The D Gene in CDR H3 Determines a Public Class of Human Antibodies to SARS-CoV-2
Abstract
1. SARS-CoV-2 Escapes from Major Classes of Neutralizing Antibodies
2. Recurring YYDxxG Motif in CDR H3 Targets a Conserved Site on SARS-CoV-2 Spike
3. The Angle of Approach of YYDxxG Antibodies Facilitates IgG Bivalent Binding and Avidity Effects
4. YYDxxG Antibodies Are Frequently Found in COVID-19 Convalescents and Vaccinees
5. Insights and Potential Applications of CDR H3-Dominant Public Antibodies
6. CDRH3-Dominant Antibodies Are Found against Various Viruses
7. Conclusions
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Fiolet, T.; Kherabi, Y.; MacDonald, C.J.; Ghosn, J.; Peiffer-Smadja, N. Comparing COVID-19 vaccines for their characteristics, efficacy and effectiveness against SARS-CoV-2 and variants of concern: A narrative review. Clin. Microbiol. Infect. 2022, 28, 202–221. [Google Scholar] [CrossRef]
- Barnes, C.O.; West, A.P., Jr.; Huey-Tubman, K.E.; Hoffmann, M.A.G.; Sharaf, N.G.; Hoffman, P.R.; Koranda, N.; Gristick, H.B.; Gaebler, C.; Muecksch, F.; et al. Structures of human antibodies bound to SARS-CoV-2 spike reveal common epitopes and recurrent features of antibodies. Cell 2020, 182, 828–842.e16. [Google Scholar] [CrossRef] [PubMed]
- Yuan, M.; Liu, H.; Wu, N.C.; Lee, C.D.; Zhu, X.; Zhao, F.; Huang, D.; Yu, W.; Hua, Y.; Tien, H.; et al. Structural basis of a shared antibody response to SARS-CoV-2. Science 2020, 369, 1119–1123. [Google Scholar] [CrossRef] [PubMed]
- Robbiani, D.F.; Gaebler, C.; Muecksch, F.; Lorenzi, J.C.C.; Wang, Z.; Cho, A.; Agudelo, M.; Barnes, C.O.; Gazumyan, A.; Finkin, S.; et al. Convergent antibody responses to SARS-CoV-2 in convalescent individuals. Nature 2020, 584, 437–442. [Google Scholar] [CrossRef] [PubMed]
- Chi, X.; Yan, R.; Zhang, J.; Zhang, G.; Zhang, Y.; Hao, M.; Zhang, Z.; Fan, P.; Dong, Y.; Yang, Y.; et al. A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-CoV-2. Science 2020, 369, 650–655. [Google Scholar] [CrossRef] [PubMed]
- Liu, L.; Wang, P.; Nair, M.S.; Yu, J.; Rapp, M.; Wang, Q.; Luo, Y.; Chan, J.F.; Sahi, V.; Figueroa, A.; et al. Potent neutralizing antibodies against multiple epitopes on SARS-CoV-2 spike. Nature 2020, 584, 450–456. [Google Scholar] [CrossRef]
- Voss, W.N.; Hou, Y.J.; Johnson, N.V.; Delidakis, G.; Kim, J.E.; Javanmardi, K.; Horton, A.P.; Bartzoka, F.; Paresi, C.J.; Tanno, Y.; et al. Prevalent, protective, and convergent IgG recognition of SARS-CoV-2 non-RBD spike epitopes. Science 2021, 372, 1108–1112. [Google Scholar] [CrossRef] [PubMed]
- Pinto, D.; Sauer, M.M.; Czudnochowski, N.; Low, J.S.; Tortorici, M.A.; Housley, M.P.; Noack, J.; Walls, A.C.; Bowen, J.E.; Guarino, B.; et al. Broad betacoronavirus neutralization by a stem helix-specific human antibody. Science 2021, 373, 1109–1116. [Google Scholar] [CrossRef]
- Zhou, P.; Song, G.; Liu, H.; Yuan, M.; He, W.T.; Beutler, N.; Zhu, X.; Tse, L.V.; Martinez, D.R.; Schafer, A.; et al. Broadly neutralizing anti-S2 antibodies protect against all three human betacoronaviruses that cause deadly disease. Immunity 2023, 56, 669–686.e7. [Google Scholar] [CrossRef]
- Araf, Y.; Akter, F.; Tang, Y.D.; Fatemi, R.; Parvez, M.S.A.; Zheng, C.; Hossain, M.G. Omicron variant of SARS-CoV-2: Genomics, transmissibility, and responses to current COVID-19 vaccines. J. Med. Virol. 2022, 94, 1825–1832. [Google Scholar] [CrossRef]
- Planas, D.; Saunders, N.; Maes, P.; Guivel-Benhassine, F.; Planchais, C.; Buchrieser, J.; Bolland, W.H.; Porrot, F.; Staropoli, I.; Lemoine, F.; et al. Considerable escape of SARS-CoV-2 Omicron to antibody neutralization. Nature 2022, 602, 671–675. [Google Scholar] [CrossRef] [PubMed]
- Qu, P.; Faraone, J.N.; Evans, J.P.; Zheng, Y.M.; Carlin, C.; Anghelina, M.; Stevens, P.; Fernandez, S.; Jones, D.; Panchal, A.R.; et al. Enhanced evasion of neutralizing antibody response by Omicron XBB.1.5, CH.1.1, and CA.3.1 variants. Cell Rep. 2023, 42, 112443. [Google Scholar] [CrossRef] [PubMed]
- Cao, Y.; Jian, F.; Wang, J.; Yu, Y.; Song, W.; Yisimayi, A.; Wang, J.; An, R.; Chen, X.; Zhang, N.; et al. Imprinted SARS-CoV-2 humoral immunity induces convergent Omicron RBD evolution. Nature 2023, 614, 521–529. [Google Scholar] [CrossRef] [PubMed]
- Ashkenazy, H.; Abadi, S.; Martz, E.; Chay, O.; Mayrose, I.; Pupko, T.; Ben-Tal, N. ConSurf 2016: An improved methodology to estimate and visualize evolutionary conservation in macromolecules. Nucleic Acids Res. 2016, 44, W344–W350. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Kaku, C.I.; Song, G.; Yuan, M.; Andrabi, R.; Burton, D.R.; Walker, L.M.; Wilson, I.A. Human antibodies to SARS-CoV-2 with a recurring YYDRxG motif retain binding and neutralization to variants of concern including Omicron. Commun. Biol. 2022, 5, 766. [Google Scholar] [CrossRef]
- Liu, H.; Wu, N.C.; Yuan, M.; Bangaru, S.; Torres, J.L.; Caniels, T.G.; van Schooten, J.; Zhu, X.; Lee, C.C.D.; Brouwer, P.J.M.; et al. Cross-neutralization of a SARS-CoV-2 antibody to a functionally conserved site is mediated by avidity. Immunity 2020, 53, 1272–1280.e5. [Google Scholar] [CrossRef]
- Liu, L.; Iketani, S.; Guo, Y.; Reddem, E.R.; Casner, R.G.; Nair, M.S.; Yu, J.; Chan, J.F.; Wang, M.; Cerutti, G.; et al. An antibody class with a common CDRH3 motif broadly neutralizes sarbecoviruses. Sci. Transl. Med. 2022, 14, eabn6859. [Google Scholar] [CrossRef] [PubMed]
- Cho, A.; Muecksch, F.; Schaefer-Babajew, D.; Wang, Z.; Finkin, S.; Gaebler, C.; Ramos, V.; Cipolla, M.; Mendoza, P.; Agudelo, M.; et al. Anti-SARS-CoV-2 receptor-binding domain antibody evolution after mRNA vaccination. Nature 2021, 600, 517–522. [Google Scholar] [CrossRef] [PubMed]
- Sakharkar, M.; Rappazzo, C.G.; Wieland-Alter, W.F.; Hsieh, C.L.; Wrapp, D.; Esterman, E.S.; Kaku, C.I.; Wec, A.Z.; Geoghegan, J.C.; McLellan, J.S.; et al. Prolonged evolution of the human B cell response to SARS-CoV-2 infection. Sci. Immunol. 2021, 6, eabg6916. [Google Scholar] [CrossRef]
- Yuan, M.; Wu, N.C.; Zhu, X.; Lee, C.D.; So, R.T.Y.; Lv, H.; Mok, C.K.P.; Wilson, I.A. A highly conserved cryptic epitope in the receptor binding domains of SARS-CoV-2 and SARS-CoV. Science 2020, 368, 630–633. [Google Scholar] [CrossRef]
- Piccoli, L.; Park, Y.-J.; Tortorici, M.A.; Czudnochowski, N.; Walls, A.C.; Beltramello, M.; Silacci-Fregni, C.; Pinto, D.; Rosen, L.E.; Bowen, J.E.; et al. Mapping neutralizing and immunodominant sites on the SARS-CoV-2 spike receptor-binding domain by structure-guided high-resolution serology. Cell 2020, 183, 1024–1042.e21. [Google Scholar] [CrossRef] [PubMed]
- Yuan, M.; Zhu, X.; He, W.T.; Zhou, P.; Kaku, C.I.; Capozzola, T.; Zhu, C.Y.; Yu, X.; Liu, H.; Yu, W.; et al. A broad and potent neutralization epitope in SARS-related coronaviruses. Proc. Natl. Acad. Sci. USA 2022, 119, e2205784119. [Google Scholar] [CrossRef] [PubMed]
- Chen, E.C.; Gilchuk, P.; Zost, S.J.; Suryadevara, N.; Winkler, E.S.; Cabel, C.R.; Binshtein, E.; Chen, R.E.; Sutton, R.E.; Rodriguez, J.; et al. Convergent antibody responses to the SARS-CoV-2 spike protein in convalescent and vaccinated individuals. Cell Rep. 2021, 36, 109604. [Google Scholar] [CrossRef] [PubMed]
- Wu, X.; Yang, Z.Y.; Li, Y.; Hogerkorp, C.M.; Schief, W.R.; Seaman, M.S.; Zhou, T.; Schmidt, S.D.; Wu, L.; Xu, L.; et al. Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1. Science 2010, 329, 856–861. [Google Scholar] [CrossRef] [PubMed]
- Avnir, Y.; Tallarico, A.S.; Zhu, Q.; Bennett, A.S.; Connelly, G.; Sheehan, J.; Sui, J.; Fahmy, A.; Huang, C.Y.; Cadwell, G.; et al. Molecular signatures of hemagglutinin stem-directed heterosubtypic human neutralizing antibodies against influenza A viruses. PLoS Pathog. 2014, 10, e1004103. [Google Scholar] [CrossRef] [PubMed]
- Raybould, M.I.J.; Kovaltsuk, A.; Marks, C.; Deane, C.M. CoV-AbDab: The coronavirus antibody database. Bioinformatics 2021, 37, 734–735. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Yuan, M.; Lv, H.; Peng, J.; Wilson, I.A.; Wu, N.C. A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. Immunity 2022, 55, 1105–1117.e4. [Google Scholar] [CrossRef] [PubMed]
- Benson, D.A.; Karsch-Mizrachi, I.; Lipman, D.J.; Ostell, J.; Wheeler, D.L. GenBank. Nucleic Acids Res. 2003, 31, 23–27. [Google Scholar] [CrossRef] [PubMed]
- Klein, J.S.; Bjorkman, P.J. Few and far between: How HIV may be evading antibody avidity. PLoS Pathog. 2010, 6, e1000908. [Google Scholar] [CrossRef]
- Asokan, M.; Rudicell, R.S.; Louder, M.; McKee, K.; O’Dell, S.; Stewart-Jones, G.; Wang, K.; Xu, L.; Chen, X.; Choe, M.; et al. Bispecific antibodies targeting different epitopes on the HIV-1 envelope exhibit broad and potent neutralization. J. Virol. 2015, 89, 12501–12512. [Google Scholar] [CrossRef]
- Wu, N.C.; Yuan, M.; Bangaru, S.; Huang, D.; Zhu, X.; Lee, C.-C.D.; Turner, H.L.; Peng, L.; Yang, L.; Burton, D.R. A natural mutation between SARS-CoV-2 and SARS-CoV determines neutralization by a cross-reactive antibody. PLoS Pathog. 2020, 16, e1009089. [Google Scholar] [CrossRef]
- Wang, P.; Casner, R.G.; Nair, M.S.; Yu, J.; Guo, Y.; Wang, M.; Chan, J.F.; Cerutti, G.; Iketani, S.; Liu, L.; et al. A monoclonal antibody that neutralizes SARS-CoV-2 variants, SARS-CoV, and other sarbecoviruses. Emerg. Microbes Infect. 2022, 11, 147–157. [Google Scholar] [CrossRef] [PubMed]
- Jette, C.A.; Cohen, A.A.; Gnanapragasam, P.N.P.; Muecksch, F.; Lee, Y.E.; Huey-Tubman, K.E.; Schmidt, F.; Hatziioannou, T.; Bieniasz, P.D.; Nussenzweig, M.C.; et al. Broad cross-reactivity across sarbecoviruses exhibited by a subset of COVID-19 donor-derived neutralizing antibodies. Cell Rep. 2021, 36, 109760. [Google Scholar] [CrossRef] [PubMed]
- Zou, J.; Li, L.; Zheng, P.; Liang, W.; Hu, S.; Zhou, S.; Wang, Y.; Zhao, J.; Yuan, D.; Liu, L.; et al. Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance. J. Clin. Investig. 2022, 132, e154987. [Google Scholar] [CrossRef]
- Cao, Y.; Wang, J.; Jian, F.; Xiao, T.; Song, W.; Yisimayi, A.; Huang, W.; Li, Q.; Wang, P.; An, R.; et al. Omicron escapes the majority of existing SARS-CoV-2 neutralizing antibodies. Nature 2022, 602, 657–663. [Google Scholar] [CrossRef] [PubMed]
- He, Q.; Wu, L.; Xu, Z.; Wang, X.; Xie, Y.; Chai, Y.; Zheng, A.; Zhou, J.; Qiao, S.; Huang, M.; et al. An updated atlas of antibody evasion by SARS-CoV-2 Omicron sub-variants including BQ.1.1 and XBB. Cell Rep. Med. 2023, 4, 100991. [Google Scholar] [CrossRef] [PubMed]
- Windsor, I.W.; Tong, P.; Lavidor, O.; Moghaddam, A.S.; McKay, L.G.A.; Gautam, A.; Chen, Y.; MacDonald, E.A.; Yoo, D.K.; Griffths, A.; et al. Antibodies induced by an ancestral SARS-CoV-2 strain that cross-neutralize variants from Alpha to Omicron BA.1. Sci. Immunol. 2022, 7, eabo3425. [Google Scholar] [CrossRef]
- Wang, Z.; Schmidt, F.; Weisblum, Y.; Muecksch, F.; Barnes, C.O.; Finkin, S.; Schaefer-Babajew, D.; Cipolla, M.; Gaebler, C.; Lieberman, J.A.; et al. mRNA vaccine-elicited antibodies to SARS-CoV-2 and circulating variants. Nature 2021, 592, 616–622. [Google Scholar] [CrossRef]
- Cheng, L.; Song, S.; Fan, Q.; Shen, S.; Wang, H.; Zhou, B.; Ge, X.; Ju, B.; Zhang, Z. Cross-neutralization of SARS-CoV-2 Kappa and Delta variants by inactivated vaccine-elicited serum and monoclonal antibodies. Cell Discov. 2021, 7, 112. [Google Scholar] [CrossRef]
- Ju, B.; Zheng, Q.; Guo, H.; Fan, Q.; Li, T.; Song, S.; Sun, H.; Shen, S.; Zhou, X.; Xue, W.; et al. Immune escape by SARS-CoV-2 Omicron variant and structural basis of its effective neutralization by a broad neutralizing human antibody VacW-209. Cell Res. 2022, 32, 491–494. [Google Scholar] [CrossRef]
- He, W.; Musharrafieh, R.; Song, G.; Dueker, K.; Tse, L.V.; Martinez, D.R.; Schafer, A.; Callaghan, S.; Yong, P.; Beutler, N.; et al. Targeted isolation of diverse human protective broadly neutralizing antibodies against SARS-like viruses. Nat. Immunol. 2022, 23, 960–970. [Google Scholar] [CrossRef] [PubMed]
- Song, G.; Yuan, M.; Liu, H.; Capozzola, T.; Lin, R.N.; Torres, J.L.; He, W.T.; Musharrafieh, R.; Dueker, K.; Zhou, P.; et al. Broadly neutralizing antibodies targeting a conserved silent face of spike RBD resist extreme SARS-CoV-2 antigenic drift. bioRxiv 2023. [Google Scholar] [CrossRef] [PubMed]
- Gobeil, S.M.; Henderson, R.; Stalls, V.; Janowska, K.; Huang, X.; May, A.; Speakman, M.; Beaudoin, E.; Manne, K.; Li, D.; et al. Structural diversity of the SARS-CoV-2 Omicron spike. Mol. Cell 2022, 82, 2050–2068.e6. [Google Scholar] [CrossRef] [PubMed]
- Stalls, V.; Lindenberger, J.; Gobeil, S.M.; Henderson, R.; Parks, R.; Barr, M.; Deyton, M.; Martin, M.; Janowska, K.; Huang, X.; et al. Cryo-EM structures of SARS-CoV-2 Omicron BA.2 spike. Cell Rep. 2022, 39, 111009. [Google Scholar] [CrossRef] [PubMed]
- Wu, N.C.; Yamayoshi, S.; Ito, M.; Uraki, R.; Kawaoka, Y.; Wilson, I.A. Recurring and adaptable binding motifs in broadly neutralizing antibodies to influenza virus are encoded on the D3-9 segment of the Ig gene. Cell Host Microbe 2018, 24, 569–578.e4. [Google Scholar] [CrossRef] [PubMed]
- Corti, D.; Voss, J.; Gamblin, S.J.; Codoni, G.; Macagno, A.; Jarrossay, D.; Vachieri, S.G.; Pinna, D.; Minola, A.; Vanzetta, F.; et al. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science 2011, 333, 850–856. [Google Scholar] [CrossRef] [PubMed]
- Joyce, M.G.; Wheatley, A.K.; Thomas, P.V.; Chuang, G.Y.; Soto, C.; Bailer, R.T.; Druz, A.; Georgiev, I.S.; Gillespie, R.A.; Kanekiyo, M.; et al. Vaccine-induced antibodies that neutralize group 1 and group 2 influenza A viruses. Cell 2016, 166, 609–623. [Google Scholar] [CrossRef] [PubMed]
- Brochet, X.; Lefranc, M.P.; Giudicelli, V. IMGT/V-QUEST: The highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis. Nucleic Acids Res. 2008, 36, W503–W508. [Google Scholar] [CrossRef] [PubMed]
- Breden, F.; Lepik, C.; Longo, N.S.; Montero, M.; Lipsky, P.E.; Scott, J.K. Comparison of antibody repertoires produced by HIV-1 infection, other chronic and acute infections, and systemic autoimmune disease. PLoS ONE 2011, 6, e16857. [Google Scholar] [CrossRef]
- Sok, D.; Burton, D.R. Recent progress in broadly neutralizing antibodies to HIV. Nat. Immunol. 2018, 19, 1179–1188. [Google Scholar] [CrossRef]
- Doria-Rose, N.A.; Schramm, C.A.; Gorman, J.; Moore, P.L.; Bhiman, J.N.; DeKosky, B.J.; Ernandes, M.J.; Georgiev, I.S.; Kim, H.J.; Pancera, M.; et al. Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies. Nature 2014, 509, 55–62. [Google Scholar] [CrossRef] [PubMed]
- Gorman, J.; Chuang, G.Y.; Lai, Y.T.; Shen, C.H.; Boyington, J.C.; Druz, A.; Geng, H.; Louder, M.K.; McKee, K.; Rawi, R.; et al. Structure of super-potent antibody CAP256-VRC26.25 in complex with HIV-1 envelope reveals a combined mode of trimer-apex recognition. Cell Rep. 2020, 31, 107488. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.H.; Andrabi, R.; Su, C.Y.; Yasmeen, A.; Julien, J.P.; Kong, L.; Wu, N.C.; McBride, R.; Sok, D.; Pauthner, M.; et al. A broadly neutralizing antibody targets the dynamic HIV envelope trimer apex via a long, rigidified, and anionic beta-hairpin structure. Immunity 2017, 46, 690–702. [Google Scholar] [CrossRef] [PubMed]
- McLellan, J.S.; Pancera, M.; Carrico, C.; Gorman, J.; Julien, J.P.; Khayat, R.; Louder, R.; Pejchal, R.; Sastry, M.; Dai, K.; et al. Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9. Nature 2011, 480, 336–343. [Google Scholar] [CrossRef] [PubMed]
- Pancera, M.; Shahzad-Ul-Hussan, S.; Doria-Rose, N.A.; McLellan, J.S.; Bailer, R.T.; Dai, K.; Loesgen, S.; Louder, M.K.; Staupe, R.P.; Yang, Y.; et al. Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16. Nat. Struct. Mol. Biol. 2013, 20, 804–813. [Google Scholar] [CrossRef] [PubMed]
- Landais, E.; Murrell, B.; Briney, B.; Murrell, S.; Rantalainen, K.; Berndsen, Z.T.; Ramos, A.; Wickramasinghe, L.; Smith, M.L.; Eren, K.; et al. HIV envelope glycoform heterogeneity and localized diversity govern the initiation and maturation of a V2 apex broadly neutralizing antibody lineage. Immunity 2017, 47, 990–1003.e9. [Google Scholar] [CrossRef] [PubMed]
- Willis, J.R.; Berndsen, Z.T.; Ma, K.M.; Steichen, J.M.; Schiffner, T.; Landais, E.; Liguori, A.; Kalyuzhniy, O.; Allen, J.D.; Baboo, S.; et al. Human immunoglobulin repertoire analysis guides design of vaccine priming immunogens targeting HIV V2-apex broadly neutralizing antibody precursors. Immunity 2022, 55, 2149–2167.e9. [Google Scholar] [CrossRef] [PubMed]
- Sok, D.; van Gils, M.J.; Pauthner, M.; Julien, J.P.; Saye-Francisco, K.L.; Hsueh, J.; Briney, B.; Lee, J.H.; Le, K.M.; Lee, P.S.; et al. Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex. Proc. Natl. Acad. Sci. USA 2014, 111, 17624–17629. [Google Scholar] [CrossRef]
- Bonsignori, M.; Hwang, K.K.; Chen, X.; Tsao, C.Y.; Morris, L.; Gray, E.; Marshall, D.J.; Crump, J.A.; Kapiga, S.H.; Sam, N.E.; et al. Analysis of a clonal lineage of HIV-1 envelope V2/V3 conformational epitope-specific broadly neutralizing antibodies and their inferred unmutated common ancestors. J. Virol. 2011, 85, 9998–10009. [Google Scholar] [CrossRef]
- Andrabi, R.; Voss, J.E.; Liang, C.H.; Briney, B.; McCoy, L.E.; Wu, C.Y.; Wong, C.H.; Poignard, P.; Burton, D.R. Identification of common features in prototype broadly neutralizing antibodies to HIV envelope V2 apex to facilitate vaccine design. Immunity 2015, 43, 959–973. [Google Scholar] [CrossRef]
- Ekiert, D.C.; Kashyap, A.K.; Steel, J.; Rubrum, A.; Bhabha, G.; Khayat, R.; Lee, J.H.; Dillon, M.A.; O’Neil, R.E.; Faynboym, A.M.; et al. Cross-neutralization of influenza A viruses mediated by a single antibody loop. Nature 2012, 489, 526–532. [Google Scholar] [CrossRef] [PubMed]
- McCarthy, K.R.; Watanabe, A.; Kuraoka, M.; Do, K.T.; McGee, C.E.; Sempowski, G.D.; Kepler, T.B.; Schmidt, A.G.; Kelsoe, G.; Harrison, S.C. Memory B cells that cross-react with group 1 and group 2 influenza A viruses are abundant in adult human repertoires. Immunity 2018, 48, 174–184.e9. [Google Scholar] [CrossRef]
- Bajic, G.; Maron, M.J.; Caradonna, T.M.; Tian, M.; Mermelstein, A.; Fera, D.; Kelsoe, G.; Kuraoka, M.; Schmidt, A.G. Structure-guided molecular grafting of a complex broadly neutralizing viral epitope. ACS Infect. Dis. 2020, 6, 1182–1191. [Google Scholar] [CrossRef] [PubMed]
- McCarthy, K.R.; Raymond, D.D.; Do, K.T.; Schmidt, A.G.; Harrison, S.C. Affinity maturation in a human humoral response to influenza hemagglutinin. Proc. Natl. Acad. Sci. USA 2019, 116, 26745–26751. [Google Scholar] [CrossRef] [PubMed]
- Sun, X.; Liu, C.; Lu, X.; Ling, Z.; Yi, C.; Zhang, Z.; Li, Z.; Jin, M.; Wang, W.; Tang, S.; et al. Unique binding pattern for a lineage of human antibodies with broad reactivity against influenza A virus. Nat. Commun. 2022, 13, 2378. [Google Scholar] [CrossRef]
- Stadlbauer, D.; Zhu, X.; McMahon, M.; Turner, J.S.; Wohlbold, T.J.; Schmitz, A.J.; Strohmeier, S.; Yu, W.; Nachbagauer, R.; Mudd, P.A.; et al. Broadly protective human antibodies that target the active site of influenza virus neuraminidase. Science 2019, 366, 499–504. [Google Scholar] [CrossRef]
- Wang, Q.; Yang, H.; Liu, X.; Dai, L.; Ma, T.; Qi, J.; Wong, G.; Peng, R.; Liu, S.; Li, J.; et al. Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus. Sci. Transl. Med. 2016, 8, 369ra179. [Google Scholar] [CrossRef]
- Barba-Spaeth, G.; Dejnirattisai, W.; Rouvinski, A.; Vaney, M.C.; Medits, I.; Sharma, A.; Simon-Loriere, E.; Sakuntabhai, A.; Cao-Lormeau, V.M.; Haouz, A.; et al. Structural basis of potent Zika-dengue virus antibody cross-neutralization. Nature 2016, 536, 48–53. [Google Scholar] [CrossRef]
- Dai, L.; Song, J.; Lu, X.; Deng, Y.Q.; Musyoki, A.M.; Cheng, H.; Zhang, Y.; Yuan, Y.; Song, H.; Haywood, J.; et al. Structures of the Zika virus envelope protein and its complex with a flavivirus broadly protective antibody. Cell Host Microbe 2016, 19, 696–704. [Google Scholar] [CrossRef]
- Zhao, H.; Fernandez, E.; Dowd, K.A.; Speer, S.D.; Platt, D.J.; Gorman, M.J.; Govero, J.; Nelson, C.A.; Pierson, T.C.; Diamond, M.S.; et al. Structural basis of Zika virus-specific antibody protection. Cell 2016, 166, 1016–1027. [Google Scholar] [CrossRef]
- Robbiani, D.F.; Bozzacco, L.; Keeffe, J.R.; Khouri, R.; Olsen, P.C.; Gazumyan, A.; Schaefer-Babajew, D.; Avila-Rios, S.; Nogueira, L.; Patel, R.; et al. Recurrent potent human neutralizing antibodies to Zika virus in Brazil and Mexico. Cell 2017, 169, 597–609 e11. [Google Scholar] [CrossRef] [PubMed]
- Dussupt, V.; Sankhala, R.S.; Gromowski, G.D.; Donofrio, G.; De La Barrera, R.A.; Larocca, R.A.; Zaky, W.; Mendez-Rivera, L.; Choe, M.; Davidson, E.; et al. Potent Zika and dengue cross-neutralizing antibodies induced by Zika vaccination in a dengue-experienced donor. Nat. Med. 2020, 26, 228–235. [Google Scholar] [CrossRef] [PubMed]
- Sharma, A.; Zhang, X.; Dejnirattisai, W.; Dai, X.; Gong, D.; Wongwiwat, W.; Duquerroy, S.; Rouvinski, A.; Vaney, M.C.; Guardado-Calvo, P.; et al. The epitope arrangement on flavivirus particles contributes to mAb C10’s extraordinary neutralization breadth across Zika and dengue viruses. Cell 2021, 184, 6052–6066 e18. [Google Scholar] [CrossRef]
- Dejnirattisai, W.; Wongwiwat, W.; Supasa, S.; Zhang, X.; Dai, X.; Rouvinski, A.; Jumnainsong, A.; Edwards, C.; Quyen, N.T.H.; Duangchinda, T.; et al. A new class of highly potent, broadly neutralizing antibodies isolated from viremic patients infected with dengue virus. Nat. Immunol. 2015, 16, 170–177. [Google Scholar] [CrossRef]
- Rouvinski, A.; Guardado-Calvo, P.; Barba-Spaeth, G.; Duquerroy, S.; Vaney, M.C.; Kikuti, C.M.; Navarro Sanchez, M.E.; Dejnirattisai, W.; Wongwiwat, W.; Haouz, A.; et al. Recognition determinants of broadly neutralizing human antibodies against dengue viruses. Nature 2015, 520, 109–113. [Google Scholar] [CrossRef] [PubMed]
- Swindells, M.B.; Porter, C.T.; Couch, M.; Hurst, J.; Abhinandan, K.R.; Nielsen, J.H.; Macindoe, G.; Hetherington, J.; Martin, A.C. abYsis: Integrated antibody sequence and structure-management, analysis, and prediction. J. Mol. Biol. 2017, 429, 356–364. [Google Scholar] [CrossRef] [PubMed]
- Lerner, R.A. Rare antibodies from combinatorial libraries suggests an S.O.S. component of the human immunological repertoire. Mol. Biosyst. 2011, 7, 1004–1012. [Google Scholar] [CrossRef] [PubMed]
- Caniels, T.G.; Medina-Ramirez, M.; Zhang, J.; Sarkar, A.; Kumar, S.; LaBranche, A.; Derking, R.; Allen, J.D.; Snitselaar, J.L.; Capella-Pujol, J.; et al. Germline-targeting HIV-1 Env vaccination induces VRC01-class antibodies with rare insertions. Cell Rep. Med. 2023, 4, 101003. [Google Scholar] [CrossRef]
- Leggat, D.J.; Cohen, K.W.; Willis, J.R.; Fulp, W.J.; deCamp, A.C.; Kalyuzhniy, O.; Cottrell, C.A.; Menis, S.; Finak, G.; Ballweber-Fleming, L.; et al. Vaccination induces HIV broadly neutralizing antibody precursors in humans. Science 2022, 378, eadd6502. [Google Scholar] [CrossRef]
- Nelson, A.N.; Shen, X.; Vekatayogi, S.; Zhang, S.; Ozorowski, G.; Dennis, M.; Sewall, L.M.; Milligan, E.; Davis, D.; Cross, K.A.; et al. Germline-targeting SOSIP trimer immunization elicits precursor CD4 binding-site targeting broadly neutralizing antibodies in infant macaques. bioRxiv 2023. [Google Scholar] [CrossRef]
- Stamatatos, L.; Pancera, M.; McGuire, A.T. Germline-targeting immunogens. Immunol. Rev. 2017, 275, 203–216. [Google Scholar] [CrossRef] [PubMed]
- Cohen, K.W.; De Rosa, S.C.; Fulp, W.J.; deCamp, A.C.; Fiore-Gartland, A.; Mahoney, C.R.; Furth, S.; Donahue, J.; Whaley, R.E.; Ballweber-Fleming, L.; et al. A first-in-human germline-targeting HIV nanoparticle vaccine induced broad and publicly targeted helper T cell responses. Sci. Transl. Med. 2023, 15, eadf3309. [Google Scholar] [CrossRef] [PubMed]
Antigen | Antibody Category/Epitope | Antibody Name | BSA by CDR H3 (%) | Putative D Gene * | CDR H3 Sequence | CDRH3 Length | PDB |
---|---|---|---|---|---|---|---|
SARS-CoV-2 spike | YYDxxG | COVA1-16 | 68% | IGHD3-22 | PPRNYYDRSGYYQRAEYFQH | 20 | 7JMW |
SARS-CoV-2 spike | YYDxxG | ADI-62113 | 72% | IGHD3-22 | AARPYYDRRGYFFRADYFQH | 20 | 7T7B |
HIV-1 Env | V1V2 apex | PGT145 | 80% | IGHD4-17 | GSKHRLRDYFLYNEYGPNYEEWGDYLATLDV | 31 | 5V8L |
HIV-1 Env | V1V2 apex | PG9 | 71% | IGHD3-03 | EAGGPDYRNGYNYYDFYDGYYNYHYMDV | 28 | 7T77 |
HIV-1 Env | V1V2 apex | CAP256-VRC26.25 | 87% | IGHD3-03 | DLREDECEEWWSDYYDFGKQLPCAKSRGGLVGIADN | 36 | 6VTT |
HIV-1 Env | V1V2 apex | PCT64.LMCA | 66% | IGHD3-03 | GVETYDFWSGYDDHYYDYYFRDVW | 24 | 7T73 |
Influenza HA | RBS | C05 | 81% | IGHD6-13 | HMSMQQVVSAGWERADLVGDAFDV | 24 | 4FP8 |
Influenza HA | RBS | K03.12 | 86% | IGHD6-19 | DLTLMYVFDSGWARGAHDYYGMDV | 24 | 5W08 |
Influenza HA | RBS | 652-I-7-6 | 85% | IGHD2-2 | APPYCTSASCPDDYYYYYMDV | 21 | 6Q0I |
Influenza HA | stem | 28-12 | 79% | IGHD2-2 | DRGCSSTNCYVVGYYFYGMDV | 21 | 7X6O |
Influenza HA | stem | S9-3-37 | 83% | IGHD3-9 | EFRTQIVLGYFDWLEGNAFDM | 21 | 6E3H |
Influenza HA | stem | F16v3 | 71% | IGHD3-9 | DSQLRSLLYFEWLSQGYFDY | 20 | 3ZTJ |
Influenza NA | catalytic site | 1G01 | 77% | IGHD3-10 | TSSWGDYTRGPEPKITWYFDL | 21 | 6Q23 |
ZIKV E | 150 loop | A11 | 83% | IGHD3-22 | DGVRFYYDSTGYYPDSFFKYGMDV | 24 | 5LCV |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Yuan, M.; Wilson, I.A. The D Gene in CDR H3 Determines a Public Class of Human Antibodies to SARS-CoV-2. Vaccines 2024, 12, 467. https://doi.org/10.3390/vaccines12050467
Yuan M, Wilson IA. The D Gene in CDR H3 Determines a Public Class of Human Antibodies to SARS-CoV-2. Vaccines. 2024; 12(5):467. https://doi.org/10.3390/vaccines12050467
Chicago/Turabian StyleYuan, Meng, and Ian A. Wilson. 2024. "The D Gene in CDR H3 Determines a Public Class of Human Antibodies to SARS-CoV-2" Vaccines 12, no. 5: 467. https://doi.org/10.3390/vaccines12050467
APA StyleYuan, M., & Wilson, I. A. (2024). The D Gene in CDR H3 Determines a Public Class of Human Antibodies to SARS-CoV-2. Vaccines, 12(5), 467. https://doi.org/10.3390/vaccines12050467