Next Article in Journal
Phosphate-Solubilizing Bacteria: Advances in Their Physiology, Molecular Mechanisms and Microbial Community Effects
Next Article in Special Issue
Gastrointestinal and Hepatological Manifestations in Severe Acute Respiratory Syndrome Coronavirus 2 Infection: Results from the Major COVID Hospital in Serbia
Previous Article in Journal
The Hidden World within Plants 2.0
Previous Article in Special Issue
Prevalence of Pneumocystis jirovecii Colonization in Non-Critical Immunocompetent COVID-19 Patients: A Single-Center Prospective Study (JiroCOVID Study)
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Molecular Mimicry between SARS-CoV-2 Proteins and Human Self-Antigens Related with Autoimmune Central Nervous System (CNS) Disorders

by
Elisa Gouvea Gutman
1,2,
Renan Amphilophio Fernandes
1,
Jéssica Vasques Raposo-Vedovi
1,
Andreza Lemos Salvio
1,
Larissa Araujo Duarte
1,2,
Caio Faria Tardim
3,
Vinicius Gabriel Coutinho Costa
4,
Valéria Coelho Santa Rita Pereira
3,
Paulo Roberto Valle Bahia
5,
Marcos Martins da Silva
3,
Fabrícia Lima Fontes-Dantas
6,* and
Soniza Vieira Alves-Leon
1,3,*
1
Translational Neuroscience Laboratory (LabNet), Biomedical Institute, Federal University of the State of Rio de Janeiro, Rio de Janeiro 20211-030, RJ, Brazil
2
Clinical Medicine Post-Graduation Program, Federal University of Rio de Janeiro, Rio de Janeiro 21941-913, RJ, Brazil
3
Department of Neurology, Clementino Fraga Filho University Hospital, Federal University of Rio de Janeiro, Rio de Janeiro 21941-913, RJ, Brazil
4
Morphological Sciences Post-Graduation Program, Federal University of Rio de Janeiro, Rio de Janeiro 21941-913, RJ, Brazil
5
Department of Radiology, Clementino Fraga Filho University Hospital, Federal University of Rio de Janeiro, Rio de Janeiro 21941-913, RJ, Brazil
6
Department of Pharmacology, Institute of Biology, Rio de Janeiro State University, Rio de Janeiro 20950-000, RJ, Brazil
*
Authors to whom correspondence should be addressed.
Microorganisms 2023, 11(12), 2902; https://doi.org/10.3390/microorganisms11122902
Submission received: 29 September 2023 / Revised: 31 October 2023 / Accepted: 7 November 2023 / Published: 1 December 2023
(This article belongs to the Special Issue SARS-CoV-2/COVID-19 Infection: Molecular and Clinical Aspects)

Abstract

SARS-CoV-2 can trigger autoimmune central nervous system (CNS) diseases in genetically susceptible individuals, a mechanism poorly understood. Molecular mimicry (MM) has been identified in other viral diseases as potential triggers of autoimmune CNS events. This study investigated if MM is the process through which SARS-CoV-2 induces the breakdown of immune tolerance. The frequency of autoimmune CNS disorders was evaluated in a prospective cohort with patients admitted to the COVID-19 Intense Care Unity (ICU) in Rio de Janeiro. Then, an in silico analysis was performed to identify the conserved regions that share a high identity between SARS-CoV-2 antigens and human proteins. The sequences with significant identity and antigenic properties were then assessed for their binding capacity to HLA subtypes. Of the 112 patients included, 3 were classified as having an autoimmune disorder. A total of eleven combinations had significant linear and three-dimensional overlap. NMDAR1, MOG, and MPO were the self-antigens with more significant combinations, followed by GAD65. All sequences presented at least one epitope with strong or intermediate binding capacity to the HLA subtypes selected. This study underscores the possibility that CNS autoimmune attacks observed in COVID-19 patients, including those in our population, could be driven by MM in genetically predisposed individuals.

1. Introduction

The recent emergence of the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) virus, responsible for the disease caused by the coronavirus disease 2019 (COVID-19), has already affected nearly seven hundred million individuals worldwide, with 6,919,573 deaths until September 2023 [1]. As evidenced in recent years, the occurrence of viral epidemics characterized by unpredictable clinical outcomes has been highly frequent on a global scale [2]. Therefore, the end of the public health emergency of international concern declared on 5 May 2023 by the World Health Organization (WHO) does not mean that COVID-19 has ceased to be a serious public health problem. Extensive studies have provided strong evidence of the frequent occurrence of neurological manifestations that resemble clinical patterns seen in autoimmune para- or post-infectious diseases triggered by SARS-CoV-2 [3,4]. This pattern is seen in other viral infections, such as Zika and Chikungunya infection [5,6,7]. Moreover, the hypothesis that viral infections can act as triggers for the development of autoimmune diseases is not a new one [8]. Due to the association between infection with other coronaviruses and autoimmunity, it is reasonable to assume that there is a connection between SARS-CoV-2 infection and certain autoimmune diseases that will be diagnosed later [9,10,11].
It is already well discussed in the literature that viral diseases have been identified as potential triggers of inflammatory demyelinating diseases (IDDs) and autoimmune encephalitis (AE) [12,13]. Numerous demyelinating disorders such as multiple sclerosis (MS), neuromyelitis optica spectrum diseases (NMOSDs), acute disseminated encephalomyelitis (ADEM), myelitis, and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD) have been described as post and para-infectious complications of COVID-19 [6], with the most common forms of AE following SARS-CoV-2 infection being limbic encephalitis and Anti-N-methyl-D-aspartate receptor (anti-NMDAR) encephalitis [14]. Important studies have identified the presence of autoantibodies anti-glutamic acid decarboxylase 65-kilodalton isoform (anti-GAD65) [15], anti-myelin oligodendrocyte glycoprotein (anti-MOG), and others [16,17,18,19].
Several hypotheses have been proposed to explain the molecular basis of the loss of immune tolerance and induction of autoimmune mechanisms, including hyperinflammation syndrome caused by SARS-CoV-2, molecular mimicry (MM) by viral proteins, immune cell activation through bystander effect, the release of autoantigens from virus-damaged tissues, lymphocyte activation mediated by superantigens, and epitope spreading [20,21,22,23]. Some recent studies on MM have shown similarities between SARS-CoV-2 protein sequences and human proteins found in multiple organs/tissues (neurological, vascular, and cardiac), indicating the potential for cross-reactive immune recognition of these regions by T cells and antibodies produced by B cells [20,21,24,25]. However, the true spectrum of autoimmune conditions, their pathophysiology, prevalence, and the risk of their development in individuals after SARS-CoV-2 infection remain unknown, representing just the tip of the iceberg.
In this study, we intend to investigate the potential role of MM between SARS-CoV-2 antigens and human autoantigens of CNS autoimmune diseases.

2. Materials and Methods

2.1. Study Population

A prospective cohort study was performed with patients admitted to the COVID-19 Intense Care Unity (ICU) of Clementino Fraga Filho University Hospital in Rio de Janeiro, RJ, Brazil. This work was approved by the National Council for Ethics in Research (CAAE 33659620.1.1001.5258) and accompanied afterward on the post-COVID ambulatory of the same hospital. All subjects signed an informed consent agreeing to participate in this research. From 2020 to 2022, COVID-19 patients were evaluated with complete physical and neurological examinations and searched for CNS autoimmune diseases. They were also actively asked for long COVID symptoms, with a focus on cognitive impairment. In addition, all patients were assessed for objective alterations with the following neurocognitive battery tests: the Symbol Digit Modalities Test (SDMT) and Montreal Cognitive Assessment (MoCA). Patients with previously known CNS autoimmune diseases or neurocognitive disturbances were excluded from the study.

2.2. Linear Sequence Analysis

Peptide sharing between SARS-CoV-2 antigens and autoantigens was analyzed in accordance with França et al. (2023) [26]. Briefly, a viral polyprotein library was constructed using the major viral antigens reported in the literature and protein sequences available in the National Center for Biotechnology Information (NCBI) Protein Reference Sequences https://www.ncbi.nlm.nih.gov/protein (accessed on 19 January 2023) (Table 1). An extended research study was conducted to build an autoantigen library from the UniProtKB Database Release 2023_01 www.uniprot.org/ (accessed on 19 January 2023) based on results from PubMed [20,24,25] of autoantigen related to demyelinating brain diseases and autoimmune encephalitis (Table 2).
The sequence alignment was performed using EMBOSS WATER https://www.ebi.ac.uk/Tools/psa/emboss_water/ (accessed on 21 January 2023), an online server that uses the Smith–Waterman algorithm (modified for speed enhancements) to calculate the local alignment of two sequences, narrowing down the regions with more identity [27]. The chosen regions were analyzed for linear homology between the identified human proteins to SARS-CoV-2 proteins using BLAST+ 2.13.0 - BLASTp https://blast.ncbi.nlm.nih.gov/Blast.cgi (accessed on 21 January 2023) [28]. We used the default BLASTp algorithm parameters to consider a significant result [29].

2.3. Three-Dimensional Comparative Modelling

The combinations that shared significant linear identity according to BLASTp were then investigated for three-dimensional similarities. The three-dimensional models were built using the Swiss Model, an online modeling server https://swissmodel.expasy.org/ (accessed on 23 January 2023). The template modeling scores (TM-scores) and root mean square deviation (RMSD) of the SARS-CoV-2 antigens and autoantigens three-dimensional overlap were calculated using TM-Align Version 20140601 https://seq2fun.dcmb.med.umich.edu//TM-align/ (accessed on 21 January 2023), an algorithm for sequence-independent protein structure comparisons. TM-align first generates optimized residue-to-residue alignment based on structural identity using heuristic dynamic programming iterations. The TM-score value scales the structural identity varying from 0.0 to 1.0, where scores below 0.3 correspond to randomly chosen unrelated proteins, while those higher than 0.5 assume generally the same fold between two structures, based on the Protein Data Bank (PDB) [30]. The RMSD considers the root-mean-square distance between corresponding residues and is calculated after an optimal rotation of one structure to another.

2.4. Antigenic Prediction

To confirm whether the SARS-CoV-2 sequences studied have antigenic properties, VaxiJen version 2.0 http://www.ddgpharmfac.net/vaxijen/VaxiJen/VaxiJen.html (accessed on 3 August 2023), was used. A threshold antigenic score of 0.4 was defined to filter probable non-antigenic sequences. The Vaxijen server performs alignment-independent prediction, which is based on auto cross-covariance transformation of protein sequences into uniform vectors of principal amino acid properties.

2.5. Search for Potential T Cell Epitopes

The sequences with significant TM-Score and antigenic properties were used as the input in a neural network–based algorithm to predict T cell epitopes showing binding capacity to human leukocyte antigen (HLA) subtypes using the Immune Epitope Database and Analysis (IEDB) Major Histocompatibility Complex-I (MHC-I) Binding Predictions http://tools.iedb.org/mhci/ (accessed on 6 September 2023), and Major Histocompatibility Complex-II (MHC-II) Binding Predictions http://tools.iedb.org/mhcii/ (accessed on 6 September 2023) resource. This approach enabled the distinction of T cell epitopes recognized by HLA. As HLAs exhibit high polymorphism, we chose HLA variants from MHC-I and MHC-II, with known associations with CNS autoimmune diseases. The representatives used were HLA-I A*31:01, HLA-I B*07:02, HLA-II DRB1*1501, HLA-II DQA1*0102-HLA-II DQB1*0602, and HLA-II DRB1∗03:01.
The prediction method used was the stabilization matrix alignment method (SMM-align) version 1.1. The predicted output is given in units of half maximal inhibitory concentration (IC50nM). Therefore, a lower number indicates higher affinity. As a rough guideline, peptides with IC50 values <50 nM are considered high affinity, <500 nM intermediate affinity, and <5000 nM low affinity. Since most known epitopes have high or intermediate affinity, we only considered a noteworthy result for the epitopes with <500 nM [31].

3. Results

3.1. Study Population

A total of 112 patients were evaluated. The mean age was 65.95 (17–95), and 58 (51.78%) were women. Among them, three were classified as having IDD. As our population consisted mainly of patients from the first and second wave of the COVID-19 pandemic, and all of them were hospitalized in the ICU, 51 (45.53%) patients progressed to death during or nearly after the hospitalization. The patients with IDD survived and remained with controlled disease for one year after the episodes. Among the survivors, 32 patients (52.45%) presented cognitive complaints during long COVID. Regarding the neurocognitive battery, 15 (24.59%) patients had cognitive impairment according to the 2 test results, while 20 had alteration only in SDMT and 33 had alteration only in MoCA.

3.1.1. Patient 1

Patient 1, male, 24 years old, with a history of IDD in the family (mother diagnosed with MS) was admitted to the hospital presenting paresthesia in the upper and lower limbs on the left side. The Magnetic Resonance Imaging (MRI) showed two white-matter lesions hyperintense in T2 and fluid-attenuated inversion recovery (FLAIR) with gadolinium enhancement, one on the periventricular region and one on the medullary bulb transition (Figure 1). The cerebrospinal fluid (CSF) exam was negative for infections, including SARS-CoV-2, and showed oligoclonal bands with normal cell and protein count. Serum research was positive for anti-MOG antibodies through flow cytometry and negative for anti-AQP4 antibodies. Screening for metabolic and other autoimmune diseases was negative. Although asymptomatic, as part of the hospital protocol, he was tested for COVID-19 with a Polymerase Chain Reaction (PCR) test, which was positive. He was treated with intravenous glucocorticoids, evolving with complete recovery. On the long COVID assessment, he presented new symptoms and new lesions on the MRI, being diagnosed with MOGAD.

3.1.2. Patient 2

Patient 2, female, 19 years old, evolved 20 days after SARS-CoV-2 m-RNA vaccination with subacute paresthesia in hands and feet, followed by urinary incontinence, visual disturbance, mental confusion, appendicular ataxia, progressive tetraparesis, and coma within days. Her Expanded Disability Status Scale (EDSS) during the acute state was 9.5. The MRI showed countless white-matter lesions hyperintense in T2/FLAIR, several with gadolinium enhancement (Figure 2). CSF exam was positive for oligoclonal bands, and negative for infections, including SARS-CoV-2. Screening for autoimmune diseases, including MOG and AQP4 antibodies, and metabolic diseases were negative. First, she received a diagnosis of ADEM following COVID-19 vaccination and was treated with pulse therapy with glucocorticoids, partially recovering from the attack. Nonetheless, after 6 months she once again evolved with a new aggressive demyelinating event, being diagnosed with MS and treated with natalizumab. The patient stabilized with the treatment, and, after a year, she recovered nearly a hundred percent (EDSS 3.0).

3.1.3. Patient 3

Patient 3, female, 39 years old, with a history of psoriasis, spontaneous miscarriages, and reducing gastroplasty was admitted due to paresthesia in the right hemiface and left lower limb, as well as deviation of the labial commissure, right auricular fullness, vertigo, and headache. A diagnostic investigation with complementary tests was initiated. Eighteen days before, she had COVID-19 confirmed with PCR, with headache, cough, and sore throat. The MRI showed hyperintense T2/FLAIR oval white-matter lesions on the right cortex, periventricular region, and brainstem. (Figure 3). The CSF exam was positive for oligoclonal bands, and negative for infections, including SARS-CoV-2 and autoantibodies. Screening for autoimmune diseases, including MOG and AQP4 antibodies, and metabolic diseases were negative. At first, she was diagnosed with ADEM following SARS-CoV-2 infection. Nonetheless, three months later, she evolved with new focal symptoms and new lesions on the MRI, with gadolinium enhancement. Therefore, she was diagnosed with MS and treated with dimethyl fumarate. The disease stabilized and she stayed asymptomatic since then.

3.2. Sequence Identification

The extended literature research led to the selection of eight viral proteins and ten self-proteins associated with CNS demyelinating diseases and autoimmune encephalitis, listed as follows:
SARS-CoV-2 proteins: spike protein (S), envelope protein (E), leader protein/non-structural protein 1 (Nsp1), non-structural protein 2 (Nsp2), non-structural protein 3 (Nsp3), non-structural protein 13/helicase (Nsp13), ORF7a, and nucleocapsid (N) (Table 1).
Self-proteins: glutamic acid decarboxylase 65-kilodalton isoform (GAD65), myelin proteolipid protein (PLP), myelin basic protein (MBP), myelin-oligodendrocyte glycoprotein (MOG), myelin-associated glycoprotein (MAG), myelin-associated oligodendrocyte basic protein (MOBP), transaldolase, 2’,3’-Cyclic-nucleotide 3’-phosphodiesterase (CNP), aquaporin-4 (AQP4), N-methyl-D-aspartate receptor 1 (NMDAR1), and myeloperoxidase (MPO) (Table 2).
The FASTA archive of all proteins can be found in the Supplementary Materials.

3.3. Linear and Three-Dimensional Analysis

A total of 80 possible arrangements were made through the bioinformatics approach to identify the sequences that shared linear and three-dimensional identity with human autoantigens of demyelinating brain diseases and autoimmune encephalitis.
The resulting arrangements were ranked based on the highest TM-scores, excluding randomly arranged and unrelated proteins (TM-score < 0.3), leaving 29 arrangements (Table 3). It is noteworthy that we only considered the SARS-CoV-2 sequences with reported linear identity on BLASTp meaningful, varying from 62.50% to 100% of identity, with significant E-score and antigenic properties according to VaxiJen (threshold antigenic score of 0.4).
Among these arrangements, eleven three-dimensional models had a significant linear and three-dimensional overlap of autoimmune CNS proteins and SARS-CoV-2 proteins (TM-score ≥ 0.5). The most similar structures were M and NMDAR1 (TM-score: 0.89), M and MPO (TM-Score = 0.73), nsp2 and NMDAR1 (TM-score = 0.69), S and MOG (TM-score = 0.63), ORF7a and MOG (TM-score = 0.62), N and MPO (TM-score = 0.59), nsp13 and GAD65 (TM-score = 0.52), nsp1 and GAD65 (TM-score = 0.52), nsp1 and MOG (TM-score = 0.50), nsp3 and MPO (TM-score = 0.50), and S and NMDAR1 (TM-score = 0.50) (Figure 1).
NMDAR1, MOG, and MPO were the self-antigens with more significant identity with SARS-CoV-2 antigens, each one with three different proteins. GAD65 also had significant identity with two virus antigens. PLP, MBP, MOBP, MAG, AQP4, and transaldolase demonstrated significant linear identity with at least one virus protein, along with three-dimensional overlap not considered random. Nonetheless, their TM-scores were below 0.5, meaning they are not on the same fold. This means that their MM is possible, yet less achievable in practice.

3.4. Search for Potential T Cell Epitopes

The sequences of the eleven combinations were used as the input in a neural network–based algorithm to predict their binding capacity to HLA subtypes related to autoimmune CNS diseases. All sequences presented at least one epitope with strong or intermediate binding capacity to the chosen HLA subtypes (Table 4). The binding capacity of all 29 arrangements with TM-Score > 0.3 can be seen on the Supplementary Materials of this paper. The arrangements with the strongest binding capacities were seen with the nsp1 and GAD65 epitopes of HLA-A*31:01 (Ic50 31.44 and 27.31, respectively) and with the nsp13 and GAD65 epitopes of HLA-A*31:01 (Ic50 18.72 and 35.44, respectively).
NMDAR1 combinations had the highest number of epitopes with strong or intermediate binding capacity with two combinations binding to all four selected HLA subtypes (nsp2 and NMDAR1, and S and NMDAR1), and the same epitope had identity with different virus antigens (M and nsp2).
Interestingly, different combinations shared the same viral epitope, such as M with NMDAR1 and MPO, and nsp1 with GAD65 and MOG (Table 4). This reinforces the potential of such a region to possibly trigger an unwanted autoimmune response by mimicking distinct self-proteins.

4. Discussion

SARS-CoV-2 is widely studied for the generation of multi-system autoimmune reactions [32]. In this sense, the triggering of CNS autoimmune diseases seems to be a consequence of an imprecise adaptive immune system response to the presence of viral antigens. It is well known that some viruses demonstrated neurotropic features [33,34,35,36] and replication within the brain tissue, as shown by our team with the Zika virus (ZIKV) [33]. However, even ZIKV nervous system manifestation is not always associated with acute infection, and MM seems to justify these events [37,38]. Similarly, in COVID-19, viral load or severe acute infection does not seem to be the only mechanism to justify CNS involvement [39,40]. The occurrence of IDD phenotypes and encephalitis as para or postinfectious events seems to be an immune-mediated response induced by SARS-CoV-2 [41].
A large study from various global health organizations found that the incidence of autoimmune diseases was significantly higher in the COVID-19 cohort compared to the non-COVID-19 group after a 6-month follow-up period [42]. Another similar study identified a 43% higher likelihood of developing an autoimmune disease between 3 to 15 months after infection compared to a non-COVID-19 cohort [43]. Despite the progress made, cases of CNS autoimmunity after COVID-19 are rare and mainly consist of isolated case reports or case series, which provide limited information regarding clinical outcomes [44].
Although the target of such supposed autoimmune mechanisms, precisely regarding the CNS manifestations, is still not fully understood, our findings suggest that cross-reaction with selected CNS proteins associated with autoimmune brain diseases is possible to occur secondary to the immune response to SARS-CoV-2 infection. However, the risk of developing these diseases or experiencing relapses in the setting of COVID-19 remains relatively low [45]. In our cohort, three patients developed IDD following SARS-CoV-2 infection or vaccination. Since the CNS autoimmune manifestations after COVID-19 are rare, it is expected that genetic predisposition plays an essential role in the disease mechanism [46]. Despite the low frequency, the identification of IDD in such circumstances is primordial, taking into consideration the high prevalence of SARS-CoV-2 infection and the possible critical state in which the patients may encounter it. For example, our first patient evolved with EDSS 9.5, a near-death experience in a young individual with no previous comorbidity. Moreover, is important to consider SARS-CoV-2 infection as a possible trigger of IDDs because some patients present demyelinating events as the only symptom of COVID-19, as happened with our second patient.
Molecular mimicry has been described as an essential immune mechanism involved in autoimmune reactions, especially from viruses [8]. The sharing of a linear amino acid sequence or a three-dimensional conformation fit between an antigen of the virus and a host self-protein can trigger a cross-reaction from the adaptive immune system and, therefore, have a major role in initiating an autoimmune response in genetically susceptible individuals [47]. Several researchers have recognized molecular mimicry as a component of COVID-19 pathophysiology [48,49,50]. For example, Lucchese et al. observed that molecular mimicry between SARS-CoV-2 antigens and respiratory pacemaker neurons may contribute to understanding respiratory failure [51]. Hence, MM may be a key component of the immune system dysregulated response in the CNS.
In this study, 80 possible arrangements of identity among SARS-CoV-2 antigens and self-antigens related to autoimmune CNS diseases were made. Among these arrangements, eleven models had a significant linear and three-dimensional overlap of autoimmune CNS proteins and SARS-CoV-2 proteins (TM-score ≥ 0.5). NMDAR1, MOG, and MPO were the self-antigens with more significant identity with SARS-CoV-2 antigens, followed by GAD65. Notably, dysregulated serum levels of autoantibodies NMDAR, GAD65, and MOG were detected in patients with severe COVID-19 compared with healthy controls and mild COVID-19 patients [52].
MS is a classic example of an autoimmune CNS disease characterized by chronic inflammation and demyelination [53]. SARS-CoV-2 most likely acts as a precipitating factor rather than being a direct cause of MS, triggering autoimmunity in genetically predisposed individuals. In our cohort, two patients had SARS-CoV-2-related events (vaccination and infection) as the trigger for MS. Both patients were women; however, their ages, comorbidities, symptoms, and MRI lesions were considerably different, highlighting the importance of genetic predisposal and other environmental factors on the course of the disease [54].
MBP, MOBP, PLP, and MAG are myelin proteins known to be critical autoantigens in causing demyelination in CNS leading to MS [55,56]. In our study, the TM-scores among these proteins and SARS-CoV-2 antigens were low, but not considered randomly arranged, unrelated proteins. This can mean that MM among these MS autoantigens is feasible; however, the evidence is not strong. Nevertheless, MPO, a pro-oxidative enzyme associated with immune-inflammatory, oxidative stress pathways, and cortical demyelination [57], has been gaining acceptance as an important modulator of MS activity [58]. Higher-expressing MPO genotype is overrepresented in early-onset MS in women [44], and immunohistochemical analysis shows that MPO is present in microglia in and around MS lesions [44]. This study found a significant overlap of MPO among three different SARS-CoV-2 antigens (M, N, nsp3). SARS-CoV-2’s ability to mimic MPO seems to provide a greater threat for triggering new-onset MS or worsening of MS symptoms in genetically predisposed patients, as seen during the COVID-19 pandemic [59,60].
MOGAD is an emerging subset of CNS demyelinating disease [61,62], and has also been related to COVID-19 [6]. In our study, one patient evolved with MOGAD during an asymptomatic SARS-CoV-2 infection. In addition, our in-silico analysis showed that MOG shared significant linear and three-dimensional identity with three different virus antigens (S, ORF7a, and nsp1), having the most prominent overlap with the S protein. This finding agrees with recent literature, which identified anti-MOG antibodies in the acute and post-infectious phase of SARS-CoV-2 infection and COVID-19 vaccination [63,64]. Moreover, the literature has shown that diseases associated with anti-MOG almost tripled during the COVID-19 pandemic [65].
Our study highlights that NMDAR1 has three domains with significant linear and three-dimensional identity with SARS-CoV-2 antigens, including the spike protein, and all of them have the binding capacity to T-cells to be considered epitopes. It has been proposed that SARS-CoV-2’s molecular mimicry may induce anti-NMDAR encephalitis after COVID-19 [66]. This may be a key mechanism beneath CNS manifestations of COVID-19 disease and vaccination associated with anti-NMDAR antibodies [14,67].
Moreover, GAD65 had the strongest binding capacity to HLA in this work, with two different combinations of mimicry. Cases of autoimmune encephalitis associated with GAD65 have been described following SARS-CoV-2 infection [15,68]. This finding reinforces the association of SARS-CoV-2 MM and the clinical findings related to anti-GAD65 antibody.
A growing body of evidence has demonstrated the relationship between ADEM and SARS-CoV-2 infection [69]. ADEM following SARS-CoV-2 infection and vaccination have been associated with MOG [70,71,72,73] and NMDAR [74] antibodies. Interestingly, in our study, both MOG and NMDAR are associated with S protein, the most common antigen presented in SARS-CoV-2 vaccination, which may indicate the relevance of MM in post-COVID ADEM manifestations.
In this cohort, 52.45% of the COVID-19 ICU patients presented cognitive impairment during the post-acute phase of COVID-19. Notably, NMDAR, GAD65, and MPO may be involved not only in acute encephalitis or demyelinating events but also in neurocognitive and psychiatric manifestations, frequently seen in long COVID patients [66,75,76,77]. Pathological results in cognitive screening were associated with the presence of antibodies against NMDAR and GAD65 in CSF of long COVID patients [78]. The MM between these autoantibodies and SARS-CoV-2 antigens may be a prominent asset to understanding the pathogenesis of long COVID cognitive and psychiatric symptoms.
The putative epitopes of SARS-CoV-2 that form MM are rich in alanine (Ala) and leucine (Leu) (Table 4), considerably responsible for the loop conformation seen in Figure 4 [79]. Notably, an increase in Ala has been associated with several neurological diseases such as MS, Guillain–Barré syndrome, and motor neuron disease [80]. The peptide that corresponds to the glycine/alanine repeat sequence of Epstein–Barr virus nuclear antigen-1, named P62, has been found to generate cross-reactive autoantibodies in MS patients [81] and other autoimmune diseases [82,83]. Similarly, the presence of Leu on the V3 loop region of the envelope gene of HIV-infected patients was associated with dementia [84]. Also, Leu mutations in the dengue type 4 virus envelope sequence were determinants of neurovirulence in mice [85].
Genetic susceptibility seems to explain the heterogeneity of response to immune tolerance breakdown and molecular mimicry between autoantigens and viral proteins [47]. Due to the limited knowledge about genetic susceptibility to explain mechanisms involved in the pathophysiology of AE, we chose HLA variants with known associations with CNS autoimmune diseases [56,78,79,80,81,82]. Interestingly enough, all eleven combinations with significant linear and three-dimensional identity presented at least one epitope with strong or intermediate binding capacity to the chosen HLA subtypes. In this manner, the investigation of the connection between HLA alleles related to CNS autoimmune diseases and the MM found in this paper can strengthen the results and possibly help elucidate the pathophysiology of these manifestations.
It is worth highlighting the results regarding the S protein. The spike, or its fragments, has the ability to cross the blood-brain barrier (BBB), irrespective of the presence of the viral RNA [83]. Furthermore, some cases have reported an association between CNS demyelination events and the use of vaccines with the S protein as the main antigen for the generation of immunological memory, which has become a major concern for health authorities worldwide [84]. Thus, the MM regarding S may be more common than the others described in this article. Indeed, both MOG and NMDAR1, which presented significant linear and three-dimensional overlap with spike, have been associated with COVID-19 in a more expressive way than the other autoimmune affection [14,65,66] and have been related to COVID-19 vaccination [67,85,86,87]. One of our patients triggered IDD following COVID-19 vaccination. Although is not possible to affirm causality, MM must be considered as a possible mechanism for this phenomenon.
As a limitation of this study, it is important to mention that it is a theoretical work; however, it is based on our cohort findings and recent literature studies regarding SARS-CoV-2. In addition, it uses validated software to give results as close as possible to reality. Additionally, the study used a limited number of HLA alleles in the prediction of T-cell binding capacity (only the most common HLA alleles in the literature associated with CNS autoimmune diseases) in order to increase the specificity of the results. Thereby, it is possible that some epitopes of rarer HLAs were not included in this study. Further studies are needed to validate the in-silico work described here, as well as to understand the probable genetic susceptibility some individuals have that causes the development of such manifestations.

5. Conclusions

The presented study proposes a demonstration of possible molecular mimicry between SARS-CoV-2 antigens and CNS autoimmune self-antigens, especially MOG, NMDAR1, GAD65, and MPO, in genetically susceptible individuals. The results agree with our cohort, with three cases of IDD, and with the most recent literature. Therefore, advancing our understanding of the key mechanisms of SARS-CoV-2-mediated autoimmunity is urgent.

Supplementary Materials

The following supporting information can be downloaded at https://www.mdpi.com/article/10.3390/microorganisms11122902/s1, Supplementary Materials: Table 1, Table 2, Table 3 and Table 4, along with the FASTA archive of all proteins analyzed and the binding capacity of all 29 arrangements with TM-Score > 0.3 can be seen on the Supplementary Materials of this paper.

Author Contributions

Conceptualization, E.G.G., S.V.A.-L., M.M.d.S. and F.L.F.-D.; methodology, E.G.G., F.L.F.-D., P.R.V.B., J.V.R.-V. and R.A.F.; software, E.G.G. and F.L.F.-D.; validation, A.L.S., R.A.F., P.R.V.B., J.V.R.-V., C.F.T., V.G.C.C., V.C.S.R.P., M.M.d.S. and F.L.F.-D.; formal analysis, E.G.G.; investigation, E.G.G., A.L.S., L.A.D., S.V.A.-L., P.R.V.B., C.F.T., V.G.C.C., V.C.S.R.P., M.M.d.S. and J.V.R.-V.; resources, S.V.A.-L. and P.R.V.B.; data curation, A.L.S., E.G.G., R.A.F., L.A.D., F.L.F.-D., P.R.V.B., J.V.R.-V., C.F.T., V.G.C.C., V.C.S.R.P., M.M.d.S. and S.V.A.-L.; writing—original draft preparation, E.G.G.; writing—review and editing, A.L.S., R.A.F., S.V.A.-L., P.R.V.B., F.L.F.-D. and J.V.R.-V.; visualization, E.G.G., L.A.D., A.L.S., R.A.F., F.L.F.-D., P.R.V.B., J.V.R.-V., C.F.T., V.G.C.C., V.C.S.R.P., M.M.d.S. and S.V.A.-L.; supervision, F.L.F.-D., P.R.V.B., M.M.d.S. and S.V.A.-L.; project administration, S.V.A.-L.; funding acquisition, S.V.A.-L. All authors have read and agreed to the published version of the manuscript.

Funding

This study was funded by Fundação de Amparo à Pesquisa do Estado do Rio de Janeiro (FAPERJ), grant numbers E26/210.254/2020, E-26/210.657/2021, E-26/210.273/2018, E-26/201.040/2021, E-26/200.733/2021, E26/2006.022/2022 and E-26/201.406/2021; by Financiadora de Estudos e Projetos (FINEP), and by the FIOCRUZ Ministry of Health/INOVA Program, grant number VPPCB-005-FIO-20-2-56.

Data Availability Statement

The results presented in this article are supported by data in other articles published in MDPI journals. The clinical profile and risk factors for severe COVID-19 in our cohort of hospitalized patients comparing the first and second pandemic waves were published in the Journal of Clinical Medicine in 2023, under the [88]. Disease severity was associated with older age, pre-existing neurological comorbidities, higher viral load, and dyspnea. Laboratory biomarkers related to white blood cells, coagulation, cellular injury, inflammation, and renal and liver injuries were significantly associated with severe COVID-19. During the second wave of the pandemic, the necessity of invasive respiratory support was higher, and more individuals with COVID-19 developed acute hepatitis, suggesting that the progression of the second wave resulted in an increase in severe cases. We used transcriptome analysis of these patients to understand key genes and cellular mechanisms that are most affected by the severe outcome of COVID-19. Transcriptomic analysis revealed 1009 up-regulated and 501 down-regulated genes in the SARS group, with 10% of both being composed of long non-coding RNA. Ribosome and cell cycle pathways were enriched among down-regulated genes. The most connected proteins among the differentially expressed genes involved transport dysregulation, proteasome degradation, interferon response, cytokinesis failure, and host translation inhibition. Furthermore, interactome analysis showed fibrillarin to be one of the key genes affected by SARS-CoV-2. This protein interacts directly with the N protein and long non-coding RNAs affecting transcription, translation, and ribosomal processes. This work was published in the International Journal of Molecular Sciences in 2022, under the [38]. We also published a study that aimed to establish a relationship between miRNA and neurological manifestations in our cohort of COVID-19 patients co-infected with HHV-6 and evaluate miRNAs as potential biomarkers. miRNA analysis by real-time polymerase chain reaction (qPCR) revealed miRNAs associated with neuroinflammation were highly expressed in patients with neurological disorders and HHV-6 detection. When compared with the group of patients without detection of HHV DNA and without neurological alterations, the group with detection of HHV-6 DNA and neurological alteration displayed significant differences in the expression of mir-21, mir-146a, miR-155, and miR-let-7b (p < 0.01). This work was published in the International Journal of Molecular Sciences in 2023, under the [89]. One of our authors (Salvio, AL) also analyzed the effectiveness of household disinfection techniques to remove SARS-CoV-2 from cloth masks. The study showed that all biocidal treatments successfully disinfected the tissue tested. This work was published in Pathogens in 2022, under the [90].

Conflicts of Interest

The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript; or in the decision to publish the results.

Abbreviations

ADEMAcute disseminated encephalomyelitis
AEAutoimmune encephalitis
AlaAlanine
AQP4Aquaporin-4
anti-GAD65Anti-glutamic acid decarboxylase 65-kilodalton isoform
anti-MOGAnti-myelin oligodendrocyte glycoprotein
anti-NMDARAnti- N-methyl-D-aspartate receptor
CNP2’,3’-Cyclic-nucleotide 3’-phosphodiesterase
COVID-19Coronavirus disease 2019
EEnvelope protein
EDSSExpanded Disability Status Scale
FLAIRFluid-attenuated inversion recovery
GAD65Glutamic acid decarboxylase 65-kilodalton isoform
HLAHuman leukocyte antigen
IC50nMHalf maximal inhibitory concentration
ICUIntense care unit
IDDsInflammatory demyelinating diseases
IEDBImmune Epitope Database and Analysis
LeuLeucine
MAG
Myelin-associated Glycoprotein
MBPMyelin basic protein
MHC-IMajor histocompatibility complex-I
MHC-IIMajor histocompatibility complex-II
MMMolecular mimicry
MOBPMyelin-associated oligodendrocyte basic protein
MoCAMontreal Cognitive Assessment
MOG
Myelin-oligodendrocyte Glycoprotein
MOGADMyelin oligodendrocyte glycoprotein antibody-associated Disease
MPOMyeloperoxidase
MRIMagnetic resonance imaging
MSMultiple sclerosis
NNucleocapsid
NCBINational Center for Biotechnology Information
NMDAR1N-methyl-D-aspartate receptor 1
NMOSDNeuromyelitis optica spectrum diseases
Nsp1Non-structural protein 1
Nsp2Non-structural protein 2
Nsp3Non-structural protein 3
Nsp13Non-structural protein 13
PCRPolymerase chain reaction
PDBProtein data bank
PLPMyelin proteolipid protein
RMSDRoot mean square deviation
SSpike protein
SARS-CoV-2Severe acute respiratory syndrome coronavirus 2
SDMTSymbol Digit Modalities Test
SMM-alignStabilization matrix alignment method
TM-scoresTemplate modeling scores
WHOWorld Health Organization
ZIKVZika virus

References

  1. COVID-19 Coronavirus Pandemic. Available online: https://www.worldometers.info/coronavirus/ (accessed on 6 September 2023).
  2. Nii-Trebi, N.I. Emerging and Neglected Infectious Diseases: Insights, Advances, and Challenges. Biomed. Res. Int. 2017, 2017, 5245021. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Alves-Leon, S.V.; da Rocha Lima, M.; Nunes, P.C.G.; Chimelli, L.M.C.; Rabelo, K.; Nogueira, R.M.R.; de Bruyc-ker-Nogueira, F.; de Azeredo, E.L.; Bahia, P.R.; Rueda Lopes, F.C.; et al. Zika virus found in brain tissue of a multiple sclerosis patient undergoing an acute disseminated encephalomyelitis-like episode. Mult. Scler. J. 2019, 25, 427–430. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Rueda-Lopes, F.C.; da Cruz, L.C.H.; Fontes, F.L.; Herlinger, A.L.; da Costa Ferreira Junior, O.; de Aguiar, R.S.; Vasconcelos, C.C.F.; do Nascimento, O.J.M.; Alves-Leon, S.V. Clinical and magnetic resonance imaging patterns of extensive Chikungunya virus–associated myelitis. J. Neurovirol. 2021, 27, 616–625. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Alves-Leon, S.V.; dos Santos Ferreira, C.; Herlinger, A.L.; Fontes-Dantas, F.L.; Rueda-Lopes, F.C.; da Silva Francisco, R.; da Costa Gonçalves, J.P.; de Araújo, A.D.; da Silva Rêgo, C.C.; Higa, L.M.; et al. Exome-Wide Search for Genes Associated with Central Nervous System Inflammatory Demyelinating Diseases Following CHIKV Infection: The Tip of the Iceberg. Front. Genet. 2021, 12, 639364. [Google Scholar] [CrossRef] [Scilit]
  6. Feizi, P.; Sharma, K.; Pasham, S.R.; Nirwan, L.; Joseph, J.; Jaiswal, S.; Sriwastava, S. Central nervous system (CNS) inflammatory demyelinating diseases (IDDs) associated with COVID-19: A case series and review. J. Neuroimmunol. 2022, 371, 577939. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Toscano, G.; Palmerini, F.; Ravaglia, S.; Ruiz, L.; Invernizzi, P.; Cuzzoni, M.G.; Franciotta, D.; Baldanti, F.; Daturi, R.; Postorino, P.; et al. Guillain–Barré Syndrome Associated with SARS-CoV-2. N. Engl. J. Med. 2020, 382, 2574–2576. [Google Scholar] [CrossRef] [Scilit]
  8. Oldstone, M.B.A. Molecular mimicry and immune-mediated diseases. FASEB J. 1998, 12, 1255–1265. [Google Scholar] [CrossRef] [Scilit]
  9. Lima, M.; Aloizou, A.-M.; Siokas, V.; Bakirtzis, C.; Liampas, I.; Tsouris, Z.; Bogdanos, D.P.; Baloyannis, S.J.; Dardiotis, E. Coronaviruses and their relationship with multiple sclerosis: Is the prevalence of multiple sclerosis going to increase after the COVID-19 pandemia? Rev. Neurosci. 2022, 33, 703–720. [Google Scholar] [CrossRef] [Scilit]
  10. Gerdes, J.C.; Klein, I.; DeVald, B.L.; Burks, J.S. Coronavirus isolates SK and SD from multiple sclerosis patients are serologically related to murine coronaviruses A59 and JHM and human coronavirus OC43, but not to human coronavirus 229E. J. Virol. 1981, 38, 231–238. [Google Scholar] [CrossRef] [Scilit]
  11. Moody, R.; Wilson, K.; Flanagan, K.L.; Jaworowski, A.; Plebanski, M. Adaptive Immunity and the Risk of Autoreactivity in COVID-19. Int. J. Mol. Sci. 2021, 22, 8965. [Google Scholar] [CrossRef] [Scilit]
  12. Hammer, C.; Stepniak, B.; Schneider, A.; Papiol, S.; Tantra, M.; Begemann, M.; Sirén, A.-L.; Pardo, L.A.; Sper-ling, S.; Mohd Jofrry, S.; et al. Neuropsychiatric disease relevance of circulating anti-NMDA receptor autoantibodies depends on blood–brain barrier integrity. Mol. Psychiatry 2014, 19, 1143–1149. [Google Scholar] [CrossRef] [Scilit]
  13. Prüss, H. Autoantibodies in neurological disease. Nat. Rev. Immunol. 2021, 21, 798–813. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Wang, H. COVID−19, Anti-NMDA Receptor Encephalitis and MicroRNA. Front. Immunol. 2022, 13, 825103. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Salari, M.; Harofteh, B.Z.; Etemadifar, M. Autoimmune meningoencephalitis associated with anti-glutamic acid decarboxylase antibody following COVID-19 infection: A case report. Clin. Case Rep. 2022, 10, e6597. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Ayuso, L.L.; Rubio, P.T.; Rosário, R.F.B.D.; Arroyo, M.L.G.; Sierra-Hidalgo, F. Bickerstaff encephalitis after COVID-19. J. Neurol. 2021, 268, 2035–2037. [Google Scholar] [CrossRef] [Scilit]
  17. Gaughan, M.; Connolly, S.; O’Riordan, S.; Tubridy, N.; McGuigan, C.; Kinsella, J.A. Pediatric Parainfectious Encephalitis Associated with COVID-19. Neurology 2021, 96, 541–544. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Ahsan, N.; Jafarpour, S.; Santoro, J.D. Myelin oligodendrocyte glycoprotein antibody encephalitis following severe acute respiratory syndrome coronavirus 2 in a pediatric patient. Clin. Exp. Pediatr. 2021, 64, 310–312. [Google Scholar] [CrossRef] [Scilit]
  19. Guilmot, A.; Maldonado Slootjes, S.; Sellimi, A.; Bronchain, M.; Hanseeuw, B.; Belkhir, L.; Yombi, J.C.; De Greef, J.; Pothen, L.; Yildiz, H.; et al. Immune-mediated neurological syndromes in SARS-CoV-2-infected patients. J. Neurol. 2021, 268, 751–757. [Google Scholar] [CrossRef] [Scilit]
  20. Gammazza, A.M.; Légaré, S.; Lo Bosco, G.; Fucarino, A.; Angileri, F.; de Macario, E.C.; Macario, A.J.; Cappello, F. Human molecular chaperones share with SARS-CoV-2 antigenic epitopes potentially capable of eliciting autoimmunity against endothelial cells: Possible role of molecular mimicry in COVID-19. Cell Stress Chaperones 2020, 25, 737–741. [Google Scholar] [CrossRef] [Scilit]
  21. Kanduc, D. From Anti-SARS-CoV-2 Immune Responses to COVID-19 via Molecular Mimicry. Antibodies 2020, 9, 33. [Google Scholar] [CrossRef] [Scilit]
  22. Gusev, E.; Sarapultsev, A.; Solomatina, L.; Chereshnev, V. SARS-CoV-2-Specific Immune Response and the Pathogenesis of COVID-19. Int. J. Mol. Sci. 2022, 23, 1716. [Google Scholar] [CrossRef] [Scilit]
  23. Sharma, C.; Bayry, J. High risk of autoimmune diseases after COVID-19. Nat. Rev. Rheumatol. 2023, 19, 399–400. [Google Scholar] [CrossRef] [Scilit]
  24. Lucchese, G.; Flöel, A. SARS-CoV-2 and Guillain-Barré syndrome: Molecular mimicry with human heat shock proteins as potential pathogenic mechanism. Cell Stress Chaperones 2020, 25, 731–735. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Cuspoca, A.F.; Estrada, P.I.; Velez-van-Meerbeke, A. Molecular Mimicry of SARS-CoV-2 Spike Protein in the Nervous System: A Bioinformatics Approach. Comput. Struct. Biotechnol. J. 2022, 20, 6041–6054. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Madeira, F.; Pearce, M.; Tivey, A.R.N.; Basutkar, P.; Lee, J.; Edbali, O.; Madhusoodanan, N.; Kolesnikov, A.; Lopez, R. Search and sequence analysis tools services from EMBL-EBI in 2022. Nucleic Acids Res. 2022, 50, W276–W279. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
  28. Altschul, S.F.; Wootton, J.C.; Gertz, E.M.; Agarwala, R.; Morgulis, A.; Schaffer, A.A.; Yu, Y.-K. Protein database searches using compositionally adjusted substitution matrices. FEBS J. 2005, 272, 5101–5109. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  29. Zhang, Y. TM-align: A protein structure alignment algorithm based on the TM-score. Nucleic Acids Res. 2005, 33, 2302–2309. [Google Scholar] [CrossRef] [Scilit]
  30. Nielsen, M.; Lundegaard, C.; Lund, O. Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method. BMC Bioinform. 2007, 8, 238. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  31. Mohkhedkar, M.; Venigalla, S.S.K.; Janakiraman, V. Untangling COVID-19 and autoimmunity: Identification of plausible targets suggests multi organ involvement. Mol. Immunol. 2021, 137, 105–113. [Google Scholar] [CrossRef] [Scilit]
  32. Figueiredo, C.P.; Barros-Aragão, F.G.Q.; Neris, R.L.S.; Frost, P.S.; Soares, C.; Souza, I.N.O.; Zeidler, J.D.; Zamberlan, D.C.; de Sousa, V.L.; Souza, A.S. Zika virus replicates in adult human brain tissue and impairs synapses and memory in mice. Nat. Commun. 2019, 10, 3890. [Google Scholar] [CrossRef] [Scilit]
  33. Ranawaka, U.K. Emerging tropical neurological infections. Clin. Med. 2022, 22, 18–20. [Google Scholar] [CrossRef] [Scilit]
  34. Zerboni, L.; Reichelt, M.; Arvin, A. Varicella-Zoster Virus Neurotropism in SCID Mouse–Human Dorsal Root Ganglia Xenografts. Curr. Top. Microbiol. Immunol. 2010, 342, 255–276. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Das, M.K.; Sarma, A.; Chakraborty, T. Nano-ART and NeuroAIDS. Drug Deliv. Transl. Res. 2016, 6, 452–472. [Google Scholar] [CrossRef] [Scilit]
  36. Da Silva, E.V.; Fontes-Dantas, F.L.; Dantas, T.V.; Dutra, A.; Nascimento, O.J.M.; Alves-Leon, S.V. Shared Molecular Signatures Across Zika Virus Infection and Multiple Sclerosis Highlight AP-1 Transcription Factor as a Potential Player in Post-ZIKV MS-Like Phenotypes. Mol. Neurobiol. 2023, 60, 4184–4205. [Google Scholar] [CrossRef] [Scilit]
  37. França, L.C.; Fontes-Dantas, F.L.; Garcia, D.G.; de Araújo, A.D.; da Costa Gonçalves, J.P.; da Silva Rêgo, C.C.; da Silva, E.V.; do Nascimento, O.J.M.; Lopes, F.C.R.; Herlinger, A.L.; et al. Mimetismo molecular entre o vírus Zika e os distúrbios inflamatórios desmielinizantes do sistema nervoso central: O papel do epítopo NS5 do vírus Zika e dos autoantígenos PLP. Arq. Neuropsiquiatr. 2023, 81, 357–368. [Google Scholar] [CrossRef] [Scilit]
  38. Cavalcante, L.T.d.F.; da Fonseca, G.C.; Amado Leon, L.A.; Salvio, A.L.; Brustolini, O.J.; Gerber, A.L.; Guimarães, A.P.d.C.; Marques, C.A.B.; Fernandes, R.A.; Ramos Filho, C.H.F.; et al. Buffy Coat Transcriptomic Analysis Reveals Alterations in Host Cell Protein Synthesis and Cell Cycle in Severe COVID-19 Patients. Int. J. Mol. Sci. 2022, 23, 13588. [Google Scholar] [CrossRef] [Scilit]
  39. Yan, L.; Ge, J.; Zheng, L.; Zhang, Y.; Gao, Y.; Wang, T.; Huang, Y.; Yang, Y.; Gao, S.; Li, M.; et al. Cryo-EM Structure of an Extended SARS-CoV-2 Replication and Transcription Complex Reveals an Intermediate State in Cap Synthesis. Cell 2021, 184, 184–193.e10. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  40. Almqvist, J.; Granberg, T.; Tzortzakakis, A.; Klironomos, S.; Kollia, E.; Öhberg, C.; Martin, R.; Piehl, F.; Ouel-lette, R.; Ineichen, B.V. Neurological manifestations of coronavirus infections—A systematic review. Ann. Clin. Transl. Neurol. 2020, 7, 2057–2071. [Google Scholar] [CrossRef] [Scilit]
  41. Chang, R.; Chen, T.Y.-T.; Wang, S.-I.; Hung, Y.-M.; Chen, H.-Y.; Wei, C.-C.J. Risk of autoimmune diseases in patients with COVID-19: A retrospective cohort study. eClinicalMedicine 2023, 56, 101783. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  42. Tesch, F.; Ehm, F.; Vivirito, A.; Wende, D.; Batram, M.; Loser, F.; Menzer, S.; Jacob, J.; Roessler, M.; Seifert, M.; et al. Incident autoimmune diseases in association with a SARS-CoV-2 infection: A matched cohort study. Clin. Rheumatol. 2023, 42, 2905–2914. [Google Scholar] [CrossRef] [Scilit]
  43. Corrêa, D.G.; de Souza Lima, F.C.; da Cruz Bezerra, D.; Coutinho, A.C.; da Cruz, L.C.H. COVID-19 associated with encephalomyeloradiculitis and positive anti-aquaporin-4 antibodies: Cause or coincidence? Mult. Scler. J. 2021, 27, 973–976. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Lotan, I.; Nishiyama, S.; Manzano, G.S.; Lydston, M.; Levy, M. COVID-19 and the risk of CNS demyelinating diseases: A systematic review. Front. Neurol. 2022, 13, 970383. [Google Scholar] [CrossRef] [Scilit]
