Next Article in Journal
Severe Elimination Disorders and Normal Intelligence in a Case of MAP1B Related Syndrome: A Case Report
Previous Article in Journal
Customized Chromosomal Microarrays for Neurodevelopmental Disorders
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Comparative Genomic Analysis of Lactiplantibacillus plantarum: Insights into Its Genetic Diversity, Metabolic Function, and Antibiotic Resistance

1
College of Veterinary Medicine, Northeast Agricultural University, Harbin 150030, China
2
College of Animal Science and Technology, Northeast Agricultural University, Harbin 150030, China
*
Author to whom correspondence should be addressed.
Genes 2025, 16(8), 869; https://doi.org/10.3390/genes16080869
Submission received: 30 June 2025 / Revised: 19 July 2025 / Accepted: 22 July 2025 / Published: 24 July 2025
(This article belongs to the Section Microbial Genetics and Genomics)

Abstract

Background/Objectives: Lactiplantibacillus plantarum is widely utilized in the fermentation industry and offers potential health benefits. However, large-scale comparative genomic analyses aimed at exploring its metabolic functions and conducting safety assessments are still lacking. Methods: In this study, we performed a comparative genomic analysis of 324 L. plantarum strains sourced from various origins and geographical locations. Results: The results revealed that L. plantarum possesses a total of 2403 core genes, of which 12.3% have an unknown function. The phylogenetic analysis revealed a mixed distribution from various origins, suggesting complex transmission pathways. The metabolic analysis demonstrated that L. plantarum strains can produce several beneficial metabolites, including lysine, acetate, and riboflavin. Furthermore, L. plantarum is highly capable of degrading various carbohydrates and proteins, increasing its adaptability. Further, we profiled the antimicrobial peptides (AMPs) in the genomes of L. plantarum. We identified a widely distributed AMP and its variants, presenting in a total of 280 genomes. In our biosafety assessment of L. plantarum, we identified several antibiotic resistance genes, such as Tet(M), ANT(6)-Ia, and mdeA, which may have potential for horizontal gene transfer within the Lactobacillaceae family. Conclusions: This study provides genomic insights into the genetic diversity, metabolic functions, antimicrobial properties, and biosafety of L. plantarum, underscoring its potential applications in biotechnology and environmental adaptation.

1. Introduction

Lactiplantibacillus plantarum, formerly known as Lactobacillus plantarum, is a species of lactic acid bacteria that can be isolated from a variety of sources, including humans, animals, grass silage, kimchi, pickled cabbage, cheese, etc. [1]. This bacterium can metabolize pentose and hexose sugars to produce lactic acid, carbon dioxide, and either acetate or ethanol [2]. Thus, it plays a crucial role in the fermentation of foods such as sauerkraut, kimchi, pickles, and dairy products [3]. In addition to being an important component in food fermentation, L. plantarum also functions as a probiotic, enhancing human health. For example, L. plantarum L168 has been shown to have several beneficial properties, including restoring the structure of the gut microbiota, modulating the concentration of the neurotransmitter serotonin, and improving impaired behavior [4].
The widespread application of L. plantarum in the food industry and its potential as a probiotic necessitate a comprehensive understanding of its genetic diversity, phylogenetic relationships, and functional characteristics. In recent years, advancements in next-generation sequencing technologies have facilitated numerous genomic studies of L. plantarum strains, providing deep insights. In the genome of L. plantarum LP-F1, a total of 130 enzymes related to carbohydrate metabolism were identified, highlighting its significant capacity for carbohydrate utilization [5]. A genomic analysis of L. plantarum L125 revealed the presence of an incomplete plataricin gene cluster, with no bacteriocin-like activity detected [6]. Additionally, a genomic analysis of L. plantarum BRD3A suggested its potential to produce bacteriocins such as plantaricin E, lantaricin F, and enterocin X [7]. Furthermore, the genomic analyses also indicated a higher prevalence of antimicrobial resistance genes in 212 L. plantarum genomes, particularly those associated with tetracycline-resistance [8].
With the accumulation of L. plantarum genomes, a comparative genomic analysis would be helpful in providing a comprehensive overview of their characteristics. Garcia-Gonzalez and colleagues conducted a comparative genomic analysis of 42 L. plantarum strains to gain insights into their probiotic properties [9]. Similarly, Evanovich and colleagues also performed a study that did not identify any antibiotic resistance genes (ARGs) in the L. plantarum genome [10]. A recent investigation evaluated the antibiotic resistance patterns of L. plantarum strains, revealing the presence of resistance to ampicillin [11]. Martino and colleagues noted a loose connection between the distribution and source of L. plantarum [12], which may be attributed to the insufficient number of genomes available. With the increasing number of genomes, there is an opportunity for large-scale comparative genomic analyses to reevaluate these relationships.
In this study, we collected a total of 324 complete genomes of L. plantarum strains from NCBI, which were isolated from various sources across six continents. A comprehensive genomic analysis was conducted to explore the genomic characteristics, phylogenetic relationships, metabolic functions, and biosafety of these strains. The findings of this study provide valuable insights into the probiotic properties and biosafety of L. plantarum, offering a scientific basis for its application in the food industry and probiotic development.

2. Materials and Methods

2.1. Collection of Microbial Genomes

To better understand the genomic characteristics of L. plantarum, a total of 324 complete genomes (as of 29 March 2025) were deposited in the National Center for Biotechnology Information (NCBI, Supplementary Table S1). To further confirm the quality of these genomes, we utilized GTDB-Tk v2.4.0 [13] and checkM2 v1.0.1 [14] to verify the taxonomic classification and genome quality, respectively. The phylogenetic relationships among different strains and plasmids were calculated using average nucleotide identity (ANI) with pyani v0.2.3 [15]. These genomes were subsequently annotated with Prokka v1.14.6 [16], which identified open reading frames for downstream analyses.

2.2. Construction of the Phylogenetic Tree

A pan-genome analysis of the 324 genomes was conducted using Panaroo v1.14.6 [17] to explore the genetic diversity and identify core and accessory genes within the L. plantarum strains. The functional annotations of the core genes were performed using eggNOG v2.1.12 [18].
We then constructed the phylogenetic tree using IQ-TREE2 v2.1.4-beta [19], which is based on the core genome alignment with the parameters of “-m TEST -B 1000 -bnni”. The phylogenetic tree was further clustered using fastBAPS [20].

2.3. Prediction of Metabolic Profiles

Functional annotations of the L. plantarum genomes were conducted using the metabolic-G.pl program in METABOLIC v4.0 [21], which integrates the Kyoto Encyclopedia of Genes and Genomes (KEGG), TIGRfam, Pfam, dbCAN2, and MEROPS databases. This process includes a protein motif validation step to evaluate the presence of metabolic pathways on the basis of KEGG modules. The annotations were subsequently manually reviewed for the presence of KEGG modules, carbohydrate-active enzymes (CAZymes), peptidases, and their inhibitors.

2.4. In Silico Analysis of Virulence Genes and Antimicrobial Resistance and Their Associated Mobile Genetic Elements (MGEs)

Virulence genes were annotated using ABRicate (https://github.com/tseemann/abricate (accessed on 6 March 2025)) against the Virulence Factor Database using the default parameters [22]. ARGs were annotated using the Comprehensive Antibiotic Resistance Database (CARD, v6.0.2) [23]. To reduce the number of potential false positives, only perfect and strict hits were retained. To establish links between these genes and MGEs, a detailed analysis of the L. plantarum-associated prophage fragments and plasmids was conducted. First, we used geNomad v1.5.2 [24] and VITAP v1.7.1 [25] to identify the prophage fragments and perform the taxonomic classification. We then typed these plasmids using the function “mob_typer” embedded in the software MOB-suite v3.1.0 [26].

2.5. In Silico Analysis of Antimicrobial Peptides (AMPs)

Macrel v1.3.0 [27] was run directly on the genomes to identify the AMPs. To assess the novelty of the predicted AMPs, we manually constructed an AMP database comprising 44,406 AMPs sourced from five existing AMP databases [28,29,30,31,32]. Subsequently, the identified AMPs were queried against the curated AMP database with blastp v2.10.0+ [33]. Nonredundant AMP sequences were then clustered using CD-HIT v4.8.1 [34], with an identity of over 70%. The amino acid sequences of AMPs, which belong to the same cluster, were aligned using MUSCLE v3.8.31 with the default parameters [35]. The alignments were then used to construct phylogenetic trees using IQ-TREE2. To better understand the potential effects of the changes to the AMP sequences, APEX [36] was used to predict the species-specific antimicrobial activities of the AMPs, which were measured by the minimum inhibitory concentration (MIC) against 34 type strains.

2.6. Statistics and Visualization

The data in this study were expressed as the mean ± SD. The phylogenetic trees were visualized using iTOL v7 [37]. Circular genome maps of ARG-carrying plasmids were visualized using Proksee [38]. The other visualizations were constructed using R software v4.3.1, primarily with the pheatmap v1.0.12 [39] and ggplot2 v3.4.4 [40] packages. Pairwise comparisons between different groups were performed using the “pairwise.wilcoxon.test” function in R.

3. Results

3.1. Strain Information and Genome Characteristics

In this study, we collected a total of 324 complete L. plantarum genome sequences from NCBI (Supplementary Table S1). These strains were isolated from a variety of sources, including human-related samples (n = 62), fermented foods (n = 138), animal-related samples (n = 56), plants (n = 26), the environment (n = 7), and other sources (n = 35). The samples were distributed across six continents: Asia, Europe, North America, South America, Oceania, and Africa. These genome sizes ranged from 2,793,376 bp to 3,687,306 bp, with an average length of 3,305,355 bp. The genomes contained an average of 2.9 ± 2.8 plasmids, accounting for an average of 101,908 ± 98,232 bp.
The pan-genome analysis revealed that these genomes contained a total of 12,416 genes, of which 2403 were classified as core genes, including both core genes and soft-core genes (Table 1). The five most common COG categories of the core genes were classified as the following: [S] function unknown (12.3%); [K] transcription (6.0%); [E] amino acid transport and metabolism (5.5%); [J] translation, ribosomal structure, and biogenesis (4.6%); and [G] carbohydrate transport and metabolism (4.5%).

3.2. Phylogenetic Analysis Reveals Complex Transmission Pathways

To investigate the phylogenetic relationships among the L. plantarum strains, a phylogenetic tree was constructed on the basis of the core genome, and the strains were grouped into seven different clusters (Figure 1). Three larger clusters were observed in the phylogenetic tree, consisting of 188 genomes in cluster 1, 82 genomes in cluster 7, and 39 genomes in cluster 2. From a host perspective, these three larger clusters included the strains from all five specific hosts included in this study, indicating no preference for any particular host (Supplementary Figure S1). From a geographical perspective, strains from other continents were distributed sporadically across the three larger clusters. This suggests a wider distribution of these genetically related strains. Additionally, there were no obvious associations between the host and the cluster, potentially because of the frequent transmission among various origins.

3.3. Key Metabolic Functions Revealed by the Presence of KEGG Modules in L. plantarum

Different strains of the same species may exhibit different metabolic functions and modulate host physiology by producing various metabolites. To better understand the potential production of metabolites, we further explored their metabolic functions by analyzing the presence of the KEGG modules. A total of 41 KEGG modules, belonging to 17 categories, were found in the 324 genomes (Supplementary Figure S2). These KEGG modules were involved mainly in the following categories: central carbohydrate metabolism (n = 8), cofactor and vitamin metabolism (n = 7), purine metabolism (n = 4), other carbohydrate metabolism (n = 4), arginine and proline metabolism (n = 4), etc. A total of 30 out of the 41 KEGG modules were found in most strains (≥ 95%). The presence of these modules indicates that L. plantarum can produce various metabolites, including lysine (M00525), acetate (M00579), inosine monophosphate (IMP, M00048), riboflavin (M00125), and tetrahydrofolate (M00126). And a large proportion of L. plantarum strains (n = 304, 93.8%) could also produce histidine (M00026), a conditionally essential amino acid, suggesting the existence of heterogeneity.
We then compared the differences in the KEGG modules between strains from various origins. This revealed that the KEGG modules of human-derived L. plantarum were similar to those of L. plantarum from animal and fermented food sources. Compared with the environmental samples (100.0%), human-, animal-, and fermented food-derived samples presented lower proportions of C1-unit interconversion (M00140), ranging from 66.1% to 76.8%. Conversely, compared with the environmental samples (71.4%), the human-, animal-, and fermented food-derived samples presented higher proportions of chorismate production (M00022), ranging from 92.0% to 94.6% (Figure 2a). Certain KEGG modules were also present in some strains from human, animal, and fermented food sources and also contained certain KEGG modules (Figure 2b), including methionine degradation (M00035), lysine biosynthesis (M00031), and ornithine biosynthesis (M00763). These findings suggest that human-derived strains may be acquired from fermented foods and animals.

3.4. Profile of Glycoside Hydrolases (GHs) Reveals the Ability to Degrade a Variety of Carbohydrates

L. plantarum strains typically possess many genes encoding GHs, which help them to adapt to diverse environments. An annotation of the CAZymes revealed that L. plantarum can encode at least 28 different GH families, 11 of which are present in most strains (≥95.0%) (Figure 3a). Notably, some GH families are not only prevalent in L. plantarum but also have multiple copies, which help to degrade carbohydrates (Figure 3b). For example, eight GH families were present in all strains: GH1 (β-glucosidases and β-galactosidases), GH2 (β-galactosidases, β-mannosidases, exo-β-glucosaminidases), GH13 (α-glucosides), GH25 (lysozymes), GH36 (α-galactosidases and α-N-acetylgalactosaminidases), GH65 (phosphorylases), GH73 (α-N-acetylglucosaminidases), and GH170 (6-phospho-N-acetylmeramidases). The average number of copies of the eight GH families in the 324 genomes ranged from 1.0 to 10.5. Interestingly, each genome contained an average of 10.5 copies of GH13 and 9.3 copies of GH1.
For each genome, the average number of GH families across the 324 genomes was 49.5, with a range of 26 to 60. There was no significant difference among the strains from different sources. Additionally, the strains that are isolated from North America exhibited a higher number of GHs than those from Asia (Figure 3c,d)

3.5. Profile of Protease Types Reveals Their Ability to Degrade or Modify a Variety of Proteins

In microbes, peptidases are crucial enzymes that degrade proteins to acquire nutrients, process essential cellular components, and often play key roles in virulence, the stress response, and environmental adaptation. A total of 51 different protease families distributed across seven protease types were detected in the L. plantarum genomes (Figure 4a). Metallo-, serine- and cysteine-peptidases were common members of the L. plantarum genome. Among these three peptidases, there were eight, nine, and six families found in the metallo-, serine-, and cysteine-type peptidases, respectively. These may be essential components of the L. plantarum genome. Moreover, the inhibitor I87 was detected in all L. plantarum genomes. Interestingly, the average number of copies of C26 per L. plantarum genome was 9.0 (Figure 4b), which is often involved in the turnover of folyl poly-gamma-glutamates.

3.6. The Antimicrobial Peptide (AMP) Facilitates the Antimicrobial Properties of L. plantarum

L. plantarum can produce AMPs that inhibit the growth of other bacteria. Therefore, we predicted which AMPs L. plantarum may harbor. AMP sequences were found in a total of 303 out of 324 genomes (93.5%, Figure 5a). On average, each genome from different origins contained an average number of 1.5 to 1.9 AMP sequences (Figure 5b). These AMPs belong to 77 different sequence types. The more common AMP sequence type was “VTGRLAVTLVGAPGPYVALIKTK”, which was found in 201 strains, and its mutant A18V, which was found in 62 strains (Figure 5c). To further verify the novelty of the 77 AMPs, we compared them against the known AMPs (n = 44,406). These results indicated that only one AMP sequence from L. plantarum SRCM100995 was identical to a partial sequence (50/62) of an existing AMP (L12A07947) recorded in the LAMP2 database. The remaining sequences exhibited identities ranging from 23.3% to 96.0%. Notably, the most prevalent AMP (n = 201) demonstrated an identity of no more than 70.0% when compared to the known AMPs. These findings indicate that these AMPs are commonly carried by L. plantarum. Furthermore, we clustered these AMP sequences on the basis of a cut-off of 70.0% identity, forming 31 clusters. To further explore the sequence differences within the clusters, we constructed phylogenetic trees of AMPs from the same cluster and predicted their antimicrobial activity. The results revealed that, of the cluster represented by “VTGRLAVTLVGAPGPYVALIKTK” (n = 201), the variant A18V (n = 62) exhibited stronger antibacterial activity than the others (Figure 5d and Supplementary Table S3). In the cluster represented by “IATAILWAIKFMIVSFVGNVVVKLIKNPRRYFGM” (n = 31), a number of 38 different AMP sequence types were found (Figure 5e). Among these mutations, the main mutation types were associated with a certain degree of decrease in antimicrobial activity.

3.7. Plasmids Mediate the Transmission of Antibiotic Resistance Genes Within the Lactobacillaceae Family

As probiotics, biosafety is an important aspect that should be considered. Therefore, we first scanned the genomes for virulence factors and found no positive hits. We then explored the ARGs harbored in the genome and identified a total of six ARGs. Two of these (vanH and vanY) were found in almost all strains, except for those from the plant-related samples, of which the percentage of vanH-positive strains was 96.2% (Figure 6a). Another ARG, vanT, which confers vancomycin resistance, was present in 10.7% of the animal-derived strains and in 28.6% of the environmental strains. In addition to the vancomycin resistance genes, the Tet(M), ANT(6)-Ia, and mdeA genes, which mediate tetracycline, aminoglycoside, and multidrug resistance, respectively, were also identified in these strains.
To determine whether these genes are mobile, we analyzed their associations with phages and plasmids. The results revealed that three plasmids carried the Tet(M) gene. Among these, the plasmid in L. plantarum ST could be transferred within the Lactobacillaceae family, as could the plasmid carrying the ANT(6)-Ia gene in L. plantarum 12_3. The plasmid carrying the mdeA gene in L. plantarum MWLp-12 could also potentially undergo transfer (Figure 6b and Table 2). We also identified prophage sequences in the genomes, finding an average of one to seven fragments per genome belonging to the genus Duplodnaviria (Supplementary Table S4). Additionally, no ARGs were detected in the prophage fragments.

