2.3 log10 RNA copies/mL). No animals succumbed or reached a HEP in this experiment. Error bars in panels b, c, d and e represent SDs.
Vaccines 09 00301 g004
Figure 5. RVFV vaccination-challenge experiment with Gnhead-coupled MPSP particles in lambs. (a) Schematic presentation of the vaccination regimen and vaccines. (b) Average rectal temperatures of vaccinated and mock-vaccinated lambs post RVFV challenge. (c) Gnhead-specific antibody responses as determined by ELISA. (d) Neutralizing antibody responses in weekly-obtained serum samples. The x-axis is set to the limit of detection of the VNT and wells were considered positive when >50% inhibition of viral growth was observed. (e) Monitoring of viral RNA in vaccinated and mock-vaccinated lambs by RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (1.3 log10 RNA copies/mL) (f) Viral RNA in liver and spleen samples of vaccinated and mock-vaccinated lambs by RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (2.3 log10 RNA copies/mL). Open symbols indicate animals that succumbed or were euthanized due to the challenge infection prior to study end. Error bars in panels b, c, d, and e indicate SDs.
Figure 5. RVFV vaccination-challenge experiment with Gnhead-coupled MPSP particles in lambs. (a) Schematic presentation of the vaccination regimen and vaccines. (b) Average rectal temperatures of vaccinated and mock-vaccinated lambs post RVFV challenge. (c) Gnhead-specific antibody responses as determined by ELISA. (d) Neutralizing antibody responses in weekly-obtained serum samples. The x-axis is set to the limit of detection of the VNT and wells were considered positive when >50% inhibition of viral growth was observed. (e) Monitoring of viral RNA in vaccinated and mock-vaccinated lambs by RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (1.3 log10 RNA copies/mL) (f) Viral RNA in liver and spleen samples of vaccinated and mock-vaccinated lambs by RT-qPCR. Samples that tested negative are depicted at the detection limit of the PCR (2.3 log10 RNA copies/mL). Open symbols indicate animals that succumbed or were euthanized due to the challenge infection prior to study end. Error bars in panels b, c, d, and e indicate SDs.
Vaccines 09 00301 g005
Table 1. Amino acid sequences of antigens, MPSPs, superglue domains and tags.
Table 1. Amino acid sequences of antigens, MPSPs, superglue domains and tags.
Protein DomainAmino Acid Sequence
GP64 signal sequenceMPMLSAIVLYVLLAAAAHSAFA
SpyCatcherDIPTTENLYFQGAMVDTLSGLSSE
QGQSGDMTIEEDSATHIKFSKRD
EDGKELAGATMELRDSSGKTIS
TWISDGQVKDFYLYPGKYTFVETAAPDGYEV
ATAITFTVNEQGQVTVNGKATKGDA
HIDGPQGIWGQLEWKK
10 GlySer linkerGGGGSGGGGS
RVFV-GnheadEDPHLRNRPGKGHNYIDGMTQEDATCK
PVTYAGACSSFDVLLEKGKFPLFQSYAHHRTL
LEAVHDTIIAKADPP
SCDLQSAHGNPCMKEKLVMKTHCPNDYQSA
HYLNNDGKMASVKCPPKYELT
EDCNFCRQMTGASLKKGSYPLQDLFCQSSED
DGSKLKTKMKGVCEVGVQAL
KKCDGQLSTAHEVVPFAVFKNSKKVYLDKLD
LKTEENLL
PDSFVCFEHKGQYKGTMDSGQTKRELKSFDIS
QCPKIGGHGSKKCTG
DAAFCSAYECTAQYANAYCSHANGSGVVQI
QVSGVWKKPLCVGYERVVVKRE
Entero Kinase siteDDDDK
Twin Strep-tagGSAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
LS-SpyTag 1MQIYEGKLTAEGLRFGIVASRFN
HALVDRLVEGAIDAIVRHGGREEDITLVRVPG
SWEIPVAAGELARKEDIDAVIAIGVLIRGATPH
FDYIASEVSKGLANLSLELRKPITFGVIT
ADTLEQAIERAGTKHGNKGWEAALSAIE
MANLFKSLRGGGGSGGGGSGGGGS
AHIVMVDAYKPTK
Aldolase-SpyTag 1MAHIVMVDAYKPTKLINGGSGGSGGSGGSM
KMEELFKKHKIVAVLRANS
VEEAKKKALAVFLGGVHLIEITFTVPDADTVIK
ELSFLKEMGAIIGAGTV
TSVEQCRKAVESGAEFIVSPHLDEE
ISQFCKEKGVFYMPGVMTPTELVKAMKLGHTI
LKLFPGEVVGPQFV
KAMKGPFPNVKFVPTGGVNLDNVCEW
FKAGVLAVGVG
SALVKGTPVEVAEKAKAFVEKIRGCTE
E2-Spytag 1MAHIVMVDAYKPTKAAAEEKAAPAAAK
PATTEGEFPETREKMSGIRRAIAKAMVH
SKHTAPHVTLMDEADVTKLVAHRKKFKAIAA
EKGIKLTFLPYVVKALVSALREYPVLNTSID
DETEEIIQKHYYNIGIAADT
DRGLLVPVIKHADRKPIFALAQEINELAEKAR
DGKLTPGEMKGASCTIT
NIGSAGGQWFTPVINHPEVAILGIGRIAEK
PIVRDGEIVAAP
MLALSLSFDHRMIDGATAQKALNHIKRLLSD
PELLLMEA
1 The SpyTag sequence is presented in bold.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Wichgers Schreur, P.J.; Tacken, M.; Gutjahr, B.; Keller, M.; van Keulen, L.; Kant, J.; van de Water, S.; Lin, Y.; Eiden, M.; Rissmann, M.; von Arnim, F.; König, R.; Brix, A.; Charreyre, C.; Audonnet, J.-C.; Groschup, M.H.; Kortekaas, J. Vaccine Efficacy of Self-Assembled Multimeric Protein Scaffold Particles Displaying the Glycoprotein Gn Head Domain of Rift Valley Fever Virus. Vaccines 2021, 9, 301. https://doi.org/10.3390/vaccines9030301

AMA Style

Wichgers Schreur PJ, Tacken M, Gutjahr B, Keller M, van Keulen L, Kant J, van de Water S, Lin Y, Eiden M, Rissmann M, von Arnim F, König R, Brix A, Charreyre C, Audonnet J-C, Groschup MH, Kortekaas J. Vaccine Efficacy of Self-Assembled Multimeric Protein Scaffold Particles Displaying the Glycoprotein Gn Head Domain of Rift Valley Fever Virus. Vaccines. 2021; 9(3):301. https://doi.org/10.3390/vaccines9030301

Chicago/Turabian Style

Wichgers Schreur, Paul J., Mirriam Tacken, Benjamin Gutjahr, Markus Keller, Lucien van Keulen, Jet Kant, Sandra van de Water, Yanyin Lin, Martin Eiden, Melanie Rissmann, Felicitas von Arnim, Rebecca König, Alexander Brix, Catherine Charreyre, Jean-Christophe Audonnet, Martin H. Groschup, and Jeroen Kortekaas. 2021. "Vaccine Efficacy of Self-Assembled Multimeric Protein Scaffold Particles Displaying the Glycoprotein Gn Head Domain of Rift Valley Fever Virus" Vaccines 9, no. 3: 301. https://doi.org/10.3390/vaccines9030301

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop