COVID-19 Treatment—Current Status, Advances, and Gap
Abstract
:1. Introduction
2. Current Approaches to Finding COVID-19 Treatment
2.1. FDA-Approved and EUA-Authorised Drugs
2.2. Potential Drugs Undergoing Clinical Trials
3. Expanding the Therapeutic Approaches for COVID-19
3.1. Peptides Targeting S Protein RBD
3.2. Peptides Targeting S Protein HR1-HR2 Fusion
3.3. Small Molecules and Peptides Targeting Host Proteases and SARS-CoV-2 Main Protease
4. A New Area That Can Be Considered for the Development of COVID-19 Drugs
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Pizzato, M.; Baraldi, C.; Boscato Sopetto, G.; Finozzi, D.; Gentile, C.; Gentile, M.D.; Marconi, R.; Paladino, D.; Raoss, A.; Riedmiller, I.; et al. SARS-CoV-2 and the host cell: A tale of interactions. Front. Virol. 2022, 1, 815388. [Google Scholar] [CrossRef]
- Weekly Epidemiological Update on COVID-19–18 May 2022. Available online: https://www.who.int/publications/m/item/weekly-epidemiological-update-on-covid-19---18-may-2022 (accessed on 22 May 2022).
- Wu, Y.; Chen, C.; Chan, Y. The outbreak of COVID-19. J. Chin. Med. Assoc. 2020, 83, 217–220. [Google Scholar] [CrossRef]
- Han, Y.; Král, P. Computational Design of ACE2-Based Peptide Inhibitors of SARS-CoV-2. ACS Nano 2020, 14, 5143–5147. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shereen, M.A.; Khan, S.; Kazmi, A.; Bashir, N.; Siddique, R. COVID-19 infection: Origin, transmission, and characteristics of human coronaviruses. J. Adv. Res. 2020, 24, 91–98. [Google Scholar] [CrossRef] [PubMed]
- Wong, N.A.; Saier, M.H. The sars-coronavirus infection cycle: A survey of viral membrane proteins, their functional interactions and pathogenesis. Int. J. Mol. Sci. 2021, 22, 1308. [Google Scholar] [CrossRef] [PubMed]
- Henderson, R.; Edwards, R.J.; Mansouri, K.; Janowska, K.; Stalls, V.; Gobeil, S.M.C.; Kopp, M.; Li, D.; Parks, R.; Hsu, A.L.; et al. Controlling the SARS-CoV-2 spike glycoprotein conformation. Nat. Struct. Mol. Biol. 2020, 27, 925–933. [Google Scholar] [CrossRef] [PubMed]
- Ling, R.; Dai, Y.; Huang, B.; Huang, W.; Yu, J.; Lu, X.; Jiang, Y. In silico design of antiviral peptides targeting the spike protein of SARS-CoV-2. Peptides 2020, 130, 170328. [Google Scholar] [CrossRef] [PubMed]
- Jackson, C.B.; Farzan, M.; Chen, B.; Choe, H. Mechanisms of SARS-CoV-2 entry into cells. Nat. Rev. Mol. Cell Biol. 2022, 23, 3–20. [Google Scholar] [CrossRef] [PubMed]
- V’kovski, P.; Kratzel, A.; Steiner, S.; Stalder, H.; Thiel, V. Coronavirus biology and replication: Implications for SARS-CoV-2. Nat. Rev. Microbiol. 2021, 19, 155–170. [Google Scholar] [CrossRef]
- Gandhi, R.T.; Lynch, J.B.; del Rio, C. Mild or Moderate COVID-19. N. Engl. J. Med. 2020, 383, 1757–1766. [Google Scholar] [CrossRef] [PubMed]
- Ng, J.W.; Chong, E.; Lee, P.C. An Updated Review on the Role of Single Nucleotide Polymorphisms in COVID-19 Disease Severity: A Global Aspect. Curr. Pharm. Biotechnol. 2022, 23, 1596–1611. [Google Scholar] [CrossRef] [PubMed]
- Ng, J.W.; Chong, E.; Tan, Y.A.; Lee, H.G.; Chan, L.L.; Lee, Q.Z.; Saw, Y.T.; Wong, Y.; Zakaria, A.; Amin, Z.B.; et al. Prevalence of Coronavirus Disease 2019 (COVID-19) in Different Clinical Stages before the National COVID-19 Vaccination Programme in Malaysia: A Systematic Review and Meta-Analysis. Int. J. Environ. Res. Public Health 2022, 19, 2216. [Google Scholar] [CrossRef] [PubMed]
- Dong, Y.; Shamsuddin, A.; Campbell, H.; Theodoratou, E. Current COVID-19 treatments: Rapid review of the literature. J. Glob. Health 2021, 11, 10003. [Google Scholar] [CrossRef]
- Grein, J.; Ohmagari, N.; Shin, D.; Diaz, G.; Asperges, E.; Castagna, A.; Feldt, T.; Green, G.; Green, M.L.; Lexcure, F.-X.; et al. Compassionate Use of Remdesivir for Patients with Severe COVID-19. N. Engl. J. Med. 2020, 382, 2327–2336. [Google Scholar] [CrossRef] [PubMed]
- Coronavirus (COVID-19) | Drugs. Available online: https://www.fda.gov/drugs/emergency-preparedness-drugs/coronavirus-covid-19-drugs (accessed on 12 September 2022).
- Selvaraj, V.; Finn, A.; Lal, A.; Khan, M.S.; Dapaah-Afriyie, K.; Carino, G.P. Baricitinib in hospitalised patients with COVID-19: A meta-analysis of randomised controlled trials. EClinicalMedicine 2022, 49, 101489. [Google Scholar] [CrossRef]
- Atmar, R.L.; Finch, N. New Perspectives on Antimicrobial Agents: Molnupiravir and Nirmatrelvir/Ritonavir for Treatment of COVID-19. Antimicrob. Agents Chemother. 2022, 66, e02404-21. [Google Scholar] [CrossRef]
- Wei, Q.; Lin, H.; Wei, R.G.; Chen, N.; He, F.; Zou, D.H.; Wei, J.R. Tocilizumab treatment for COVID-19 patients: A systematic review and meta-analysis. Infect. Dis. Poverty 2021, 10, 71. [Google Scholar] [CrossRef] [PubMed]
- Collins, F.S.; Stoffels, P. Accelerating COVID-19 Therapeutic Interventions and Vaccines (ACTIV): An Unprecedented Partnership for Unprecedented Times. J. Am. Med. Assoc. 2020, 323, 2455–2457. [Google Scholar] [CrossRef]
- LaVange, L.; Adam, S.J.; Currier, J.S.; Higgs, E.S.; Reineck, L.A.; Hughes, E.A.; Read, S.W. Accelerating COVID-19 therapeutic interventions and vaccines (activ): Designing master protocols for evaluation of candidate COVID-19 therapeutics. Ann. Intern. Med. 2021, 174, 1293–1300. [Google Scholar] [CrossRef]
- NIH-Funded ACTIV/ACTIV-Associated Clinical Trials. Available online: https://www.nih.gov/activ/nih-funded-activ/activ-associated-clinical-trials (accessed on 12 September 2022).
- Boucau, J.; Chew, K.W.; Choudhary, M.C.; Deo, R.; Regan, J.; Flynn, J.P.; Crain, C.R.; Hughes, M.D.; Ritz, J.; Moser, C.; et al. Monoclonal antibody treatment drives rapid culture conversion in SARS-CoV-2 infection. Cell Rep. Med. 2022, 3, 100678. [Google Scholar] [CrossRef] [PubMed]
- Chen, P.; Nirula, A.; Heller, B.; Gottlieb, R.L.; Boscia, J.; Morris, J.; Huhn, G.; Cardona, J.; Mocherla, B.; Stosor, V.; et al. SARS-CoV-2 Neutralizing Antibody LY-CoV555 in Outpatients with COVID-19. N. Engl. J. Med. 2021, 384, 229–237. [Google Scholar] [CrossRef] [PubMed]
- Cohen, M.S.; Nirula, A.; Mulligan, M.J.; Novak, R.M.; Marovich, M.; Yen, C.; Stemer, A.; Mayer, S.M.; Wohl, D.; Brengle, B.; et al. Effect of Bamlanivimab vs Placebo on Incidence of COVID-19 Among Residents and Staff of Skilled Nursing and Assisted Living Facilities a Randomized Clinical Trial. JAMA 2021, 46225, 46–55. [Google Scholar] [CrossRef] [PubMed]
- Gottlieb, R.L.; Nirula, A.; Chen, P.; Boscia, J.; Heller, B.; Morris, J.; Huhn, G.; Cardona, J.; Mocherla, B.; Stosor, V.; et al. Effect of bamlanivimab as monotherapy or in combination with etesevimab on viral load in patients with mild to moderate COVID-19: A randomized clinical trial. JAMA 2021, 325, 632–644. [Google Scholar] [CrossRef] [PubMed]
- Dougan, M.; Nirula, A.; Azizad, M.; Mocherla, B.; Gottlieb, R.L.; Chen, P.; Hebert, C.; Perry, R.; Boscia, J.; Heller, B.; et al. Bamlanivimab plus Etesevimab in Mild or Moderate COVID-19. N. Engl. J. Med. 2021, 385, 1382–1392. [Google Scholar] [CrossRef] [PubMed]
- Levin, M.J.; Ustianowski, A.; De Wit, S.; Launay, O.; Avila, M.; Templeton, A.; Yuan, Y.; Seegobin, S.; Ellery, A.; Levinson, D.J.; et al. Intramuscular AZD7442 (Tixagevimab–Cilgavimab) for Prevention of COVID-19. N. Engl. J. Med. 2022, 386, 2188–2200. [Google Scholar] [CrossRef] [PubMed]
- Levin, M.J.; Ustianowski, A.; De Wit, S.; Launay, O.; Avila, M.; Seegobin, S.; Templeton, A.; Yuan, Y.; Ambery, P.; Arends, R.H.; et al. LB5. PROVENT: Phase 3 Study of Efficacy and Safety of AZD7442 (Tixagevimab/Cilgavimab) for Pre-exposure Prophylaxis of COVID-19 in Adults. Open Forum Infect. Dis. 2021, 8 (Suppl. 1), S810. [Google Scholar] [CrossRef]
- Montgomery, H.; Hobbs, F.D.R.; Padilla, F.; Arbetter, D.; Templeton, A.; Seegobin, S.; Kim, K.; Campos, J.A.S.; Arends, R.H.; Brodek, B.H.; et al. Efficacy and safety of intramuscular administration of tixagevimab–cilgavimab for early outpatient treatment of COVID-19 (TACKLE): A phase 3, randomised, double-blind, placebo-controlled trial. Lancet Respir. Med. 2022, 19, 985–996. [Google Scholar] [CrossRef]
- ACTIV-3/Therapeutics for Inpatients with COVID-19 (TICO) Study Group. Efficacy and safety of two neutralising monoclonal antibody therapies, sotrovimab and BRII-196 plus BRII-198, for adults hospitalised with COVID-19 (TICO): A randomised controlled trial. Lancet Infect. Dis. 2022, 22, 622–635. [Google Scholar] [CrossRef]
- Mouffak, S.; Shubbar, Q.; Saleh, E.; El-awady, R. Recent advances in management of COVID-19: A review. Biomed. Pharmacother. 2020, 143, 112107. [Google Scholar] [CrossRef]
- Biswas, I.; Khan, G.A. Coagulation Disorders in COVID-19: Role of Toll-like Receptors. J. Inflamm. Res. 2020, 13, 823–828. [Google Scholar] [CrossRef]
- Buicu, A.L.; Cernea, S.; Benedek, I.; Buicu, C.F.; Benedek, T. Systemic Inflammation and COVID-19 Mortality in Patients with Major Noncommunicable Diseases: Chronic Coronary Syndromes, Diabetes and Obesity. J. Clin. Med. 2021, 10, 1545. [Google Scholar] [CrossRef] [PubMed]
- Siddiqi, H.K.; Mehra, M.R. COVID-19 illness in native and immunosuppressed states: A clinical-therapeutic staging proposal. J. Heart Lung Transplant. 2020, 39, 405–407. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mehta, P.; McAuley, D.F.; Brown, M.; Sanchez, E.; Tattersall, R.S.; Manson, J.J.; HLH Across Speciality Collaboration, UK. COVID-19: Consider cytokine storm syndromes and immunosuppression. Lancet 2020, 395, 1033–1034. [Google Scholar] [CrossRef]
- Al-Samkari, H.; Karp Leaf, R.S.; Dzik, W.H.; Carlson, J.; Fogerty, A.E.; Waheed, A.; Goodarzi, K.; Bendapudi, P.K.; Bornikova, L.; Gupta, S.; et al. COVID-19 and coagulation: Bleeding and thrombotic manifestations of SARS-CoV-2 infection. Blood 2020, 136, 489–500. [Google Scholar] [CrossRef] [PubMed]
- Rad, P.; Milenković, M.; Dukić, M.; Rović, I.; Šijan, Đ.; Hadžibegović, A.; Popadić, V.; Klašnja, S.; Brajković, M.; Zdravković, M. Anticoagulants and corticosteroids in COVID-19—What do we know so far? Serb. Med. J. 2022, 3, 62–74. [Google Scholar] [CrossRef]
- Leucker, T.M.; Osburn, W.O.; Reventun, P.; Smith, K.; Claggett, B.; Kirwan, B.; Brouwer, S.; Williams, M.S.; Gerstenblith, G.; Hagar, D.N.; et al. Effect of Crizanlizumab, a P-Selectin Inhibitor, in COVID-19. JACC Basic Transl. Sci. 2021, 6, 935–945. [Google Scholar] [CrossRef]
- Strich, J.R.; Tian, X.; Samour, M.; King, C.S.; Shlobin, O.; Reger, R.; Cohen, J.; Ahmad, K.; Brown, A.W.; Khangoora, V.; et al. Fostamatinib for the Treatment of Hospitalized Adults with Coronavirus Disease 2019: A Randomized Trial. Clin. Infect. Dis. 2022, 75, 491–498. [Google Scholar] [CrossRef]
- Can Rigel’s Bleeding Disorder Drug Fostamatinib Cross over into COVID-19? Available online: https://www.clinicaltrialsarena.com/analysis/fostamatinib-vs-covid-19/ (accessed on 13 September 2022).
- Das, L.; Frost, R. SGLT2 inhibition and COVID-19: The road not taken. Eur. J. Clin. Investig. 2020, 50, e13339. [Google Scholar] [CrossRef]
- Koufakis, T.; Pavlidis, A.N.; Metallidis, S.; Kotsa, K. Sodium-glucose co-transporter 2 inhibitors in COVID-19: Meeting at the crossroads between heart, diabetes and infectious diseases. Int. J. Clin. Pharm. 2021, 43, 764–767. [Google Scholar] [CrossRef]
- Soni, S.; Dyck, J.R.B. The multiple effects of SGLT2 inhibitors suggest potential benefit in COVID-19 patients. Can. J. Cardiol. 2020, 36, 1691.e3. [Google Scholar] [CrossRef]
- Yang, D.; Li, H.; Chen, Y.; Ren, W.; Dong, M.; Li, C.; Jiao, Q. Immunomodulatory mechanisms of abatacept: A therapeutic strategy for COVID-19. Front. Med. 2019, 9, 951115. [Google Scholar] [CrossRef] [PubMed]
- Julià, A.; Bonafonte-Pardàs, I.; Gómez, A.; López-Lasanta, M.; López-Corbeto, M.; Martínez-Mateu, S.H.; Lladós, J.; Rodríguez-Nunez, I.; Myers, R.M.; Marsal, S. Targeting of the CD80/86 proinflammatory axis as a therapeutic strategy to prevent severe COVID-19. Sci. Rep. 2021, 11, 11462. [Google Scholar] [CrossRef] [PubMed]
- Immune Modulator Drugs Improved Survival for People Hospitalized with COVID-19. Available online: https://www.nih.gov/news-events/news-releases/immune-modulator-drugs-improved-survival-people-hospitalized-covid-19 (accessed on 13 September 2022).
- Yamaguchi, Y.; Takasawa, K.; Irabu, H.; Hiratoko, K.; Ichigi, Y.; Hirata, K.; Tamura, Y.; Murakoshi, M.; Yamashita, M.; Nakatani, H.; et al. Infliximab treatment for refractory COVID-19-associated multisystem inflammatory syndrome in a Japanese child. J. Infect. Chemother. 2022, 28, 814–818. [Google Scholar] [CrossRef] [PubMed]
- Abatacept, Infliximab Improved Survival in Adults Hospitalized with COVID-19. Available online: https://www.empr.com/home/news/drugs-in-the-pipeline/abatacept-infliximab-improved-survival-in-adults-hospitalized-with-covid-19/ (accessed on 13 September 2022).
- Reis, G.; dos Santos Moreira-Silva, A.E.; Medeiros Silva, M.D.; Thabane, L.; Milagres, A.C.; Ferreira, T.S.; Quirino, C.V.; Helena, V.; Nogueira, A.M.R.; Guimaraes, A.P.F.; et al. Articles Effect of early treatment with fluvoxamine on risk of emergency care and hospitalisation among patients with COVID-19: The TOGETHER randomised, platform clinical trial. Lancet 2022, 10, 42–51. [Google Scholar] [CrossRef]
- Hashimoto, Y.; Suzuki, T.; Hashimoto, K. Mechanisms of action of fluvoxamine for COVID-19: A historical review. Mol. Psychiatry 2022, 27, 1898–1907. [Google Scholar] [CrossRef]
- Lenze, E.J.; Mattar, C.; Zorumski, C.F.; Stevens, A.; Schweiger, J.; Nicol, G.E.; Miller, P.; Yang, L.; Yingling, M.; Avidan, M.S.; et al. Fluvoxamine vs Placebo and Clinical Deterioration in Outpatients with Symptomatic COVID-19: A Randomized Clinical Trial. JAMA 2020, 324, 2292–2300. [Google Scholar] [CrossRef]
- Marzolini, C.; Marra, F.; Boyle, A.; Khoo, S.; Back, D.J. Fluvoxamine for the treatment of COVID-19. Lancet Glob. Health 2021, 10, e331. [Google Scholar] [CrossRef]
- Lee, T.C.; Vigod, S.; Bortolussi-Courval, É.; Hanula, R.; Boulware, D.R.; Lenze, E.J.; Reiersen, A.M.; McDonald, E.G. Fluvoxamine for Outpatient Management of COVID-19 to Prevent Hospitalization: A Systematic Review and Meta-analysis. JAMA Netw. Open 2022, 5, e226269. [Google Scholar] [CrossRef]
- Junqueira, D.R.; Zorzela, L.M.; Perini, E. Unfractionated heparin versus low molecular weight heparins for avoiding heparin-induced thrombocytopenia in postoperative patients. Cochrane Database Syst. Rev. 2017, 4, CD007557. [Google Scholar] [CrossRef]
- Giossi, R.; Menichelli, D.; Pani, A.; Tratta, E.; Romandini, A.; Roncato, R.; Nani, A.; Schenardi, P.; Diani, E.; Fittipaldo, V.A.; et al. A Systematic Review and a Meta-Analysis Comparing Prophylactic and Therapeutic Low Molecular Weight Heparins for Mortality Reduction in 32688 COVID-19 Patients. Front. Pharmacol. 2021, 12, 2153. [Google Scholar] [CrossRef]
- Alsagaff, M.Y.; Mulia, E.; Maghfirah, I.; Azmi, Y.; Rachmi, D.A.; Yutha, A.; Andira, L.H.; Semedi, B.P. Low molecular weight heparin is associated with better outcomes than unfractionated heparin for thromboprophylaxis in hospitalized COVID-19 patients: A meta-analysis. Eur. Heart J. Qual. Care Clin. Outcomes 2022. [Google Scholar] [CrossRef] [PubMed]
- Volteas, P.; Drakos, P.; Alkadaa, L.N.; Cleri, N.A.; Asencio, A.A.; Oganov, A.; Giannopoulos, S.; Saadon, J.R.; Mikell, C.B., 3rd; Rubano, J.A.; et al. Low-molecular-weight heparin compared with unfractionated heparin in critically ill COVID-19 patients. J. Vasc. Surg. Venous Lymphat. Disord. 2022, 10, 1128–1136. [Google Scholar] [CrossRef] [PubMed]
- Bryant, A.; Lawrie, T.A.; Dowswell, T.; Fordham, E.J.; Mitchell, S.; Hill, S.R.; Tham, T.C. Ivermectin for Prevention and Treatment of COVID-19 Infection: A Systematic Review, Meta-analysis, and Trial Sequential Analysis to Inform Clinical Guidelines. Am. J. Ther. 2021, 28, 434–460. [Google Scholar] [CrossRef]
- Lim, S.C.L.; Hor, C.P.; Tay, K.H.; Jelani, A.M.; Tan, W.H.; Ker, H.B.; Chow, T.S.; Zaid, M.; Cheah, W.K.; Lim, H.H.; et al. Efficacy of Ivermectin Treatment on Disease Progression Among Adults with Mild to Moderate COVID-19 and Comorbidities The I-TECH Randomized Clinical Trial. JAMA Intern. Med. 2022, 182, 426–435. [Google Scholar] [CrossRef]
- Reis, G.; Silva, E.A.S.M.; Silva, D.C.M.; Thabane, L.; Milagres, A.C.; Ferreira, T.S.; Santos, C.V.Q.; Campos, V.H.S.; Nogueira, A.M.R.; Almeida, A.P.F.G.; et al. Effect of Early Treatment with Ivermectin among Patients with COVID-19. N. Engl. J. Med. 2022, 386, 1721–1731. [Google Scholar] [CrossRef] [PubMed]
- Mehta, J.; Rolta, R.; Mehta, B.B.; Kaushik, N.; Choi, E.H.; Kaushik, N.K. Role of Dexamethasone and Methylprednisolone Corticosteroids in Coronavirus Disease 2019 Hospitalized Patients: A Review. Front. Microbiol. 2022, 13, 813358. [Google Scholar] [CrossRef] [PubMed]
- Tomazini, B.M.; Maia, I.S.; Cavalcanti, A.B.; Berwanger, O.; Rosa, R.G.; Veiga, V.C.; Avezum, A.; Lopes, R.D.; Bueno, F.R.; Silva, M.V.A.O.; et al. Effect of Dexamethasone on Days Alive and Ventilator-Free in Patients with Moderate or Severe Acute Respiratory Distress Syndrome and COVID-19: The CoDEX Randomized Clinical Trial. JAMA 2020, 324, 1307–1316. [Google Scholar] [CrossRef]
- The RECOVERY Collaborative Group. Dexamethasone in Hospitalized Patients with COVID-19. N. Engl. J. Med. 2021, 384, 693–704. [Google Scholar] [CrossRef]
- The COVID STEROID 2 Trial Group. Effect of 12 mg vs 6 mg of Dexamethasone on the Number of Days Alive Without Life Support in Adults With COVID-19 and Severe Hypoxemia: The COVID STEROID 2 Randomized Trial. JAMA 2021, 326, 1807–1817. [Google Scholar] [CrossRef]
- Cao, L.; Goreshnik, I.; Coventry, B.; Case, J.B.; Miller, L.; Walls, A.C.; Park, Y.; Strauch, E.; Stewart, L.; Diamond, M.S.; et al. De novo design of picomolar SARS-CoV-2 miniprotein inhibitors. Science 2020, 370, 426–431. [Google Scholar] [CrossRef]
- Wolfe, M.; Webb, S.; Chushak, Y.; Krabacher, R.; Liu, Y.; Swami, N.; Harbaugh, S.; Chávez, J. A high-throughput pipeline for design and selection of peptides targeting the SARS-CoV-2 Spike protein. Sci. Rep. 2021, 11, 21768. [Google Scholar] [CrossRef] [PubMed]
- Curreli, F.; Victor, S.M.B.; Ahmed, S.; Drelich, A.; Tong, X.; Tseng, C.T.K.; Hillyer, C.; Debnath, A.K. Stapled peptides based on human angiotensin-converting enzyme 2 (ACE2) potently inhibit SARS-CoV-2 infection in vitro. MBio 2020, 11, e02451-20. [Google Scholar] [CrossRef] [PubMed]
- Karoyan, P.; Vieillard, V.; Gómez-Morales, L.; Odile, E.; Guihot, A.; Luyt, C.E.; Denis, A.; Grondin, P.; Lequin, O. Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection. Commun. Biol. 2021, 4, 197. [Google Scholar] [CrossRef] [PubMed]
- Chen, J.; Li, S.; Lei, Z.; Tang, Q.; Mo, L.; Zhao, X.; Xie, F.; Zi, D.; Tan, J. Inhibition of SARS-CoV-2 pseudovirus invasion by ace2 protecting and spike neutralizing peptides: An alternative approach to covid19 prevention and therapy. Int. J. Biol. Sci. 2021, 17, 2957–2969. [Google Scholar] [CrossRef]
- Xia, S.; Liu, M.; Wang, C.; Xu, W.; Lan, Q.; Feng, S.; Qi, F.; Bao, L.; Du, L.; Liu, S.; et al. Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. Cell Res. 2020, 30, 343–355. [Google Scholar] [CrossRef] [Green Version]
- Vries, R.D.; De Schmitz, K.S.; Bovier, F.T.; Predella, C.; Khao, J.; Noack, D.; Haagmans, B.L.; Herfst, S.; Stearns, K.N.; Drew-Bear, J.; et al. Intranasal fusion inhibitory lipopeptide prevents direct-contact SARS-CoV-2 transmission in Ferrets. Science 2021, 371, 1379–1382. [Google Scholar] [CrossRef]
- Bestle, D.; Heindl, M.R.; Limburg, H.; van Lam, T.V.; Pilgram, O.; Moulton, H.; Stein, D.A.; Hardes, K.; Eickmann, M.; Dolnik, O.; et al. TMPRSS2 and furin are both essential for proteolytic activation of SARS-CoV-2 in human airway cells. Life Sci. Alliance 2020, 3, e202000786. [Google Scholar] [CrossRef]
- Cheng, Y.W.; Chao, T.L.; Li, C.L.; Chiu, M.F.; Kao, H.C.; Wang, S.H.; Pang, Y.H.; Lin, C.H.; Tsai, Y.M.; Lee, W.H.; et al. Furin Inhibitors Block SARS-CoV-2 Spike Protein Cleavage to Suppress Virus Production and Cytopathic Effects. Cell Rep. 2020, 33, 108254. [Google Scholar] [CrossRef]
- Zhang, J.; Ma, X.; Yu, F.; Liu, J.; Zou, F.; Pan, T.; Zhang, H. Teicoplanin potently blocks the cell entry of 2019-nCoV. bioRxiv 2020. [Google Scholar] [CrossRef] [Green Version]
- Ghahremanpour, M.M.; Tirado-Rives, J.; Deshmukh, M.; Ippolito, J.A.; Zhang, C.H.; Cabeza De Vaca, I.; Liosi, M.; Anderson, K.S.; Jorgensen, W.L. Identification of 14 Known Drugs as Inhibitors of the Main Protease of SARS-CoV-2. ACS Med. Chem. Lett. 2020, 11, 2526–2533. [Google Scholar] [CrossRef]
- Chan, H.T.H.; Moesser, M.A.; Walters, R.K.; Malla, T.R.; Twidale, R.M.; John, T.; Deeks, H.M.; Johnston-Wood, T.; Mikhailov, V.; Sessions, R.B.; et al. Discovery of SARS-CoV-2 Mpropeptide inhibitors from modelling substrate and ligand binding. Chem. Sci. 2021, 12, 13686–13703. [Google Scholar] [CrossRef]
- Jin, Z.; Du, X.; Xu, Y.; Deng, Y.; Liu, M.; Zhao, Y.; Zhang, B.; Li, X.; Zhang, L.; Peng, C.; et al. Structure of Mpro from SARS-CoV-2 and discovery of its inhibitors. Nature 2020, 582, 289–293. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tripathi, K.P.; Upadhyay, S.; Singh, M.; Raghavendhar, S.; Bhardwaj, M. Screening and evaluation of approved drugs as inhibitors of main protease of SARS-CoV-2. Int. J. Biol. Macromol. 2020, 164, 2622–2631. [Google Scholar] [CrossRef] [PubMed]
- Huang, Y.; Yang, C.; Xu, X.F.; Xu, W.; Liu, S.W. Structural and functional properties of SARS-CoV-2 spike protein: Potential antivirus drug development for COVID-19. Acta Pharmacol. Sin. 2020, 41, 1141–1149. [Google Scholar] [CrossRef] [PubMed]
- SARS-CoV-2 Variants of Concern as of 25 May 2022. Available online: https://www.ecdc.europa.eu/en/covid-19/variants-concern (accessed on 31 May 2022).
- Thomas, G. Furin at the cutting edge: From protein traffic to embryogenesis and disease. Mol. Cell 2007, 3, 753–766. [Google Scholar] [CrossRef]
- Kirschke, H.; Cathepsin, L. Handbook of Proteolytic Enzymes, 3rd ed.; Rawlings, N.D., Salvesen, G., Eds.; Academic Press: London, UK, 2013; Volume 2, pp. 1808–1817. [Google Scholar]
Type | Drug | Treatment Target |
---|---|---|
FDA approved | Remdesivir | Adults and children (≥28 days of age and weighing at least 3 kg), hospitalised or not hospitalised, who have mild to moderate COVID-19 and are at high risk of developing severe diseases that could necessitate hospitalisation or even death |
Baricitinib | Hospitalised adults who require mechanical ventilation, extracorporeal membrane oxygenation (ECMO), or oxygen supplementation | |
FDA–EUA authorised | Baricitinib | Paediatric patients of 2 to 18 years old who require mechanical ventilation, extracorporeal membrane oxygenation (ECMO), or oxygen supplementation |
Molnupiravir | Adults with mild to moderate COVID-19 | |
Ritonavir and nirmatrelvir | Adults and paediatric patients (12 years and older and weighing at least 40 kg) with mild to moderate COVID-19 | |
Tocilizumab | Hospitalised adults and paediatric patients (2 years and older) receiving systemic corticosteroids | |
Bebtelovimab | Adults and paediatric patients (12 years and older and weighing at least 40 kg) with mild to moderate COVID-19 |
Type | Drug | Clinical Trial |
---|---|---|
Monoclonal Antibody | SkyrisiTM (risankizumab) for inpatient. | Phase 2 |
Lenzilumab for inpatient. | Phase 2 | |
LY-CoV555 for outpatient. | Phase 2/3 | |
AZD7442 for outpatient. | Phase 2/3 | |
BRII-196 and BRII-198 for outpatient. | Phase 2/3 | |
AZD7442 for inpatient. | Phase 3 | |
Crizanlizumab for inpatient. | Phase 4 | |
Factor D Inhibitor | Danicopan for inpatient. | Phase 2 |
Spleen Tyrosine Kinase (SYK) Inhibitor | Fostamatinib. | Phase 3 |
Sodium/glucose cotransporter-2 inhibitor | SGLT2i. | Phase 4 |
Immune Modulators | Orencia® (abatacept) for inpatients. | Phase 3 |
Remicade® (infliximab) for inpatients. | Phase 3 | |
Immune Modulators/Antiviral | Fluvoxamine for outpatient. | Phase 3 |
Ivermectin 600 mcg for outpatient. | Phase 3 | |
Anticoagulants | Unfractionated (UF) and Low Molecular Weight (LMW) heparin for inpatients. | Phase 4 |
Others | Convalescent Plasma for inpatient. | Phase 2 |
Veklury® (remdesivir) for inpatient. | Phase 3 | |
Veklury® (remdesivir) and Olumiant® (baricitinib) for inpatients. | Phase 3 |
Peptides | Peptide Sequence | KD | IC50 | Toxicity | In vivo Models | Reference |
---|---|---|---|---|---|---|
Peptides are designed to target the RBD of S protein. | ||||||
AHB1 | DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVRELEEQVMHVLDQVSELAHELLHKLTGEELERAAYFNWWATEMMLELIKSDDEREIREIEEEARRILEHLEELARK | - | 35 nM | - | - | [66] |
AHB2 | ELEEQVMHVLDQVSELAHELLHKLTGEELERAAYFNWWATEMMLELIKSDDEREIREIEEEARRILEHLEELARK | - | 15.5 nM | - | - | |
LCB1 | DKEWILQKIYEIMRLLDELGHAEASMRVSDLIYEFMKKGDERLLEEAERLLEEVER | - | 23.54 pM | - | - | |
LCB3 | NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLS | - | 48.1 pM | - | - | |
P89 | DWTLFLFVFNLEWEDLFY | 124 nM | - | - | - | [67] |
P100 | KTEWDKWMHMYYEIFYED | 185 nM | - | - | - | |
P168 | NFDILLFVFNYEMEDKFY | 143 nM | - | - | - | |
P180 | KTDWDMFSHWMEIYFYVI | 243 nM | - | - | - | |
NYBSP-4 * | - | 2.2 µM | 1.97–2.8 µM | No | - | [68] |
P8 | SALEEQLKTFLDKFMHELEDLLYQLAL | 24 nM | 46 nM | No | - | [69] |
P9 | SALEEQYKTFLDKFMHELEDLLYQLSL | 0.09 nM | 53 nM | No | - | |
P10 | SALEEQYKTFLDKFMHELEDLLYQLAL | 0.03 nM | 42 nM | No | - | |
AYn1 | KKKKKKDKFNHEAEDLFY | 95.6 nM | 4.9 µM | No | Not satisfactory | [70] |
Peptides are designed to target HR1 and HR2 of SARS-CoV-2. | ||||||
EK1C4 | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL-GSGSG-PEG4-C(chol) | - | 36.5 nM | No | - | [71] |
EKL1C | NVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTVEY-GSG-C(Chol) | - | 3 nM | No | Reduce SARS-CoV-2 titer | |
[SARSHRC-PEG4]2-chol | [DISGINASWNIQKEIDRLNEVAKNLNESLIDLQEL-PEG4]2-chol | - | ~300 nM and ~5 nM | No | - | [72] |
Inhibitors | Inhibitory Effect | Reference |
---|---|---|
TMPRSS2 inhibitors: | ||
MI-432 | Suppresses replication of SARS-CoV-2 in Calu-3 cells | [73] |
MI-1900 | ||
Aprotinin | ||
Camostat | Decreases SARS-CoV-2 production in Vero-E6 cells | [74] |
Furin inhibitors: | ||
MI-1851 | Suppresses replication of SARS-CoV-2 in Calu-3 cells | [73] |
CMK | Decreases SARS-CoV-2 production in Vero-E6 cells | [74] |
Naphthofluorescein | ||
Cathepsin L inhibitor: | ||
Teicoplanin | Inhibits SARS-CoV-2 pseudotyped virus entry in HEK293T and Huh7 cells | [75] |
SARS-CoV-2 main protease inhibitors: | ||
Manidipine | IC50 = 4.81 µM | [76] |
Boceprevir | IC50 = 5.4 µM | |
Lercanidipine | IC50 = 16.2 µM | |
Efonidipine | IC50 = 38.5 µM | |
Bedaquiline | IC50 = 18.7 µM | |
p12 | IC50 = 5.36 µM | [77] |
p13 | IC50 = 3.11 µM | |
p15 | IC50 = 5.31 µM | |
p16 | IC50 = 3.76 µM | |
Ebselen | Antiviral effects in Vero cells infected with SARS-CoV-2 | [78] |
N3 | ||
Teicoplanin | IC50 = 1.5 µM | [79] |
SARS-CoV-2 Variant | Mutation on RBD | Mutation near S1/S2 Cleavage Site | Mutation on Other Sites |
---|---|---|---|
Alpha | N501Y | P681H | D614G |
Beta | K417N, E484K, N501Y | - | D614G, A701V |
Gamma | K417T, E484K, N501Y | - | D614G, H655Y |
Delta | L452R, T478K | P681R | D614G |
Omicron | G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H | P681H | A67V, Δ69-70, T95I, G142D, Δ143-145, N211I, Δ212, ins215EPE, T547K, D614G, H655Y, N679K, N764K, D796Y, N856K, Q954H, N969K, L981F |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ho, C.; Lee, P.-C. COVID-19 Treatment—Current Status, Advances, and Gap. Pathogens 2022, 11, 1201. https://doi.org/10.3390/pathogens11101201
Ho C, Lee P-C. COVID-19 Treatment—Current Status, Advances, and Gap. Pathogens. 2022; 11(10):1201. https://doi.org/10.3390/pathogens11101201
Chicago/Turabian StyleHo, Chian, and Ping-Chin Lee. 2022. "COVID-19 Treatment—Current Status, Advances, and Gap" Pathogens 11, no. 10: 1201. https://doi.org/10.3390/pathogens11101201