4. Discussion

In this study, we conducted a comparative genomic analysis of 324 complete L. plantarum genomes. The key findings of this study are as follows: (1) the strains were distributed unevenly from various origins; (2) L. plantarum may be able to produce some beneficial metabolites for hosts; (3) there was a high diversity of CAZymes and proteases in the L. plantarum genomes; (4) a large proportion of L. plantarum could produce AMPs as probiotics; and (5) the plasmid-mediated transmission of ARGs within the Lactobacillaceae family requires more attention in the future.
Our research revealed that L. plantarum has a total of 2403 core genome genes, which is higher than that of other Lactobacillus species, as reported [41,42]. These findings suggest that these genes are important for the survival of L. plantarum. Notably, among these core genes, 12.3% of these core genes have unknown functions, and their role in the survival of L. plantarum requires additional research, such as the use of the CRISPRi system [43].
The construction of phylogenetic trees can help us to better understand how different strains of the same species are transmitted from various sources. Previous evolutionary tree analyses of 54 L. plantarum strains did not reveal a close connection between the strains and their origins [12]. Our more extensive analysis similarly uncovered no inherent connections, indicating that L. plantarum sourced from diverse origins is disseminated via a multitude of pathways. For instance, plant-derived L. plantarum can be further transmitted to humans via the fermentation enrichment of fermented foods. However, the ability of colonization of the strains from fermented foods needs to be studies in the future.
Microorganisms in the gastrointestinal tract can synthesize essential amino acids de novo to maintain amino acid homeostasis in the host [44]. We found that L. plantarum can synthesize several essential amino acids for humans, including threonine, arginine, and lysine, which are crucial for maintaining the body’s amino acid balance. Additionally, L. plantarum can also synthesize histidine, a conditionally essential amino acid that helps maintain nutritional balance in early infancy [45]. The supplementary of essential amino acids to hosts may bring benefits to hosts.
In addition to essential amino acids, L. plantarum can also synthesize various beneficial compounds. For example, it can produce IMP due to the presence of M00048. IMP enhances the flavor of fermented foods as a flavoring substance [46]. The genome of L. plantarum has also been found to metabolize and produce acetic acid, which inhibits the proliferation of pathogenic bacteria during fermentation and aids in enhancing the resistance of the host to pathogenic infections and regulating the immune system [47]. The presence of the thiamine salvage pathway results in the production of thiamine (vitamin B1). Thiamine is essential for all living organisms because its active form, thiamine pyrophosphate, is an indispensable cofactor for enzymes that are involved in amino acid and carbohydrate metabolism [48].
An analysis of the CAZymes in L. plantarum indicates that it is a highly adaptable heterotroph that can utilize various complex carbohydrates as energy sources. For example, GH13 and GH1 are essential for the metabolism of complex carbohydrates [49], and multiple genes from these families increase the degradation ability. Additionally, the presence of various proteases not only helps L. plantarum to utilize different proteins effectively but also helps the host to digest and absorb proteins. These results suggest that L. plantarum has strong capabilities for utilizing polysaccharides and proteins, which endows it with significant environmental adaptability and assists the host in the digestion and absorption of nutrients.
As a probiotic, research has shown that its main mechanism of action is producing antimicrobial peptides. We found that L. plantarum primarily produces two types of antimicrobial peptides, represented by “VTGRLAVTLVGAPGPYVALIKTK” and “IATAILWAIKFMIVSFVGNVVVKLIKNPRRYFGM”. These two AMPs are not recorded in any antimicrobial peptide database. Furthermore, the antimicrobial activity of these mutants exhibits some degree of variability, which could impact strain selection during use.
We also analyzed the virulence factors and antibiotic resistance genes carried by the bacterium and found that our results are consistent with those of previous reports, indicating that there are no known virulence genes in its genome [9]. However, unlike previous studies, we discovered several genes that may undergo horizontal gene transfer. These genes are carried by plasmids that can be transferred within the Lactobacillaceae family.
The present study also has a limitation. While the in silico genomic analyses of L. plantarum offer insights into the genetic diversity, metabolic function, and antimicrobial properties of this species, this study lacks additional experimental validation. Specifically, the mobility of the plasmid-carrying ARGs, the biological activity of AMPs, and the metabolites require further investigation. These findings need to be verified to serve as a guide for future applications.

5. Conclusions

In this study, we conducted a comprehensive analysis of 324 L. plantarum genomes sourced from various origins and geographical locations. Our findings indicate transmissions occurring from foods to humans, other than from the environment. Furthermore, its ability to utilize a diverse range of carbohydrates and proteins supports its application in fermented foods. As a probiotic, one of the potential beneficial mechanisms of L. plantarum may be the production of various AMPs that inhibit other commensals, which can be considered as an intrinsic characteristic of this species. However, the plasmid-mediated dissemination of ARGs should be closely monitored within the fermented food industry.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/genes16080869/s1, Table S1: Genomic characteristics of 324 strains of L. plantarum; Table S2: Number of Glycoside Hydrolases in L. plantarum genomes. Table S3: Prediction of minimum inhibitory concentration of AMPs against 34 type strains; Table S4: Prophage fragments in 324 L. plantarum genomes; Figure S1: Percentage of strains from different hosts (a) and locations (b) in each cluster in Figure 1. The numbers labeled above each bar represent the total number of strains in each cluster; Figure S2: Heatmap of the presence of KEGG modules in strains from various sources. The hierarchical clustering was based on Euclidean distance and adopted complete linkage. Both rows and columns were clustered.

Author Contributions

Conceptualization, C.B.; methodology, R.L.; software, R.L.; formal analysis, R.L.; writing—original draft preparation, R.L.; writing—review and editing, C.B.; visualization, R.L.; supervision, C.B. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by Heilongjiang Provincial Key R&D Program, grant number 2024ZXDXB58.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The genomes included in this study can be found in https://www.ncbi.nlm.nih.gov/datasets/genome/?taxon=1590.

Acknowledgments

We would like to thank Yan Lin and Junyan Bie, from Beijing Yutai Biotechnology Co., Ltd., for their help in the data analysis of this study.

Conflicts of Interest

The authors declare no conflicts of interest.

Abbreviations

The following abbreviations are used in this manuscript:
AMPAntimicrobial Peptide
ANIAverage Nucleotide Identity
ARGAntibiotic Resistance Gene
CARDComprehensive Antibiotic Resistance Database
CAZymeCarbohydrate-Active Enzyme
GHGlycoside Hydrolase
IMPInosine Monophosphate
KEGGKyoto Encyclopedia of Genes and Genomes
MGEMobile Genetic Element
MICMinimum Inhibitory Concentration
NCBINational Center for Biotechnology Information

References

  1. Siezen, R.J.; van Hylckama Vlieg, J.E.T. Genomic Diversity and Versatility of Lactobacillus plantarum, a Natural Metabolic Engineer. Microb. Cell Fact. 2011, 10 (Suppl. S1), S3. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Shah, A.B.; Baiseitova, A.; Zahoor, M.; Ahmad, I.; Ikram, M.; Bakhsh, A.; Shah, M.A.; Ali, I.; Idress, M.; Ullah, R.; et al. Probiotic Significance of Lactobacillus Strains: A Comprehensive Review on Health Impacts, Research Gaps, and Future Prospects. Gut Microbes 2024, 16, 2431643. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Zheng, J.; Wittouck, S.; Salvetti, E.; Franz, C.M.A.P.; Harris, H.M.B.; Mattarelli, P.; O’Toole, P.W.; Pot, B.; Vandamme, P.; Walter, J.; et al. A Taxonomic Note on the Genus Lactobacillus: Description of 23 Novel Genera, Emended Description of the Genus Lactobacillus Beijerinck 1901, and Union of Lactobacillaceae and Leuconostocaceae. Int. J. Syst. Evol. Microbiol. 2020, 70, 2782–2858. [Google Scholar] [CrossRef] [Scilit]
  4. Chen, K.; Luan, X.; Liu, Q.; Wang, J.; Chang, X.; Snijders, A.M.; Mao, J.-H.; Secombe, J.; Dan, Z.; Chen, J.-H.; et al. Drosophila Histone Demethylase KDM5 Regulates Social Behavior through Immune Control and Gut Microbiota Maintenance. Cell Host Microbe 2019, 25, 537–552.e8. [Google Scholar] [CrossRef] [Scilit]
  5. Cui, Y.; Wang, M.; Zheng, Y.; Miao, K.; Qu, X. The Carbohydrate Metabolism of Lactiplantibacillus plantarum. Int. J. Mol. Sci. 2021, 22, 13452. [Google Scholar] [CrossRef] [Scilit]
  6. Tegopoulos, K.; Stergiou, O.S.; Kiousi, D.E.; Tsifintaris, M.; Koletsou, E.; Papageorgiou, A.C.; Argyri, A.A.; Chorianopoulos, N.; Galanis, A.; Kolovos, P. Genomic and Phylogenetic Analysis of Lactiplantibacillus plantarum L125, and Evaluation of Its Anti-Proliferative and Cytotoxic Activity in Cancer Cells. Biomedicines 2021, 9, 1718. [Google Scholar] [CrossRef] [Scilit]
  7. Huidrom, S.; Ngashangva, N.; Khumlianlal, J.; Sharma, K.C.; Mukherjee, P.K.; Devi, S.I. Genomic Insights from Lactiplantibacillus plantarum BRD3A Isolated from Atingba, a Traditional Fermented Rice-Based Beverage and Analysis of Its Potential for Probiotic and Antimicrobial Activity against Methicillin-Resistant Staphylococcus Aureus. Front. Microbiol. 2024, 15, 1357818. [Google Scholar] [CrossRef] [Scilit]
  8. Tóth, A.G.; Judge, M.F.; Nagy, S.Á.; Papp, M.; Solymosi, N. A Survey on Antimicrobial Resistance Genes of Frequently Used Probiotic Bacteria, 1901 to 2022. Eurosurveillance 2023, 28, 2200272. [Google Scholar] [CrossRef] [Scilit]
  9. Garcia-Gonzalez, N.; Bottacini, F.; van Sinderen, D.; Gahan, C.G.M.; Corsetti, A. Comparative Genomics of Lactiplantibacillus plantarum: Insights Into Probiotic Markers in Strains Isolated From the Human Gastrointestinal Tract and Fermented Foods. Front. Microbiol. 2022, 13, 854266. [Google Scholar] [CrossRef] [Scilit]
  10. Evanovich, E.; de Souza Mendonça Mattos, P.J.; Guerreiro, J.F. Comparative Genomic Analysis of Lactobacillus plantarum: An Overview. Int. J. Genom. 2019, 2019, 4973214. [Google Scholar] [CrossRef] [Scilit]
  11. Wu, M.; Tarrah, A.; Ghion, G.; Pakroo, S.; Giacomini, A.; Corich, V. A Critical Issue on Microbiological Cut-off Value of Ampicillin Resistance in Lactiplantibacillus plantarum. J. Appl. Microbiol. 2023, 134, lxad050. [Google Scholar] [CrossRef] [Scilit]
  12. Martino, M.E.; Bayjanov, J.R.; Caffrey, B.E.; Wels, M.; Joncour, P.; Hughes, S.; Gillet, B.; Kleerebezem, M.; van Hijum, S.A.F.T.; Leulier, F. Nomadic Lifestyle of Lactobacillus plantarum Revealed by Comparative Genomics of 54 Strains Isolated from Different Habitats. Environ. Microbiol. 2016, 18, 4974–4989. [Google Scholar] [CrossRef] [Scilit]
  13. Chaumeil, P.A.; Mussig, A.J.; Hugenholtz, P.; Parks, D.H. GTDB-Tk: A Toolkit to Classify Genomes with the Genome Taxonomy Database. Bioinformatics 2020, 36, 1925–1927. [Google Scholar] [CrossRef] [Scilit]
  14. Parks, D.H.; Imelfort, M.; Skennerton, C.T.; Hugenholtz, P.; Tyson, G.W. CheckM: Assessing the Quality of Microbial Genomes Recovered from Isolates, Single Cells, and Metagenomes. Genome Res. 2015, 25, 1043–1055. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Pritchard, L.; Glover, R.H.; Humphris, S.; Elphinstone, J.G.; Toth, I.K. Genomics and Taxonomy in Diagnostics for Food Security: Soft-Rotting Enterobacterial Plant Pathogens. Anal. Methods 2016, 8, 12–24. [Google Scholar] [CrossRef] [Scilit]
  16. Seemann, T. Prokka: Rapid Prokaryotic Genome Annotation. Bioinformatics 2014, 30, 2068–2069. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Tonkin-Hill, G.; MacAlasdair, N.; Ruis, C.; Weimann, A.; Horesh, G.; Lees, J.A.; Gladstone, R.A.; Lo, S.; Beaudoin, C.; Floto, R.A.; et al. Producing Polished Prokaryotic Pangenomes with the Panaroo Pipeline. Genome Biol. 2020, 21, 180. [Google Scholar] [CrossRef] [Scilit]
  18. Huerta-Cepas, J.; Szklarczyk, D.; Heller, D.; Hernández-Plaza, A.; Forslund, S.K.; Cook, H.; Mende, D.R.; Letunic, I.; Rattei, T.; Jensen, L.J.; et al. EggNOG 5.0: A Hierarchical, Functionally and Phylogenetically Annotated Orthology Resource Based on 5090 Organisms and 2502 Viruses. Nucleic Acids Res. 2019, 47, D309–D314. [Google Scholar] [CrossRef] [Scilit]
  19. Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; Von Haeseler, A.; Lanfear, R.; Teeling, E. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [Scilit]
  20. Tonkin-Hill, G.; Lees, J.A.; Bentley, S.D.; Frost, S.D.W.; Corander, J. Fast Hierarchical Bayesian Analysis of Population Structure. Nucleic Acids Res. 2019, 47, 5539–5549. [Google Scholar] [CrossRef] [Scilit]
  21. Zhou, Z.; Tran, P.Q.; Breister, A.M.; Liu, Y.; Kieft, K.; Cowley, E.S.; Karaoz, U.; Anantharaman, K. METABOLIC: High-Throughput Profiling of Microbial Genomes for Functional Traits, Metabolism, Biogeochemistry, and Community-Scale Functional Networks. Microbiome 2022, 10, 33. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Zhou, S.; Liu, B.; Zheng, D.; Chen, L.; Yang, J. VFDB 2025: An Integrated Resource for Exploring Anti-Virulence Compounds. Nucleic Acids Res. 2025, 53, D871–D877. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Alcock, B.P.; Huynh, W.; Chalil, R.; Smith, K.W.; Raphenya, A.R.; Wlodarski, M.A.; Edalatmand, A.; Petkau, A.; Syed, S.A.; Tsang, K.K.; et al. CARD 2023: Expanded Curation, Support for Machine Learning, and Resistome Prediction at the Comprehensive Antibiotic Resistance Database. Nucleic Acids Res. 2023, 51, D690–D699. [Google Scholar] [CrossRef] [Scilit]
  24. Camargo, A.P.; Roux, S.; Schulz, F.; Babinski, M.; Xu, Y.; Hu, B.; Chain, P.S.G.; Nayfach, S.; Kyrpides, N.C. Identification of Mobile Genetic Elements with geNomad. Nat. Biotechnol. 2023, 42, 1303–1312. [Google Scholar] [CrossRef] [Scilit]
  25. Zheng, K.; Sun, J.; Liang, Y.; Kong, L.; Paez-Espino, D.; Mcminn, A.; Wang, M. VITAP: A High Precision Tool for DNA and RNA Viral Classification Based on Meta-Omic Data. Nat. Commun. 2025, 16, 2226. [Google Scholar] [CrossRef] [Scilit]
  26. Robertson, J.; Bessonov, K.; Schonfeld, J.; Nash, J.H.E. Universal Whole-Sequence-Based Plasmid Typing and Its Utility to Prediction of Host Range and Epidemiological Surveillance. Microb. Genom. 2020, 6, mgen000435. [Google Scholar] [CrossRef] [Scilit]
  27. Santos-Júnior, C.D.; Pan, S.; Zhao, X.-M.; Coelho, L.P. Macrel: Antimicrobial Peptide Screening in Genomes and Metagenomes. PeerJ 2020, 8, e10555. [Google Scholar] [CrossRef] [Scilit]
  28. Mondal, R.K.; Sen, D.; Arya, A.; Samanta, S.K. Developing Anti-Microbial Peptide Database Version 1 to Provide Comprehensive and Exhaustive Resource of Manually Curated AMPs. Sci. Rep. 2023, 13, 17843. [Google Scholar] [CrossRef] [Scilit]
  29. Wang, G.; Li, X.; Wang, Z. APD3: The Antimicrobial Peptide Database as a Tool for Research and Education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef] [Scilit]
  30. Pirtskhalava, M.; Amstrong, A.A.; Grigolava, M.; Chubinidze, M.; Alimbarashvili, E.; Vishnepolsky, B.; Gabrielian, A.; Rosenthal, A.; Hurt, D.E.; Tartakovsky, M. DBAASP v3: Database of Antimicrobial/Cytotoxic Activity and Structure of Peptides as a Resource for Development of New Therapeutics. Nucleic Acids Res. 2021, 49, D288–D297. [Google Scholar] [CrossRef] [Scilit]
  31. Shi, G.; Kang, X.; Dong, F.; Liu, Y.; Zhu, N.; Hu, Y.; Xu, H.; Lao, X.; Zheng, H. DRAMP 3.0: An Enhanced Comprehensive Data Repository of Antimicrobial Peptides. Nucleic Acids Res. 2022, 50, D488–D496. [Google Scholar] [CrossRef] [Scilit]
  32. Ye, G.; Wu, H.; Huang, J.; Wang, W.; Ge, K.; Li, G.; Zhong, J.; Huang, Q. LAMP2: A Major Update of the Database Linking Antimicrobial Peptides. Database 2020, 2020, baaa061. [Google Scholar] [CrossRef] [Scilit]
  33. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic Local Alignment Search Tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
  34. Fu, L.; Niu, B.; Zhu, Z.; Wu, S.; Li, W. CD-HIT: Accelerated for Clustering the next-Generation Sequencing Data. Bioinformatics 2012, 28, 3150–3152. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Edgar, R.C. MUSCLE: Multiple Sequence Alignment with High Accuracy and High Throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Wan, F.; Torres, M.D.T.; Peng, J.; de la Fuente-Nunez, C. Deep-Learning-Enabled Antibiotic Discovery through Molecular de-Extinction. Nat. Biomed. Eng. 2024, 8, 854–871. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Letunic, I.; Bork, P. Interactive Tree of Life (iTOL) v6: Recent Updates to the Phylogenetic Tree Display and Annotation Tool. Nucleic Acids Res. 2024, 52, W78–W82. [Google Scholar] [CrossRef] [Scilit]
  38. Grant, J.R.; Enns, E.; Marinier, E.; Mandal, A.; Herman, E.K.; Chen, C.-Y.; Graham, M.; Van Domselaar, G.; Stothard, P. Proksee: In-Depth Characterization and Visualization of Bacterial Genomes. Nucleic Acids Res. 2023, 51, W484–W492. [Google Scholar] [CrossRef] [Scilit]
  39. Kolde, R.; Kolde, M.R. Maintainer Raivo Package ‘pheatmap’. Bioconductor 2015, 1, 790. [Google Scholar]
  40. Brunson, J.C. Ggalluvial: Alluvial Plots in “Ggplot2”. ggalluvial 2020, 5, 2017. [Google Scholar]
  41. Zhang, L.; Kulyar, M.F.; Niu, T.; Yang, S.; Chen, W. Comparative Genomics of Limosilactobacillus Reuteri YLR001 Reveals Genetic Diversity and Probiotic Properties. Microorganisms 2024, 12, 1636. [Google Scholar] [CrossRef] [Scilit]
  42. You, L.; Lv, R.; Jin, H.; Ma, T.; Zhao, Z.; Kwok, L.-Y.; Sun, Z. A Large-Scale Comparative Genomics Study Reveals Niche-Driven and within-Sample Intra-Species Functional Diversification in Lacticaseibacillus rhamnosus. Food Res. Int. 2023, 173, 113446. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Myrbråten, I.S.; Wiull, K.; Salehian, Z.; Håvarstein, L.S.; Straume, D.; Mathiesen, G.; Kjos, M. CRISPR Interference for Rapid Knockdown of Essential Cell Cycle Genes in Lactobacillus plantarum. mSphere 2019, 4, e00007–e00019. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Lin, R.; Liu, W.; Piao, M.; Zhu, H. A Review of the Relationship between the Gut Microbiota and Amino Acid Metabolism. Amino Acids 2017, 49, 2083–2090. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Man, L.-L.; Xiang, D.-J. Effect of LuxS/AI-2-Mediated Quorum Sensing System on Bacteriocin Production of Lactobacillus plantarum NMD-17. Folia Microbiol. 2023, 68, 855–866. [Google Scholar] [CrossRef] [Scilit]
  46. Hu, Q.; Qi, Y.; Liu, C.; Chen, Q.; Mai, X.; Zhu, Z.; Ma, B. Effects of Lactobacillus plantarum Cofermentation on the Flavor and Taste Characteristics of Mango Vinegar. J. Food Meas. Charact. 2024, 18, 3744–3756. [Google Scholar] [CrossRef] [Scilit]
  47. Mann, E.R.; Lam, Y.K.; Uhlig, H.H. Short-Chain Fatty Acids: Linking Diet, the Microbiome and Immunity. Nat. Rev. Immunol. 2024, 24, 577–595. [Google Scholar] [CrossRef] [Scilit]
  48. Gonçalves, C.; Gonçalves, P. Multilayered Horizontal Operon Transfers from Bacteria Reconstruct a Thiamine Salvage Pathway in Yeasts. Proc. Natl. Acad. Sci. USA 2019, 116, 22219–22228. [Google Scholar] [CrossRef] [Scilit]
  49. Iarusso, I.; Mahony, J.; Pannella, G.; Lombardi, S.J.; Gagliardi, R.; Coppola, F.; Pellegrini, M.; Succi, M.; Tremonte, P. Diversity of Lactiplantibacillus plantarum in Wild Fermented Food Niches. Foods 2025, 14, 1765. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Phylogenetic tree constructed based on the core genomes of 324 L. plantarum strains. From the inner to outer, the three rings represent different clusters, the location, and the host of strains.
Figure 1. Phylogenetic tree constructed based on the core genomes of 324 L. plantarum strains. From the inner to outer, the three rings represent different clusters, the location, and the host of strains.
Genes 16 00869 g001
Figure 2. Presence of KEGG modules in the genomes of L. plantarum. (a) Prevalence of the KEGG modules among the strains. The different colors of each bar correspond to different KEGG categories. The gray vertical line indicates the 95% presence ratio. The numbers on the right represent the total number of strains within the correlated KEGG modules. (b) Prevalence of the KEGG modules from various hosts, excluding those modules present in all strains. The positive ratio of different modules in strains from different sources is represented by the numbers in each cell.
Figure 2. Presence of KEGG modules in the genomes of L. plantarum. (a) Prevalence of the KEGG modules among the strains. The different colors of each bar correspond to different KEGG categories. The gray vertical line indicates the 95% presence ratio. The numbers on the right represent the total number of strains within the correlated KEGG modules. (b) Prevalence of the KEGG modules from various hosts, excluding those modules present in all strains. The positive ratio of different modules in strains from different sources is represented by the numbers in each cell.
Genes 16 00869 g002
Figure 3. Glycoside Hydrolase (GH) family harbored in L. plantarum genomes. (a) Prevalence of GH families in the L. plantarum genomes. The numbers on the right indicate the total number of strains in correlated GH. (b) The average copy number of each GH family in the L. plantarum genomes. (c) The number of GHs in strains from different sources. (d) The number of GHs in strains from different continents.
Figure 3. Glycoside Hydrolase (GH) family harbored in L. plantarum genomes. (a) Prevalence of GH families in the L. plantarum genomes. The numbers on the right indicate the total number of strains in correlated GH. (b) The average copy number of each GH family in the L. plantarum genomes. (c) The number of GHs in strains from different sources. (d) The number of GHs in strains from different continents.
Genes 16 00869 g003
Figure 4. Protease families and inhibitors harbored in the L. plantarum genomes. (a) Prevalence of protease families and inhibitors in the L. plantarum genomes. The numbers on the right represent the total number of strains in correlated peptidase. (b) The average copy number of each protease family/inhibitor in the L. plantarum genomes.
Figure 4. Protease families and inhibitors harbored in the L. plantarum genomes. (a) Prevalence of protease families and inhibitors in the L. plantarum genomes. The numbers on the right represent the total number of strains in correlated peptidase. (b) The average copy number of each protease family/inhibitor in the L. plantarum genomes.
Genes 16 00869 g004
Figure 5. Antimicrobial peptides (AMPs) harbored in L. plantarum genomes. (a) Number of AMPs per genome. (b) Average number of AMPs per genome from various sources. (c) Number of the most common AMP sequences. (de) Phylogenetic tree of two clusters of AMP sequences. The sequence of each branch was labeled on the tree, and the number of each AMP was shown in the blue bar. The numbers on the right represent the total number of AMP sequences (ce). Different amino acids were colored according to their chemical properties in (de).
Figure 5. Antimicrobial peptides (AMPs) harbored in L. plantarum genomes. (a) Number of AMPs per genome. (b) Average number of AMPs per genome from various sources. (c) Number of the most common AMP sequences. (de) Phylogenetic tree of two clusters of AMP sequences. The sequence of each branch was labeled on the tree, and the number of each AMP was shown in the blue bar. The numbers on the right represent the total number of AMP sequences (ce). Different amino acids were colored according to their chemical properties in (de).
Genes 16 00869 g005
Figure 6. Antibiotic resistance genes (ARGs) that are carried by the L. plantarum strains and related plasmids. (a) Prevalence of ARGs in the strains from various sources. (b) The genetic structure of ARG-carrying plasmids. Note: The plasmids in L. plantarum A8 and L. plantarum J50 exhibited the same length with only two mismatches (6261/6263) and an ANI value of 0.990.
Figure 6. Antibiotic resistance genes (ARGs) that are carried by the L. plantarum strains and related plasmids. (a) Prevalence of ARGs in the strains from various sources. (b) The genetic structure of ARG-carrying plasmids. Note: The plasmids in L. plantarum A8 and L. plantarum J50 exhibited the same length with only two mismatches (6261/6263) and an ANI value of 0.990.
Genes 16 00869 g006
Table 1. Number of core and accessory genes in 324 genomes.
Table 1. Number of core and accessory genes in 324 genomes.
CategoryCut-OffNumber of Genes
Core genes99% ≤ strains ≤ 100%2194
Soft-core genes95% ≤ strains < 99%209
Shell genes15% ≤ strains < 95%1164
Cloud genes0% < strains < 15%8849
Total genes0% < strains ≤ 100%12,416
Table 2. Molecular characterization of the five ARG-carrying plasmids.
Table 2. Molecular characterization of the five ARG-carrying plasmids.
AccessionStrain HostARGReplicon TypePredicted MobilityPredicted Host Range
CP035015L. plantarum 12_3ANT(6)-Iarep_cluster_707ConjugativeLactobacillaceae
CP058737L. plantarum A8Tet(M)rep_cluster_2119Non-mobilizableLactobacillaceae
CP090185L. plantarum STTet(M)rep_cluster_167, rep_cluster_707ConjugativeLactobacillaceae
CP116750L. plantarum MWLp-12mdeArep_cluster_1328MobilizableLactobacillales
CP140093L. plantarum J50Tet(M)rep_cluster_2119Non-mobilizableLactobacillaceae
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Li, R.; Bi, C. Comparative Genomic Analysis of Lactiplantibacillus plantarum: Insights into Its Genetic Diversity, Metabolic Function, and Antibiotic Resistance. Genes 2025, 16, 869. https://doi.org/10.3390/genes16080869

AMA Style

Li R, Bi C. Comparative Genomic Analysis of Lactiplantibacillus plantarum: Insights into Its Genetic Diversity, Metabolic Function, and Antibiotic Resistance. Genes. 2025; 16(8):869. https://doi.org/10.3390/genes16080869

Chicago/Turabian Style

Li, Ruiqi, and Chongpeng Bi. 2025. "Comparative Genomic Analysis of Lactiplantibacillus plantarum: Insights into Its Genetic Diversity, Metabolic Function, and Antibiotic Resistance" Genes 16, no. 8: 869. https://doi.org/10.3390/genes16080869

APA Style

Li, R., & Bi, C. (2025). Comparative Genomic Analysis of Lactiplantibacillus plantarum: Insights into Its Genetic Diversity, Metabolic Function, and Antibiotic Resistance. Genes, 16(8), 869. https://doi.org/10.3390/genes16080869

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop