Genome-Wide Characterization of the TGF-β Gene Family in Donkey (Equus asinus) Reveals Lineage-Specific Gene Duplications and Deleterious Mutations
Simple Summary
Abstract
1. Introduction
2. Materials and Methods
2.1. Data Retrieval
2.2. Identification of TGF-β Genes in Donkey
2.3. Characterization of Physicochemical Properties
2.4. Multiple Sequence Alignment
2.5. Structural Analyses (Motifs, Gene Structure, Domains)
2.6. Phylogenetic Analysis
2.7. Synteny and Gene Duplication Analyses
2.8. Ka/Ks Calculation and Selection Pressure
2.9. SNP Detection and Functional Effect Prediction
2.10. Subcellular Localization Prediction
2.11. Tissue-Specific Expression Analysis of TGF-β Genes
2.12. Protein–Protein Interaction and KEGG Pathway Enrichment Analysis
3. Results
3.1. Genome-Wide Identification of Donkey TGF-β Genes
3.2. Evolutionary Analysis
3.3. Structural and Physicochemical Characterization
3.4. Mutation Analysis
3.5. Functional Prediction
3.6. Tissue-Specific Expression Profiling of Donkey TGF-β Family Genes
3.7. Integrated PPI and KEGG Enrichment Analysis
4. Discussion
Limitations and Future Directions
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
Abbreviations
| AI | Aliphatic index |
| BLAST | Basic Local Alignment Search Tool |
| BMP | Bone morphogenetic protein |
| CDD | Conserved Domain Database |
| GDF | Growth differentiation factor |
| GFF3 | General Feature Format version 3 |
| GRAVY | Grand average of hydropathicity |
| HMM | Hidden Markov model |
| HMMER | Hidden Markov Model-based sequence analysis tool |
| II | Instability index |
| Ka | Nonsynonymous substitution rate |
| Ks | Synonymous substitution rate |
| lncRNA | Long noncoding RNA |
| MCScanX | Multiple Collinearity Scan toolkit |
| MEGA | Molecular Evolutionary Genetics Analysis |
| MEME | Multiple Expectation Maximization for Motif Elicitation |
| miRNA | MicroRNA |
| MSTN | Myostatin |
| MW | Molecular weight |
| MYA | Million years ago |
| NCBI | National Center for Biotechnology Information |
| NGS | Next-generation sequencing |
| NJ | Neighbor-joining |
| Pfam | Protein families database |
| pI | Isoelectric point |
| PROVEAN | Protein Variation Effect Analyzer |
| RGMA | Repulsive Guidance Molecule A |
| R-SMAD | Receptor-regulated SMAD |
| SIFT | Sorting Intolerant From Tolerant |
| SMART | Simple Modular Architecture Research Tool |
| SNP | Single nucleotide polymorphism |
| SMAD | Small Mothers Against Decapentaplegic |
| TBtools | Toolkit for Biologists |
| TGF-β | Transforming growth factor beta |
| TGFBR | Transforming growth factor beta receptor |
| UTR | Untranslated region |
| WoLF PSORT | Weighted k-nearest neighbor Protein Subcellular Localization Prediction Tool |
References
- Moses, H.L.; Roberts, A.B.; Derynck, R. The discovery and early days of TGF-β: A historical perspective. Cold Spring Harb. Perspect. Biol. 2016, 8, a021865. [Google Scholar] [CrossRef] [PubMed]
- Roth, S.; Gong, W.; Gressner, A.M. Expression of different isoforms of TGF-β and the latent TGF-β binding protein (LTBP) by rat Kupffer cells. J. Hepatol. 1998, 29, 915–922. [Google Scholar] [CrossRef] [PubMed]
- Capdevila, J.; Belmonte, J.C.I. Patterning mechanisms controlling vertebrate limb development. Annu. Rev. Cell Dev. Biol. 2001, 17, 87–132. [Google Scholar] [CrossRef] [PubMed]
- Rissi, M.; Wittbrodt, J.; Délot, E.; Naegeli, M.; Rosa, F.M. Zebrafish Radar: A new member of the TGF-β superfamily defines dorsal regions of the neural plate and the embryonic retina. Mech. Dev. 1995, 49, 223–234. [Google Scholar] [CrossRef] [PubMed]
- Grimaud, E.; Heymann, D.; Rédini, F. Recent advances in TGF-β effects on chondrocyte metabolism: Potential therapeutic roles of TGF-β in cartilage disorders. Cytokine Growth Factor Rev. 2002, 13, 241–257. [Google Scholar] [CrossRef] [PubMed]
- Wu, M.Y.; Hill, C.S. TGF-β superfamily signaling in embryonic development and homeostasis. Dev. Cell 2009, 16, 329–343. [Google Scholar] [CrossRef] [PubMed]
- Morikawa, M.; Derynck, R.; Miyazono, K. TGF-β and the TGF-β family: Context-dependent roles in cell and tissue physiology. Cold Spring Harb. Perspect. Biol. 2016, 8, a021873. [Google Scholar] [CrossRef] [PubMed]
- Kang, J.S.; Liu, C.; Derynck, R. New regulatory mechanisms of TGF-β receptor function. Trends Cell Biol. 2009, 19, 385–394. [Google Scholar] [CrossRef] [PubMed]
- Huminiecki, L.; Goldovsky, L.; Freilich, S.; Moustakas, A.; Ouzounis, C.; Heldin, C.-H. Emergence, development and diversification of the TGF-β signalling pathway within the animal kingdom. BMC Evol. Biol. 2009, 9, 28. [Google Scholar] [CrossRef] [PubMed]
- Dayal, S.; Chaubey, D.; Joshi, D.C.; Ranmale, S.; Pillai, B. Noncoding RNAs: Emerging regulators of behavioral complexity. Wiley Interdiscip. Rev. RNA 2024, 15, e1847. [Google Scholar] [CrossRef] [PubMed]
- Kumar, S.; Chauhan, M.S. Relative expression of the developmentally important candidate genes in immature oocytes and in vitro-produced embryos of buffalo (Bubalus bubalis). Zygote 2022, 30, 509–515. [Google Scholar] [CrossRef] [PubMed]
- Cheng, Z.; Fu, L.; Yimamu, M.; Feng, J.; Wu, L.; Hu, Y.; Wu, J.; Xu, X.; Guo, C. Fenofibrate Inhibits Hepatic Stellate Cell Activation and Autophagy in Liver Fibrosis through the Tgfβ1/Smad3 and Pparα/Cgas/Sting Pathways. Pak. Vet. J. 2025, 45, 579–591. [Google Scholar] [CrossRef]
- Li, Y.; Jing, J.; Dang, W.; Jia, K.; Guo, X.; Kebreab, E.; Lyu, L.; Zhao, J. Cross-talk between NOTCH2 and BMP4/SMAD signaling pathways in bovine follicular granulosa cells. Theriogenology 2022, 187, 74–81. [Google Scholar] [CrossRef] [PubMed]
- Dall’Olio, S.; Fontanesi, L.; Costa, L.N.; Tassinari, M.; Minieri, L.; Falaschini, A. Analysis of horse myostatin gene and identification of single nucleotide polymorphisms in breeds of different morphological types. BioMed Res. Int. 2010, 2010, 542945. [Google Scholar] [CrossRef] [PubMed]
- Shehzad, S.; Hafeez, A.; Chang, M.S.; Suthar, V.; Khaskheli, R.A.; Fatima, S.; Binish, S.; Rasool, G.; Mehmood, A.; Ali, A.; et al. Genome-wide identification and functional analysis of Kunitz-Type Trypsin Inhibitor gene family in cotton against pest resistance. Int. J. Agric. Biosci. 2026, 15, 168–174. [Google Scholar] [CrossRef] [PubMed]
- Wong, X.J.; Ramaiya, S.D.; Cheng, W.H.; Wang, Z.F.; Hishamuddin, M.S.; Lee, S.Y. Complete plastid genome of Coelostegia griffithii (Malvaceae): Structure, comparative and phylogenetic analysis. Asian J. Agric. Biol. 2025, 2024015. [Google Scholar] [CrossRef]
- Budiyanto, A.; Hartanto, S.; Widayanti, R.; Setyawan, E.M.N.; Haryanto, A.; Ibrahim, A.; Pakpahan, S. Genetic diversity of Jawa-Brebes cattle based on reproductive traits markers of the growth hormone gene. Int. J. Vet. Sci. 2025, 14, 351–357. [Google Scholar] [CrossRef]
- Fatmona, S.; Sjafani, N.; Sulasmi; Utami, S.; Wahyuni, S.; Sahil, J.; Keintjem, J.R.M. Genetic distance and kinship relationship of Walik Kembang Sula bird (Ptilinopus melanosphila) based on mtDNA CO1 in North Maluku, Indonesia. Int. J. Vet. Sci. 2024, 14, 548–556. [Google Scholar] [CrossRef]
- Huang, D.; Wang, R.; Liu, S.; Shao, Y.; Zhang, Z.; Yu, C.; Bao, S.; Cong, Y. Genomic analysis and evaluation of pathogenicity and immunogenicity of Riemerella anatipestifer isolates from chickens in China. Pak. Vet. J. 2025, 45, 1345–1352. [Google Scholar] [CrossRef]
- Kun, L.; Hassan, M.; Ahmad, H.I.; Shahzad, A.H.; Raza, S.; Qadeer, I.; Muhammad, S.A.; Liu, W. Comparative genomics analysis of cation channel sperm-associated proteins (CATSPERs) associated with sperm motility in livestock. Pak. Vet. J. 2025, 45, 1157–1167. [Google Scholar] [CrossRef]
- Nasir, T.; Safdar, M.; Imran, S.; Tariq, M.; Junejo, Y.; Ozaslan, M.; Younus, M. Genome-wide in silico identification and characterization of the F-box gene family in water buffalo (Bubalus bubalis). Comp. Biochem. Physiol. Part D Genom. Proteom. 2026, 59, 101825. [Google Scholar]
- Zhu, Q.; Khan, M.Z.; Jing, Y.; Geng, M.; Zhang, X.; Zheng, Y.; Cao, X.; Peng, Y.; Wang, C. The Donkey Genome: From Evolutionary Insights to Sustainable Breeding Strategies. Animals 2025, 16, 93. [Google Scholar] [CrossRef] [PubMed]
- Kitts, P.A.; Church, D.M.; Thibaud-Nissen, F.; Choi, J.; Hem, V.; Sapojnikov, V.; Smith, R.G.; Tatusova, T.; Xiang, C.; Zherikov, A.; et al. Assembly: A resource for assembled genomes at NCBI. Nucleic Acids Res. 2016, 44, D73–D80. [Google Scholar] [CrossRef] [PubMed]
- UniProt Consortium. UniProt: A worldwide hub of protein knowledge. Nucleic Acids Res. 2019, 47, D506–D515. [Google Scholar] [CrossRef] [PubMed]
- Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [PubMed]
- Potter, S.C.; Luciani, A.; Eddy, S.R.; Park, Y.; López, R.; Finn, R.D. HMMER web server: 2018 update. Nucleic Acids Res. 2018, 46, W200–W204. [Google Scholar] [CrossRef] [PubMed]
- El-Gebali, S.; Mistry, J.; Bateman, A.; Eddy, S.R.; Luciani, A.; Potter, S.C.; Qureshi, M.; Richardson, L.J.; Salazar, G.A.; Smart, A.; et al. The Pfam protein families database in 2019. Nucleic Acids Res. 2019, 47, D427–D432. [Google Scholar] [CrossRef] [PubMed]
- Kumar, S.; Stecher, G.; Tamura, K. MEGA7: Molecular evolutionary genetics analysis version 7.0 for bigger datasets. Mol. Biol. Evol. 2016, 33, 1870–1874. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Tang, H.; DeBarry, J.D.; Tan, X.; Li, J.; Wang, X.; Lee, T.-H.; Jin, H.; Marler, B.; Guo, H.; et al. MCScanX: A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, e49. [Google Scholar] [CrossRef] [PubMed]
- Rozas, J.; Ferrer-Mata, A.; Sánchez-DelBarrio, J.C.; Guirao-Rico, S.; Librado, P.; Ramos-Onsins, S.E.; Sánchez-Gracia, A. DnaSP 6: DNA sequence polymorphism analysis of large data sets. Mol. Biol. Evol. 2017, 34, 3299–3302. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.H.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef] [PubMed]
- Wall, J.D. Estimating ancestral population sizes and divergence times. Genetics 2003, 163, 395–404. [Google Scholar] [CrossRef] [PubMed]
- Sim, N.-L.; Kumar, P.; Hu, J.; Henikoff, S.; Schneider, G.; Ng, P.C. SIFT web server: Predicting effects of amino acid substitutions on proteins. Nucleic Acids Res. 2012, 40, W452–W457. [Google Scholar] [CrossRef] [PubMed]
- Choi, Y.; Chan, A.P. PROVEAN web server: A tool to predict the functional effect of amino acid substitutions and indels. Bioinformatics 2015, 31, 2745–2747. [Google Scholar] [CrossRef] [PubMed]
- Capriotti, E.; Fariselli, P. PhD-SNPg: A webserver and lightweight tool for scoring single nucleotide variants. Nucleic Acids Res. 2017, 45, W247–W252. [Google Scholar] [CrossRef] [PubMed]
- Horton, P.; Park, K.-J.; Obayashi, T.; Fujita, N.; Harada, H.; Adams-Collier, C.J.; Nakai, K. WoLF PSORT: Protein localization predictor. Nucleic Acids Res. 2007, 35, W585–W587. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Huang, Y.; Zhen, Y.; Wang, J.; Wang, L.; Chen, N.; Wu, F.; Zhang, L.; Shen, Y.; Bi, C.; et al. De novo transcriptome assembly database for 100 tissues from each of seven species of domestic herbivore. Sci. Data 2024, 11, 488. [Google Scholar] [CrossRef] [PubMed]
- Kingsley, D.M. The TGF-β superfamily: New members, new receptors, and new genetic tests of function in different organisms. Genes Dev. 1994, 8, 133–146. [Google Scholar] [CrossRef] [PubMed]
- Hogan, B.L.M. Bone morphogenetic proteins: Multifunctional regulators of vertebrate development. Genes Dev. 1996, 10, 1580–1594. [Google Scholar] [CrossRef] [PubMed]
- Akgun, E.E.; Erdogan, M.; Altunbas, K. BMP-9 and TGF-β3 Synergistically Regulate Chondrogenic Pathways in Bovine Synovial Fluid-Derived Mesenchymal Stem Cells (BSF-MSCs) in Transwell Co-Culture with Chondrocytes. Pak. Vet. J. 2025, 45, 138–148. [Google Scholar] [CrossRef] [PubMed]
- Mottershead, D.G.; Ritter, L.J.; Gilchrist, R.B. Signalling pathways mediating specific synergistic interactions between GDF9 and BMP15. Mol. Hum. Reprod. 2012, 18, 121–128. [Google Scholar] [CrossRef] [PubMed]
- David, L.; Mallet, C.; Mazerbourg, S.; Feige, J.-J.; Bailly, S. Identification of BMP9 and BMP10 as functional activators of the orphan activin receptor-like kinase 1 (ALK1) in endothelial cells. Blood 2007, 109, 1953–1961. [Google Scholar] [CrossRef] [PubMed]
- Kalbfleisch, T.S.; Rice, E.S.; DePriest, M.S., Jr.; Walenz, B.P.; Hestand, M.S.; Vermeesch, J.R.; O’Connell, B.L.; Fiddes, I.T.; Vershinina, A.O.; Saremi, N.F. Improved reference genome for the domestic horse increases assembly contiguity and composition. Commun. Biol. 2018, 1, 197. [Google Scholar] [CrossRef] [PubMed]
- Li, S.; Zhao, G.; Han, H.; Li, Y.; Li, J.; Wang, J.; Li, X. Genome collinearity analysis illuminates the evolution of donkey chromosome 1 and horse chromosome 5 in perissodactyls: A comparative study. BMC Genom. 2021, 22, 665. [Google Scholar] [CrossRef]
- Massagué, J. TGF-β signal transduction. Annu. Rev. Biochem. 1998, 67, 753–791. [Google Scholar] [CrossRef] [PubMed]
- Tanaka, C.; Sakuma, R.; Nakamura, T.; Hamada, H.; Saijoh, Y. Long-range action of Nodal requires interaction with GDF1. Genes Dev. 2007, 21, 3272–3282. [Google Scholar] [CrossRef] [PubMed]
- Magadum, S.; Banerjee, U.; Murugan, P.; Gangapur, D.; Ravikesavan, R. Gene duplication as a major force in evolution. J. Genet. 2013, 92, 155–161. [Google Scholar] [CrossRef] [PubMed]
- Huang, J.; Zhao, Y.; Bai, D.; Shiraigol, W.; Li, B.; Yang, L.; Wu, J.; Bao, W.; Ren, X.; Jin, B.; et al. Donkey genome and insight into the imprinting of fast karyotype evolution. Sci. Rep. 2015, 5, 14106. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Rehman, M.S.-U.; Hassan, F.-U.; Rehman, Z.-U.; Ishtiaq, I.; Rehman, S.U.; Liu, Q. Molecular characterization of TGF-beta gene family in buffalo to identify gene duplication and functional mutations. Genes 2022, 13, 1302. [Google Scholar] [CrossRef] [PubMed]
- Conant, G.C.; Wolfe, K.H. Turning a hobby into a job: How duplicated genes find new functions. Nat. Rev. Genet. 2008, 9, 938–950. [Google Scholar] [CrossRef] [PubMed]
- Steiner, C.C.; Ryder, O.A. Molecular phylogeny and evolution of the Perissodactyla. Zool. J. Linn. Soc. 2011, 163, 1289–1303. [Google Scholar] [CrossRef]
- Otsuka, F.; McTavish, K.J.; Shimasaki, S. Integral role of GDF-9 and BMP-15 in ovarian function. Mol. Reprod. Dev. 2011, 78, 9–21. [Google Scholar] [PubMed]
- Belli, M.; Shimasaki, S. Molecular aspects and clinical relevance of GDF9 and BMP15 in ovarian function. Vitam. Horm. 2018, 107, 317–348. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Deng, C.-X. Roles of FGF signaling in skeletal development and human genetic diseases. Front. Biosci. 2005, 10, 1961–1976. [Google Scholar] [CrossRef] [PubMed]
- Fountas, S.; Petinaki, E.; Bolaris, S.; Kargakou, M.; Dafopoulos, S.; Zikopoulos, A.; Moustakli, E.; Sotiriou, S.; Dafopoulos, K. The Roles of GDF-9, BMP-15, BMP-4 and EMMPRIN in Folliculogenesis and In Vitro Fertilization. J. Clin. Med. 2024, 13, 3775. [Google Scholar] [CrossRef] [PubMed]
- Asghari, R.; Shokri-Asl, V.; Rezaei, H.; Tavallaie, M.; Khafaei, M.; Abdolmaleki, A.; Seghinsara, A.M. Alteration of TGFB1, GDF9, and BMPR2 Gene Expression in Preantral Follicles of an Estradiol Valerate-Induced Polycystic Ovary Mouse Model Can Lead to Anovulation, Polycystic Morphology, Obesity, and Absence of Hyperandrogenism. Clin. Exp. Reprod. Med. 2021, 48, 245–254. [Google Scholar] [CrossRef] [PubMed]
- Settle, S.H., Jr.; Rountree, R.B.; Sinha, A.; Thacker, A.; Higgins, K.; Kingsley, D.M. Multiple joint and skeletal patterning defects caused by single and double mutations in the mouse Gdf6 and Gdf5 genes. Dev. Biol. 2003, 254, 116–130. [Google Scholar] [CrossRef] [PubMed]
- Massagué, J. TGFβ signalling in context. Nat. Rev. Mol. Cell Biol. 2012, 13, 616–630. [Google Scholar] [CrossRef] [PubMed]
- Carmona Dinau, F.; González-Zambrano, C.M.; Jurado Jimenez, J.; Montoya Florez, L.M.; Oliveira, R.; Sousa Rocha, N. Exploring the dynamics of IL-6, TGF-β1, and CD8+ T cells in the canine transmissible venereal tumor: New perspectives. Pak. Vet. J. 2025, 45, 375–381. [Google Scholar] [CrossRef] [PubMed]
- Sanfins, A.; Rodrigues, P.; Albertini, D.F. GDF-9 and BMP-15 Direct the Follicle Symphony. J. Assist. Reprod. Genet. 2018, 35, 1741–1750. [Google Scholar] [CrossRef] [PubMed]





| Gene Pairs | Chromosome | Duplication | Ka | Ks | Ka/Ks | MYA |
|---|---|---|---|---|---|---|
| GDF2/BMP10 | ch2/12 | SD | 0.52 | 1.90 | 0.28 | 146.2 |
| GDF1/GDF3 | ch10/22 | SD | 0.66 | 1.54 | 0.43 | 118.5 |
| GDF5/GDF6 | ch15/12 | SD | 0.42 | 1.06 | 0.40 | 81.5 |
| GREM1/GREM2 | ch2/30 | SD | 0.36 | 0.93 | 0.39 | 71.5 |
| Motif | Sequence | Length | Pfam Domain |
|---|---|---|---|
| 1 | WIIAPKGYEAYYCEGECPFPL | 21 | TGF-beta family profile Transforming growth factor beta-like domain Cystine-knot cytokines TGF-beta family signature |
| 2 | PKPCCVPTKLSPISILYIDENNNVVLKKY | 29 | TGF-beta-like domain TGF-beta family profile Cystine-knot cytokines |
| 3 | KNACRRHPLYVSFKDLGWDD | 20 | TGF-beta family profile Cystine-knot cytokines |
| 4 | ASHLNPTNHAIIQTLVHSMNP | 21 | TGF-beta family profile Consensus disorder prediction |
| 5 | WLTFDVTAAVRRWLLNRQKNLGLRLSV | 27 | TGF-beta propeptide |
| 6 | ETEIYQTVLLRHENILGFIAADIKGTGSWTQLWLITDYHENGSLYDYLK | 49 | TGF-beta receptor type I&II Protein kinase domain profile Phosphorylase Kinase; domain 1 Protein kinase-like (PK-like) |
| 7 | AHRDLKSKNILVKKNGTCCIADLGLAVKFDSDTNEVDIPPNTRVGTKRYM | 50 | TGF-beta receptor type I&II Protein kinase domain profile Transferase (Phosphotransferase) domain 1 Protein kinase domain, Protein kinase-like (PK-like) |
| Sr# | Gene | Chr. | Exon Count | A.A. | MW (Da) | pI | II | Al | GRAVY |
|---|---|---|---|---|---|---|---|---|---|
| 1 | TGFB1 | 26 | 7 | 391 | 44.07 | 8.83 | 46.29 | 89.77 | −0.255 |
| 2 | TGFB2 | 30 | 8 | 442 | 50.52 | 8.74 | 53.00 | 80.52 | −0.396 |
| 3 | TGFB3 | 7 | 7 | 412 | 47.17 | 8.13 | 48.59 | 82.06 | −0.499 |
| 4 | TAB1 | 4 | 11 | 504 | 54.60 | 5.31 | 45.98 | 82.44 | −0.339 |
| 5 | TAB2 | 1 | 9 | 693 | 76.51 | 8.83 | 58.96 | 63.74 | −0.750 |
| 6 | TAB3 | X | 13 | 717 | 79.04 | 8.81 | 78.93 | 57.81 | −0.836 |
| 7 | TGIF1 | 7 | 5 | 272 | 29.62 | 7.64 | 60.43 | 72.13 | −0.489 |
| 8 | TGIF2 | 15 | 5 | 237 | 25.80 | 7.77 | 58.88 | 84.35 | −0.488 |
| 9 | TGFBR1 | 10 | 11 | 499 | 55.53 | 7.51 | 42.82 | 90.90 | −0.083 |
| 10 | TGFBR2 | 21 | 10 | 652 | 73.87 | 5.44 | 44.56 | 78.16 | −0.351 |
| 11 | TGFBR3 | 16 | 17 | 850 | 93.18 | 5.74 | 48.53 | 81.13 | −0.248 |
| 12 | GDF1 | 10 | 2 | 368 | 39.04 | 10.79 | 71.84 | 90.87 | −0.050 |
| 13 | GDF2 | 2 | 2 | 427 | 47.39 | 6.34 | 50.53 | 74.89 | −0.437 |
| 14 | GDF3 | 22 | 2 | 364 | 40.76 | 7.11 | 52.09 | 97.25 | −0.087 |
| 15 | GDF5 | 15 | 2 | 499 | 55.28 | 9.87 | 46.43 | 71.02 | −0.617 |
| 16 | GDF6 | 12 | 2 | 461 | 51.41 | 9.19 | 65.48 | 69.65 | −0.615 |
| 17 | GDF7 | 6 | 2 | 452 | 46.46 | 9.29 | 55.16 | 79.51 | −0.118 |
| 18 | GDF9 | 9 | 2 | 451 | 50.71 | 8.92 | 57.08 | 78.96 | −0.366 |
| 19 | GDF10 | 2 | 2 | 477 | 52.53 | 9.52 | 57.24 | 77.38 | −0.456 |
| 20 | GDF11 | 22 | 2 | 405 | 44.92 | 8.18 | 60.02 | 80.99 | −0.303 |
| 21 | GDF15 | 10 | 2 | 300 | 32.93 | 10.56 | 61.91 | 93.50 | −0.270 |
| 22 | BMP1 | 3 | 22 | 988 | 11.17 | 6.27 | 46.65 | 61.84 | −0.609 |
| 23 | BMP2 | 15 | 3 | 395 | 44.86 | 8.72 | 52.88 | 79.24 | −0.470 |
| 24 | BMP3 | 3 | 3 | 475 | 53.45 | 9.62 | 59.67 | 79.05 | −0.519 |
| 25 | BMP4 | 7 | 4 | 409 | 46.59 | 8.57 | 57.89 | 79.80 | −0.532 |
| 26 | BMP5 | 8 | 7 | 454 | 51.47 | 9.00 | 47.99 | 77.97 | −0.439 |
| 27 | BMP6 | 8 | 7 | 506 | 55.78 | 8.38 | 59.65 | 71.76 | −0.468 |
| 28 | BMP7 | 15 | 8 | 431 | 45.35 | 8.36 | 54.40 | 73.69 | −0.513 |
| 29 | BMP10 | 6 | 2 | 424 | 48.02 | 4.84 | 47.26 | 86.93 | −0.349 |
| 30 | BMP15 | X | 2 | 394 | 45.22 | 9.67 | 52.86 | 96.19 | −0.309 |
| 31 | BMP8A | 5 | 8 | 402 | 36.57 | 8.79 | 66.99 | 79.97 | −0.471 |
| 32 | BMP8B | 5 | 7 | 402 | 60.13 | 7.42 | 45.57 | 87.97 | −0.178 |
| 33a | BMPR1A | 2 | 13 | 532 | 57.24 | 8.23 | 51.15 | 84.04 | −0.327 |
| 33b | BMPR1B | 3 | 24 | 491 | 88.77 | 9.15 | 48.04 | 78.02 | −0.471 |
| 34 | BRINP1 | 10 | 8 | 761 | 88.91 | 8.45 | 50.39 | 85.71 | −0.314 |
| 35 | BRINP2 | 25 | 8 | 783 | 88.18 | 8.06 | 58.97 | 83.26 | −0.335 |
| 36 | BRINP3 | 30 | 10 | 766 | 63.28 | 9.69 | 66.14 | 66.05 | −0.586 |
| 37 | RGMA | 2 | 4 | 455 | 51.98 | 8.35 | 45.50 | 74.46 | −0.299 |
| 38 | RGMB | 9 | 9 | 480 | 53.34 | 8.21 | 45.25 | 72.94 | −0.339 |
| 39 | GREM1 | 2 | 2 | 184 | 20.63 | 9.46 | 62.67 | 60.98 | −0.776 |
| 40 | GREM2 | 30 | 3 | 168 | 19.25 | 9.36 | 55.23 | 77.68 | −0.486 |
| TAB 1 | ||||||||||
| Mutations | MetaSNP | MUPro | PhD-SNP | PROVEN | PolyPhen-2 | SIFT | SNAP | I-Mutant | PANTHER | Overall |
| S260A | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| TAB 2 | ||||||||||
| S337N | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| A348T | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| P353S | NE | DE | NE | NE | BE | NE | DI | DE | NE | SYN |
| A381S | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| TGFBR2 | ||||||||||
| I36M | NE | DE | NE | NE | BE | NA | DI | DE | NA | SYN |
| H81R | NE | DE | NE | NE | BE | NA | NE | DE | NA | SYN |
| GDF1 | ||||||||||
| A259P | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| L184P | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| GDF2 | ||||||||||
| V135I | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| T182A | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| A308V | NE | DE | NE | NE | BE | NE | NE | DE | NA | SYN |
| GDF3 | ||||||||||
| A7V | NE | DE | NE | NE | BE | NE | NE | DE | NA | SYN |
| L13M | NE | DE | NE | NE | BE | DI | NE | DE | NA | SYN |
| GDF6 | ||||||||||
| R73P | DI | DE | NE | NE | BE | NE | DI | DE | NE | NON-SYN |
| L303P | NE | DE | DI | NE | BE | NE | NE | DE | NA | NON-SYN |
| V328A | NE | DE | NE | NE | BE | NE | NE | DE | NA | NON-SYN |
| GDF7 | ||||||||||
| E166D | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| F167S | NE | DE | NE | NE | BE | NE | NE | DE | DI | SYN |
| P296A | NE | DE | NE | NE | BE | NE | NE | DE | NA | SYN |
| GDF9 | ||||||||||
| R87G | DI | DE | DI | NE | BE | DI | DI | DE | NE | NON-SYN |
| T310R | NE | DE | NE | NE | BE | NE | NE | DE | NA | NON-SYN |
| BMP15 | ||||||||||
| F17Y | DI | DE | DI | NE | BE | NE | DI | DE | NE | NON-SYN |
| Y150H | NE | DE | NE | NE | BE | NE | NE | DE | DI | SYN |
| BMP8B | ||||||||||
| S6G | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| V141I | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| R188Q | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| C257R | NE | DE | NE | NE | BE | NE | NE | DE | NA | SYN |
| P288S | NE | DE | NE | NE | BE | NE | NE | DE | NA | SYN |
| BMPR1A | ||||||||||
| S5Y | NE | DE | NE | NE | BE | NE | DI | DE | NA | SYN |
| BMPR1B | ||||||||||
| L462I | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| BRINP2 | ||||||||||
| G367S | NE | DE | NE | NE | BE | NE | NE | DE | NE | SYN |
| RGMA | ||||||||||
| P160S | NE | DE | NE | NE | BE | DI | DI | DE | NA | NON-SYN |
| GDF10 | ||||||||||
| R28Q | DI | DE | DI | NE | BE | NE | DI | DE | NE | NON-SYN |
| A225P | NE | DE | NE | NE | BE | NE | NE | DE | NE | NON-SYN |
| F347L | NE | DE | NE | NE | BE | NE | NE | DE | NA | NON-SYN |
| A348P | NE | DE | DI | NE | BE | NE | NE | DE | NA | NON-SYN |
| Genes | Transcript IDs | Ovary | Uterus | Pineal Gland | Spleen | Blood | Quadriceps Femoris | Longissimus Dorsi |
|---|---|---|---|---|---|---|---|---|
| GDF9 | XM_014856804.3 | 0.932 | 0.296 | 0.546 | 0.162 | 0 | 0.099 | 0 |
| BMP15 | XM_014827162.3 | 6.197 | 0.037 | 0 | 0.086 | 0 | 0.019 | 0.097 |
| BMP4 | XM_014864713.3 | 113.613 | 46.152 | 13.867 | 30.35 | 0.363 | 14.072 | 10.257 |
| BMP7 | XM_014831981.3 | 13.15 | 14.456 | 29.086 | 13.79 | 0.418 | 2.377 | 1.841 |
| BMPR1B | XM_044766344.2 | 1.243 | 8.997 | 50.195 | 3.547 | 0.427 | 3.687 | 2.921 |
| TGFB1 | XM_044746676.2 | 25.771 | 11.338 | 13.867 | 30.35 | 0.363 | 19.954 | 26.793 |
| GDF10 | XM_014841529.3 | 1.366 | 0.229 | 5.02 | 11.017 | 0 | 5.1 | 2.696 |
| TGFB2 | XM_014849872.3 | 15.831 | 14.164 | 14.27 | 17.06 | 0.131 | 9.085 | 9.261 |
| TGFB3 | XM_014840877.3 | 19.474 | 9.276 | 5.317 | 11.76 | 0.785 | 7.789 | 5.245 |
| TGFBR1 | XM_044779147.2 | 30.227 | 18.186 | 23.611 | 7.482 | 43.372 | 8.348 | 9.644 |
| TGFBR2 | XM_044754085.2 | 137.097 | 67.166 | 67.163 | 39.59 | 61.603 | 53.212 | 35.848 |
| BMPR1A | XM_044759872.2 | 28.712 | 25.709 | 15.172 | 22.89 | 1.75 | 19.576 | 24.253 |
| RGMA | XM_014842511.3 | 11.219 | 7.949 | 3.406 | 11.23 | 0 | 22.316 | 13.281 |
| BMP2 | XM_044766204.2 | 17.381 | 16.869 | 10.472 | 5.585 | 40.005 | 5.471 | 5.418 |
| GDF11 | XM_014857093.3 | 13.268 | 27.791 | 18.021 | 3.403 | 1.011 | 3.623 | 8.502 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2026 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license.
Share and Cite
Nasir, T.; Tariq, M.; Tharwat, M.; Safdar, M.; Junejo, Y.; Alshanbari, F.A. Genome-Wide Characterization of the TGF-β Gene Family in Donkey (Equus asinus) Reveals Lineage-Specific Gene Duplications and Deleterious Mutations. Animals 2026, 16, 2028. https://doi.org/10.3390/ani16132028
Nasir T, Tariq M, Tharwat M, Safdar M, Junejo Y, Alshanbari FA. Genome-Wide Characterization of the TGF-β Gene Family in Donkey (Equus asinus) Reveals Lineage-Specific Gene Duplications and Deleterious Mutations. Animals. 2026; 16(13):2028. https://doi.org/10.3390/ani16132028
Chicago/Turabian StyleNasir, Tanveer, Muhammad Tariq, Mohamed Tharwat, Muhammad Safdar, Yasmeen Junejo, and Fahad A. Alshanbari. 2026. "Genome-Wide Characterization of the TGF-β Gene Family in Donkey (Equus asinus) Reveals Lineage-Specific Gene Duplications and Deleterious Mutations" Animals 16, no. 13: 2028. https://doi.org/10.3390/ani16132028
APA StyleNasir, T., Tariq, M., Tharwat, M., Safdar, M., Junejo, Y., & Alshanbari, F. A. (2026). Genome-Wide Characterization of the TGF-β Gene Family in Donkey (Equus asinus) Reveals Lineage-Specific Gene Duplications and Deleterious Mutations. Animals, 16(13), 2028. https://doi.org/10.3390/ani16132028