  45. Galeotti, C.; Bayry, J. Autoimmune and inflammatory diseases following COVID-19. Nat. Rev. Rheumatol. 2020, 16, 413–414. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Schattner, A.; Rager-Zisman, B. Virus-Induced Autoimmunity. Clin. Infect. Dis. 1990, 12, 204–222. [Google Scholar] [CrossRef] [Scilit]
  47. Morsy, S.; Morsy, A. Epitope mimicry analysis of SARS-CoV-2 surface proteins and human lung proteins. J. Mol. Graph. Model. 2021, 105, 107836. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Petrenko, V.A.; Gillespie, J.W.; De Plano, L.M.; Shokhen, M.A. Phage-Displayed Mimotopes of SARS-CoV-2 Spike Protein Targeted to Authentic and Alternative Cellular Receptors. Viruses 2022, 14, 384. [Google Scholar] [CrossRef] [Scilit]
  49. Karagöz, I.K.; Munk, M.R.; Kaya, M.; Rückert, R.; Yıldırım, M.; Karabaş, L. Using bioinformatic protein sequence similarity to investigate if SARS-CoV-2 infection could cause an ocular autoimmune inflammatory reactions? Exp. Eye Res. 2021, 203, 108433. [Google Scholar] [CrossRef] [Scilit]
  50. Lucchese, G.; Flöel, A. Molecular mimicry between SARS-CoV-2 and respiratory pacemaker neurons. Autoimmun. Rev. 2020, 19, 102556. [Google Scholar] [CrossRef] [Scilit]
  51. Lavi, Y.; Vojdani, A.; Halpert, G.; Sharif, K.; Ostrinski, Y.; Zyskind, I.; Lattin, M.T.; Zimmerman, J.; Silverberg, J.I.; Rosenberg, A.Z.; et al. Dysregulated Levels of Circulating Autoantibodies against Neuronal and Nervous System Autoantigens in COVID-19 Patients. Diagnostics 2023, 13, 687. [Google Scholar] [CrossRef] [Scilit]
  52. Giovannoni, G.; Ebers, G. Multiple sclerosis: The environment and causation. Curr. Opin. Neurol. 2007, 20, 261–268. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Olsson, T.; Barcellos, L.F.; Alfredsson, L. Interactions between genetic, lifestyle and environmental risk factors for multiple sclerosis. Nat. Rev. Neurol. 2017, 13, 25–36. [Google Scholar] [CrossRef] [Scilit]
  54. Kaushansky, N.; Eisenstein, M.; Zilkha-Falb, R.; Ben-Nun, A. The myelin-associated oligodendrocytic basic protein (MOBP) as a relevant primary target autoantigen in multiple sclerosis. Autoimmun. Rev. 2010, 9, 233–236. [Google Scholar] [CrossRef] [Scilit]
  55. Mohammadi-Milasi, F.; Mahnam, K.; Shakhsi-Niaei, M. In silico study of the association of the HLA-A*31:01 allele (human leucocyte antigen allele 31:01) with neuroantigenic epitopes of PLP (proteolipid protein), MBP (myelin basic protein) and MOG proteins (myelin oligodendrocyte glycoprotein) for studying the multiple sclerosis disease pathogenesis. J. Biomol. Struct. Dyn. 2021, 39, 2526–2542. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Minohara, M.; Matsuoka, T.; Li, W.; Osoegawa, M.; Ishizu, T.; Ohyagi, Y.; Kira, J. Upregulation of myeloperoxidase in patients with opticospinal multiple sclerosis: Positive correlation with disease severity. J. Neuroimmunol. 2006, 178, 156–160. [Google Scholar] [CrossRef] [Scilit]
  57. Gray, E.; Thomas, T.L.; Betmouni, S.; Scolding, N.; Love, S. Elevated Activity and Microglial Expression of Myeloperoxidase in Demyelinated Cerebral Cortex in Multiple Sclerosis. Brain Pathol. 2008, 18, 86–95. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Nagra, R.M.; Becher, B.; Tourtellotte, W.W.; Antel, J.P.; Gold, D.; Paladino, T.; Smith, R.A.; Nelson, J.R.; Reynolds, W.F. Immunohistochemical and genetic evidence of myeloperoxidase involvement in multiple sclerosis. J. Neuroimmunol. 1997, 78, 97–107. [Google Scholar] [CrossRef] [Scilit]
  59. Sedighi, S.; Gholizadeh, O.; Yasamineh, S.; Akbarzadeh, S.; Amini, P.; Favakehi, P.; Afkhami, H.; Firouzi-Amandi, A.; Pahlevan, D.; Eslami, M. Comprehensive Investigations Relationship Between Viral Infections and Multiple Sclerosis Pathogenesis. Curr. Microbiol. 2023, 80, 15. [Google Scholar] [CrossRef] [Scilit]
  60. Mariotto, S.; Ferrari, S.; Monaco, S.; Benedetti, M.D.; Schanda, K.; Alberti, D.; Farinazzo, A.; Capra, R.; Mancinelli, C.; De Rossi, N.; et al. Clinical spectrum and IgG subclass analysis of anti-myelin oligodendrocyte glycoprotein antibody-associated syndromes: A multicenter study. J. Neurol. 2017, 264, 2420–2430. [Google Scholar] [CrossRef] [Scilit]
  61. Cobo-Calvo, A.; Ruiz, A.; Maillart, E.; Audoin, B.; Zephir, H.; Bourre, B.; Ciron, J.; Collongues, N.; Brassat, D.; Cotton, F.; et al. Clinical spectrum and prognostic value of CNS MOG autoimmunity in adults. Neurology 2018, 90, e1858–e1869. [Google Scholar] [CrossRef] [Scilit]
  62. Sehgal, V.; Bansal, P.; Arora, S.; Kapila, S.; Bedi, G.S. Myelin Oligodendrocyte Glycoprotein Antibody Disease after COVID-19 Vaccination—Causal or Incidental? Cureus 2022, 14, e27024. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Netravathi, M.; Dhamija, K.; Gupta, M.; Tamborska, A.; Nalini, A.; Holla, V.V.; Nitish, L.K.; Menon, D.; Pal, P.K.; Seena, V.; et al. COVID-19 vaccine associated demyelination & its association with MOG antibody. Mult. Scler. Relat. Disord. 2022, 60, 103739. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Lambe, J.; McGinley, M.P.; Moss, B.P.; Mao-Draayer, Y.; Kassa, R.; Ciotti, J.R.; Mariotto, S.; Kunchok, A. Myelin oligodendrocyte glycoprotein-IgG associated disorders (MOGAD) following SARS-CoV-2 infection: A case series. J. Neuroimmunol. 2022, 370, 577933. [Google Scholar] [CrossRef] [Scilit]
  65. Vasilevska, V.; Guest, P.C.; Bernstein, H.G.; Schroeter, M.L.; Geis, C.; Steiner, J. Molecular mimicry of NMDA receptors may contribute to neuropsychiatric symptoms in severe COVID-19 cases. J. Neuroinflamm. 2021, 18, 245. [Google Scholar] [CrossRef] [Scilit]
  66. Etemadifar, M.; Nouri, H.; Salari, M.; Sedaghat, N. Detection of anti-NMDA receptor antibodies following BBIBP-CorV COVID-19 vaccination in a rituximab-treated person with multiple sclerosis presenting with manifestations of an acute relapse. Hum. Vaccin. Immunother. 2022, 18, 2033540. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Valadez-Calderon, J.; Navarro, A.O.; Rodriguez-Chavez, E.; Vera-Lastra, O. Co-expression of anti-NMDAR and anti-GAD65 antibodies. A case of autoimmune encephalitis in a post-COVID-19 patient. Neurología 2022, 37, 503–504. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Assi, F.; Abdallah, R.; Mecheik, A.; Rahhal, H.H.; Wazne, J. Acute Disseminated Encephalomyelitis Following COVID-19 Infection. Cureus 2023, 15, e33365. [Google Scholar] [CrossRef] [Scilit]
  69. Mumoli, L.; Vescio, V.; Pirritano, D.; Russo, E.; Bosco, D. ADEM anti-MOG antibody-positive after SARS-CoV-2 vaccination. Neurol. Sci. 2022, 43, 763–766. [Google Scholar] [CrossRef] [Scilit]
  70. Wang, Y.; Wang, Y.; Huo, L.; Li, Q.; Chen, J.; Wang, H. SARS-CoV-2-associated acute disseminated encephalomyelitis: A systematic review of the literature. J. Neurol. 2022, 269, 1071–1092. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  71. Miyamoto, K.; Koh, J.; Takahashi, M.; Niwa, M.; Ito, H. A case of anti-MOG antibody-positive ADEM following COVID-19 mRNA vaccination. Neurol. Sci. 2022, 43, 3513–3514. [Google Scholar] [CrossRef] [Scilit]
  72. Pinto, A.A.; Carroll, L.S.; Nar, V.; Varatharaj, A.; Galea, I. CNS inflammatory vasculopathy with antimyelin oligodendrocyte glycoprotein antibodies in COVID-19. Neurol.-Neuroimmunol. Neuroinflamm. 2020, 7, e813. [Google Scholar] [CrossRef] [Scilit]
  73. Naidu, K.; Tayler, R. Anti N-Methyl-D-Aspartate receptor antibody associated Acute Demyelinating Encephalomyelitis in a patient with COVID-19: A case report. J. Med. Case Rep. 2023, 17, 247. [Google Scholar] [CrossRef] [Scilit]
  74. Al-Hakeim, H.K.; Al-Rubaye, H.T.; Al-Hadrawi, D.S.; Almulla, A.F.; Maes, M. Long-COVID post-viral chronic fatigue and affective symptoms are associated with oxidative damage, lowered antioxidant defenses and inflammation: A proof of concept and mechanism study. Mol. Psychiatry 2023, 28, 564–578. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Al-Hakeim, H.K.; Al-Rubaye, H.T.; Almulla, A.F.; Al-Hadrawi, D.S.; Maes, M. Chronic Fatigue, Depression and Anxiety Symptoms in Long COVID Are Strongly Predicted by Neuroimmune and Neuro-Oxidative Pathways Which Are Caused by the Inflammation during Acute Infection. J. Clin. Med. 2023, 12, 511. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  76. Li, F.; Tsien, J.Z. Memory and the NMDA Receptors. N. Engl. J. Med. 2009, 361, 302–303. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  77. Franke, C.; Boesl, F.; Goereci, Y.; Gerhard, A.; Schweitzer, F.; Schroeder, M.; Foverskov-Rasmussen, H.; Heine, J.; Quitschau, A.; Kandil, F.I.; et al. Association of cerebrospinal fluid brain-binding autoantibodies with cognitive impairment in post-COVID-19 syndrome. Brain Behav. Immun. 2023, 109, 139–143. [Google Scholar] [CrossRef] [Scilit]
  78. Mueller, S.H.; Färber, A.; Prüss, H.; Melzer, N.; Golombeck, K.S.; Kümpfel, T.; Thaler, F.; Elisak, M.; Lewerenz, J.; Kaufmann, M.; et al. Genetic predisposition in anti-LGI1 and anti-NMDA receptor encephalitis. Ann. Neurol. 2018, 83, 863–869. [Google Scholar] [CrossRef] [Scilit]
  79. Sawcer, S.; Hellenthal, G.; Pirinen, M.; Spencer, C.C.A.; Patsopoulos, N.A.; Moutsianas, L.; Dilthey, A.; Su, Z.; Freeman, C.; Hunt, S.E.; et al. Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis. Nature 2011, 476, 214–219. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  80. Alves-Leon, S.V.; Veluttini-Pimentel, M.L.; Gouveia, M.E.; Malfetano, F.R.; Gaspareto, E.L.; Alvarenga, M.P.; Frugulhetti, I.; Quirico-Santos, T. ACUTE DISSEMINATED ENCEPHALOMYELITIS Clinical features, HLA DRB1*1501, HLA DRB1*1503, HLA DQA1*0102, HLA DQB1*0602, and HLA DPA1*0301 allelic association study. Arq. Neuro-Psiquiatr. 2009, 67, 643–651. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  81. De Silvestri, A.; Capittini, C.; Mallucci, G.; Bergamaschi, R.; Rebuffi, C.; Pasi, A.; Martinetti, M.; Tinelli, C. The Involvement of HLA Class II Alleles in Multiple Sclerosis: A Systematic Review with Meta-analysis. Dis. Markers 2019, 2019, 1409069. [Google Scholar] [CrossRef] [Scilit]
  82. Barcellos, L.F.; Sawcer, S.; Ramsay, P.P.; Baranzini, S.E.; Thomson, G.; Briggs, F.; Cree, B.C.A.; Begovich, A.B.; Villoslada, P.; Montalban, X.; et al. Heterogeneity at the HLA-DRB1 locus and risk for multiple sclerosis. Hum. Mol. Genet. 2006, 15, 2813–2824. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  83. Fontes-Dantas, F.L.; Fernandes, G.G.; Gutman, E.G.; De Lima, E.V.; Antonio, L.S.; Hammerle, M.B.; Mo-ta-Araujo, H.P.; Colodeti, L.C.; Araújo, S.M.B.; Froz, G.M.; et al. SARS-CoV-2 spike protein induces TLR4-mediated long-term cognitive dysfunction recapitulating post-COVID syndrome in mice. Cell Rep. 2023, 42, 112189. [Google Scholar] [CrossRef] [Scilit]
  84. Ismail, I.I.; Salama, S. A systematic review of cases of CNS demyelination following COVID-19 vaccination. J. Neuroimmunol. 2022, 362, 577765. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  85. Flannery, P.; Yang, I.; Keyvani, M.; Sakoulas, G. Acute Psychosis Due to Anti-N-Methyl D-Aspartate Receptor Encephalitis Following COVID-19 Vaccination: A Case Report. Front. Neurol. 2021, 12, 764197. [Google Scholar] [CrossRef] [Scilit]
  86. Lee, H.C.; Kim, B.-K.; Kang, K.; Lee, W.-W.; Yoo, I.; Kim, Y.S.; Lee, J.-J. Anti-N-Methyl-D-Aspartate Receptor Encephalitis after BNT162b2 COVID-19 Vaccination. J. Epilepsy Res. 2022, 12, 71–73. [Google Scholar] [CrossRef] [Scilit]
  87. Jarius, S.; Bieber, N.; Haas, J.; Wildemann, B. MOG encephalomyelitis after vaccination against severe acute respiratory syndrome coronavirus type 2 (SARS-CoV-2): Case report and comprehensive review of the literature. J. Neurol. 2022, 269, 5198–5212. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  88. Amado, L.A.; Coelho, W.L.d.C.N.P.; Alves, A.D.R.; Carneiro, V.C.d.S.; Moreira, O.d.C.; de Paula, V.S.; Lemos, A.S.; Duarte, L.A.; Gutman, E.G.; Fontes-Dantas, F.L.; et al. Clinical Profile and Risk Factors for Severe COVID-19 in Hospitalized Patients from Rio de Janeiro, Brazil: Comparison between the First and Second Pandemic Waves. J. Clin. Med. 2023, 12, 2568. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  89. Carneiro, V.C.d.S.; Moreira, O.d.C.; Coelho, W.L.d.C.N.P.; Rio, B.C.; Sarmento, D.J.d.S.; Salvio, A.L.; Alves-Leon, S.V.; de Paula, V.S.; Leon, L.A.A. miRNAs in Neurological Manifestation in Patients Co-Infected with SARS-CoV-2 and Herpesvírus 6 (HHV-6). Int. J. Mol. Sci. 2023, 24, 11201. [Google Scholar] [CrossRef] [Scilit]
  90. Mares-Guia, M.A.M.M.; Paiva, A.A.P.; Mello, V.M.; Eller, C.M.; Salvio, A.L.; Nascimento, F.F.; Silva, E.S.R.F.; Campos, V.T.M.G.; da Silva Mendes, Y.; Lemos, E.R.S.; et al. Effectiveness of Household Disinfection Techniques to Remove SARS-CoV-2 from Cloth Masks. Pathogens 2022, 11, 916. [Google Scholar] [CrossRef] [Scilit]
Figure 1. MRI of patient 1. (A)—axial flair sequence reveals hyperintense lesion near the posterior horn of the right lateral ventricle (red arrows). (B,C)—axial flair and sagittal T2 sequences demonstrate hyperintense lesion in the pons (red arrows). (DF)—axial and sagittal T1 sequences with contrast demonstrating impregnation of the lesions (yellow arrows).
Figure 1. MRI of patient 1. (A)—axial flair sequence reveals hyperintense lesion near the posterior horn of the right lateral ventricle (red arrows). (B,C)—axial flair and sagittal T2 sequences demonstrate hyperintense lesion in the pons (red arrows). (DF)—axial and sagittal T1 sequences with contrast demonstrating impregnation of the lesions (yellow arrows).
Microorganisms 11 02902 g001
Figure 2. MRI of patient 2. (AD)—sagittal and axial flair sequences and sagittal T2, showing multiple lesions (red arrows) with hypersignal, distributed in the periventricular and subcortical regions and in the spinal cord. Some of these lesions are impregnated with contrast (yellow arrows) (E,F).
Figure 2. MRI of patient 2. (AD)—sagittal and axial flair sequences and sagittal T2, showing multiple lesions (red arrows) with hypersignal, distributed in the periventricular and subcortical regions and in the spinal cord. Some of these lesions are impregnated with contrast (yellow arrows) (E,F).
Microorganisms 11 02902 g002
Figure 3. MRI of patient 3—(AF)—flair sequence in the axial plane showing multiple lesions in the inferior cerebellar peduncle and the subcortical and periventricular regions, predominantly in the right hemisphere (red arrows).
Figure 3. MRI of patient 3—(AF)—flair sequence in the axial plane showing multiple lesions in the inferior cerebellar peduncle and the subcortical and periventricular regions, predominantly in the right hemisphere (red arrows).
Microorganisms 11 02902 g003
Figure 4. Models had a significant linear and three-dimensional overlap of autoimmune CNS proteins (in red) and SARS-CoV-2 (in blue) proteins according to TM-align, with their respective amino acid sequences. The arrows indicate the sequence region with three-dimensional overlap. (a) M and NMDAR1 (TM-score: 0.89). (b) M and MPO (TM-Score = 0.73). (c) nsp2 and NMDAR1 (TM-score = 0.69). (d) S and MOG (TM-score = 0.63). (e) ORF7a and MOG (TM-score = 0.62). (f) N and MPO (TM-score = 0.59). (g) nsp13 and GAD65 (TM-score = 0.52). (h) nsp1 and GAD65 (TM-score = 0.52). (i) nsp1 and MOG (TM-score = 0.50). (j) nsp3 and MPO (TM-score = 0.50). (k) S and NMDAR1 (TM-score = 0.50).
Figure 4. Models had a significant linear and three-dimensional overlap of autoimmune CNS proteins (in red) and SARS-CoV-2 (in blue) proteins according to TM-align, with their respective amino acid sequences. The arrows indicate the sequence region with three-dimensional overlap. (a) M and NMDAR1 (TM-score: 0.89). (b) M and MPO (TM-Score = 0.73). (c) nsp2 and NMDAR1 (TM-score = 0.69). (d) S and MOG (TM-score = 0.63). (e) ORF7a and MOG (TM-score = 0.62). (f) N and MPO (TM-score = 0.59). (g) nsp13 and GAD65 (TM-score = 0.52). (h) nsp1 and GAD65 (TM-score = 0.52). (i) nsp1 and MOG (TM-score = 0.50). (j) nsp3 and MPO (TM-score = 0.50). (k) S and NMDAR1 (TM-score = 0.50).
Microorganisms 11 02902 g004
Table 1. SARS-CoV-2 proteins selected.
Table 1. SARS-CoV-2 proteins selected.
ProteinNumber of AminoacidsGeneNCBI Reference SequenceUniprot ID
E75aaEYP_009724392P0DTC4
Nsp1180aaORF1aYP_009742608.1P0DTD1
M222aaMYP_009724393.1P0DTC5
Nsp2638aaORF1aYP_009742609.1P0DTD1
Nsp31945aaORF1aYP_009742610.1P0DTD1
Nsp13601aaORF1aNP_828870.1P0DTD1
ORF7a121aaORF7aYP_009724395.1P0DTC7
S1273aaSYP_009724390.1P0DTC2
Table 2. Self-proteins associated with IDDs and autoimmune encephalitis.
Table 2. Self-proteins associated with IDDs and autoimmune encephalitis.
ProteinNumber of AminoacidsGeneNCBI Reference SequenceUniprot ID
2’,3’-Cyclic-nucleotide 3’-phosphodiesterase (CNP)421aaCNPNP_149124.3P09543
Aquaporin-4 (AQP4)323aaAQP4NP_001641.1P55087
Glutamic acid decarboxylase 65-kilodalton isoform (GAD65)585aaGAD2NP_001127838.1Q05329
Myelin-associated glycoprotein (MAG)626aaMAGNP_002352.1P20916
Myelin basic protein (MBP)304aaMBPNP_001020272.1P02686
Myelin oligodendrocyte glycoprotein (MOG)247aaMOGNP_996532.2Q16653
Myelin-associated oligodendrocytic basic protein (MOBP)183aaMOBPNP_001380633.1Q13875
Myeloperoxidase (MPO)745aaMPONP_000241.1P05164
N-methyl-D-aspartate receptor 1 (NMDAR1)938aaGRIN1NP_015566.1Q05586
Transaldolase337aaTALDO1NP_006746.1P37837
Table 3. Linear and three-dimensional identity between SARS-CoV-2 antigens and self-antigens, and antigenic properties of each combination.
Table 3. Linear and three-dimensional identity between SARS-CoV-2 antigens and self-antigens, and antigenic properties of each combination.
SARS-CoV-2 AntigensAutoantigensRegion of the SARS-CoV-2 Antigen with More IdentityRegion of the Autoantigen with More Identity% IdentityE-ValueSWISS MODEL SARS-CoV-2 AntigenSWISS MODEL AutoantigenTM-SCORERMSDOverall Prediction Vaxijen LinearOverall Prediction VaxiJen Three-Dimensional Model
MNMDAR154–70562–5771003.00 × 10−474–106626–6580.890.550.93060.5324
MMPO134–16257–851001.076–10567–960.731.210.47400.5177
Nsp2NMDAR1448–465325–34471.430.038549–584621–6500.691.350.59830.4174
SMOG249–27883–10283.330.069944–974150–1800.632.060.47060.4059
ORF7aMOG25–3295–102752.00 × 10−417–8130–1530.622.830.48460.6598
NMPO227–236149–157700.002388–41967–980.591.910.41170.4124
Nsp13GAD65466–472439–44566.673.00 × 10−4290–349312–3890.523.220.65550.4695
Nsp1GAD65131–138137–1391000.00532–61302–3310.521.57−0.32990.6325
Nsp1MOG103–114210–22171.430.00333–62204–2320.501.590.60130.6757
Nsp3MPO903–908613–61883.332.00 × 10−5180–20971–1120.502.791.82360.8823
SNMDAR11020–1027223–2301000.0171020–1050221–2500.501.470.87260.7359
Nsp3NMDAR11800–1809766–7741005.00 × 10−4399–535153–2780.493.860.42380.4044
Nsp13PLP88–9499–10571.431.00 × 10−4310–342175–2100.492.82−0.06240.4685
Nsp1PLP34–62196–2111000.00633–64240–2720.471.690.76450.5854
Nsp1Transaldolase84–99139–1541000.00133–62145–1760.462.180.68980.6757
Nsp2MPO419–425159–1651000.15672–70767–950.461.160.58130.5890
Nsp3PLP88–9499–10571.431.00 × 10−4180–20934–630.452.07−0.06240.8823
MMAG132–138369–3751002.00 × 10−4156–186295–3250.432.590.45490.6527
STransaldolase1110–111737–4462.500.002276–305125–1560.422.100.87340.6476
Nsp13Transaldolase146–151307–31283.330.001367–396135–1640.412.601.07261.1104
NCNP243–252191–2001000.001195–239322–3630.412.720.70560.6601
Nsp13NMDAR1301–306628–6361003.00 × 10−4503–532683–7120.412.900.90600.4818
Nsp2Transaldolase389–40395–10966.670.19249–280134–1630.401.900.51460.7524
Nsp2CNP270–278348–35677.784.00 × 10−7395–432349–3820.392.380.92950.4387
NMOBP198–209168–17877.785.00 × 10−6202–23329–740.382.380.42910.6320
NPLP170–184120–134750.0003212–24175–980.371.440.44590.7169
Nsp1MBP76–102198–1161000.01032–67211–2400.363.220.65830.4770
Nsp3AQP463–7751–651000.272667–2697197–2270.352.360.41680.5551
Nsp2MBP61–73107–1191008.00 × 10−4280–309200–2290.332.790.66250.5624
Table 4. The viral epitopes for MHC-I and MHC-II and the corresponding homologous human proteins.
Table 4. The viral epitopes for MHC-I and MHC-II and the corresponding homologous human proteins.
SARS-CoV-2 AntigenAutoantigensAllelePotential SARS-CoV-2 EpitopeCorresponding Human EpitopeIC50 Virus PeptideIC50 Human Peptide
MNMDAR1HLA-DQA1*01:02/DQB1*06:02NWITGGIAIAMACLVVWAGFAMIIVASYTA57.0060.00
HLA-DRB1*15:01LMWLSYFIASFRLFAGFAMIIVASYTANLA68.0049.00
HLA-A*31:01LSYFIASFRLGMVWAGFAM12.20262.06
MMPOHLA-A*31:01LSYFIASFRKQLVDKAYK12.2068.78
HLA-B*07:02GGIAIAMACLVRLRSGSASPM321.23159.89
Nsp2NMDAR1HLA-DQA1*01:02/DQB1*06:02RVLQKAAITILDGISVWAGFAMIIVASYTA93.0060.00
HLA-DRB1*15:01ITILDGISQYSLRLIVWAGFAMIIVASYTA146.0060.00
HLA-A*31:01RTLETAQNSVRGAPRSFSAR309.40129.86
HLA-B*07:02SVRVLQKAAIAPRSFSARIL357.9529.30
SMOGHLA-DRB1*15:01LNTLVKQLSSNFGAIGVLVLLAVLPVLLLQ89.0058.00
HLA-DQA1*01:02/DQB1*06:02QNAQALNTLVKQLSSWVSPGVLVLLAVLPV319.00229.00
ORF7aMOGHLA-DQA1*01:02/DQB1*06:02YQECVRGTTVLLKEPYWVSPGVLVLLAVLP261.00210.00
NMPOHLA-A*31:01FSKQLQQSMSSKQLVDKAYK46.7268.78
Nsp13GAD65HLA-DRB1*15:01AIGLALYYPSARIVYAKQKGFVPFLVSATA71.00196.00
HLA-DQA1*01:02/DQB1*06:02IVYTACSHAAVDALCLVSATAGTTVYGAFD347.0052.00
HLA-A*31:01KYLPIDKCSRKHKWKLSGVER18.7235.44
HLA-B*07:02LPIDKCSRVPFLVSAT187.5069.82
Nsp1GAD65HLA-DRB1*03:01SVEEVLSEARQHLKDRGKMIPSDLERRILE489.00448.00
HLA-A*31:01HLKDGTCGLVEKMIPSDLERR31.4427.31
Nsp1MOGHLA-A*31:01HLKDGTCGLVECWKITLFVIVP31.44284.79
Nsp3MPOHLA-A*31:01SYKDWSYSGQSRLRSGSASPME38.77111.56
SNMDAR1HLA-DQA1*01:02/DQB1*06:02ASANLAATKMSECVLASEDDAATVYRAAAM213.00121.00
HLA-A*31:01KMSECVLGQSKRLSASEDDAATVYR297.9495.7
HLA-DQA1*01:02/DQB1*06:02AQYTSALLAGTITSGSRRVLLLAGRLAAQS122.00199.00
HLA-B*07:02MIAQYTSALMAAESRRVL61.8854.29
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Gutman, E.G.; Fernandes, R.A.; Raposo-Vedovi, J.V.; Salvio, A.L.; Duarte, L.A.; Tardim, C.F.; Costa, V.G.C.; Pereira, V.C.S.R.; Bahia, P.R.V.; da Silva, M.M.; et al. Molecular Mimicry between SARS-CoV-2 Proteins and Human Self-Antigens Related with Autoimmune Central Nervous System (CNS) Disorders. Microorganisms 2023, 11, 2902. https://doi.org/10.3390/microorganisms11122902

AMA Style

Gutman EG, Fernandes RA, Raposo-Vedovi JV, Salvio AL, Duarte LA, Tardim CF, Costa VGC, Pereira VCSR, Bahia PRV, da Silva MM, et al. Molecular Mimicry between SARS-CoV-2 Proteins and Human Self-Antigens Related with Autoimmune Central Nervous System (CNS) Disorders. Microorganisms. 2023; 11(12):2902. https://doi.org/10.3390/microorganisms11122902

Chicago/Turabian Style

Gutman, Elisa Gouvea, Renan Amphilophio Fernandes, Jéssica Vasques Raposo-Vedovi, Andreza Lemos Salvio, Larissa Araujo Duarte, Caio Faria Tardim, Vinicius Gabriel Coutinho Costa, Valéria Coelho Santa Rita Pereira, Paulo Roberto Valle Bahia, Marcos Martins da Silva, and et al. 2023. "Molecular Mimicry between SARS-CoV-2 Proteins and Human Self-Antigens Related with Autoimmune Central Nervous System (CNS) Disorders" Microorganisms 11, no. 12: 2902. https://doi.org/10.3390/microorganisms11122902

APA Style

Gutman, E. G., Fernandes, R. A., Raposo-Vedovi, J. V., Salvio, A. L., Duarte, L. A., Tardim, C. F., Costa, V. G. C., Pereira, V. C. S. R., Bahia, P. R. V., da Silva, M. M., Fontes-Dantas, F. L., & Alves-Leon, S. V. (2023). Molecular Mimicry between SARS-CoV-2 Proteins and Human Self-Antigens Related with Autoimmune Central Nervous System (CNS) Disorders. Microorganisms, 11(12), 2902. https://doi.org/10.3390/microorganisms11122902

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop