Next Article in Journal
Selective Interactions of Mouse Melanocortin Receptor Accessory Proteins with Somatostatin Receptors
Next Article in Special Issue
The Splicing Variant TFIIIA-7ZF of Viroid-Modulated Transcription Factor IIIA Causes Physiological Irregularities in Transgenic Tobacco and Transient Somatic Depression of “Degradome” Characteristic for Developing Pollen
Previous Article in Journal
Phosphorylation-Induced Ubiquitination and Degradation of PXR through CDK2-TRIM21 Axis
Previous Article in Special Issue
Conserved Motifs and Domains in Members of Pospiviroidae
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Revisiting the Non-Coding Nature of Pospiviroids

by
Konstantina Katsarou
1,2,*,
Charith Raj Adkar-Purushothama
3,
Emilios Tassios
1,4,
Martina Samiotaki
4,
Christos Andronis
2,
Purificación Lisón
5,
Christoforos Nikolaou
1,2,4,
Jean-Pierre Perreault
3 and
Kriton Kalantidis
1,2,*
1
Department of Biology, University of Crete, Vassilika Vouton, 71409 Heraklion, Greece
2
Institute of Molecular Biology and Biotechnology, Foundation for Research and Technology, 71110 Heraklion, Greece
3
RNA Group/Groupe ARN, Département de Biochimie, Faculté de Médecine des Sciences de la Santé, Pavillon de Recherche Appliquée au Cancer, Université de Sherbrooke, Sherbrooke, QC J1E 4K8, Canada
4
Biomedical Sciences Research Center “Alexander Fleming”, Institute for Bioinnovation, 16672 Vari, Greece
5
Instituto de Biología Molecular y Celular de Plantas (IBMCP), Consejo Superior de Investigaciones Científicas (CSIC), Universitat Politècnica de València (UPV), Ciudad Politécnica de la Innovación (CPI) 8 E, Ingeniero Fausto Elio s/n, 46011 Valencia, Spain
*
Authors to whom correspondence should be addressed.
Cells 2022, 11(2), 265; https://doi.org/10.3390/cells11020265
Submission received: 8 December 2021 / Revised: 5 January 2022 / Accepted: 7 January 2022 / Published: 13 January 2022
(This article belongs to the Special Issue Celebrating 50 Years of Viroid Discovery)

Abstract

Viroids are small, circular, highly structured pathogens that infect a broad range of plants, causing economic losses. Since their discovery in the 1970s, they have been considered as non-coding pathogens. In the last few years, the discovery of other RNA entities, similar in terms of size and structure, that were shown to be translated (e.g., cirRNAs, precursors of miRNA, RNA satellites) as well as studies showing that some viroids are located in ribosomes, have reignited the idea that viroids may be translated. In this study, we used advanced bioinformatic analysis, in vitro experiments and LC-MS/MS to search for small viroid peptides of the PSTVd. Our results suggest that in our experimental conditions, even though the circular form of PSTVd is found in ribosomes, no produced peptides were identified. This indicates that the presence of PSTVd in ribosomes is most probably not related to peptide production but rather to another unknown function that requires further study.

1. Introduction

The ‘central dogma’ of molecular biology explains the flow of genetic information and consists of the process of transcribing DNA into RNA, which is then translated into proteins. Translation is usually divided into four stages: initiation, elongation, termination and ribosome recycling [1]. The initiation step is the most complex in terms of the proteins involved. During initiation, the 40S ribosomal subunit binds to the mRNA and scans until an initiation codon (AUG) is found. In the last few years, several alternative initiation starting codons have been described [2]. Following initiation, the 60S ribosomal subunit joins to form the 80S ribosome whereupon the elongation step starts, translating the information encoded in three consecutive nucleotides into an amino acid (aa), creating a peptide, and then a protein. Recognition of the stop codon drives the termination process and the release of the protein. Finally, ribosome recycling occurs, where the messenger RNA (mRNA) is released and the 80S ribosome is separated into its 40S and 60S components [1].
For many years, it was believed that mRNAs were the only RNAs produced by DNA that can be translated. However, only around 4% of the RNA transcribed is actual mRNA [3]. The remainder corresponds to different classes of non-coding RNAs [4]. In 1979, a peculiar endogenous circular RNA (circRNA) was discovered in HeLa cells [5]. At the time, this was considered an exception, but nowadays, especially with the technological breakthrough of high-throughput sequencing (HTS) technologies, circRNAs are considered as a large class of ubiquitously expressed RNA molecules. circRNAs are produced through splicing and regulated by specific mechanisms [6,7]. Their best characterized role is to act as miRNA and protein sponges, thus altering gene expression [7].
In the last few years, the idea that circRNAs can be used as templates for protein synthesis has emerged [8,9,10,11]. Some circRNAs include in their sequence an internal ribosome entry site (IRES), which constitutes a highly structured domain containing multiple stem loops, to allow initiation of translation [9,10]. Moreover, it has been proposed that other regions of circRNAs, named IRES-like domains, can also be used for translation initiation [12]. The translation of circRNAs produces small peptides of fewer than 100 aa, termed microproteins or non-conventional peptides (NCPs), discovered mostly with the use of mass spectrometry [12]. In humans, these microproteins seem to be extremely abundant in the heart, liver and kidney, as suggested by translatome analysis [13].
The first circRNA of exogenous origin discovered was a viroid, whose circularity was confirmed by electron microscopy in 1973 [14]. Viroids are plant pathogenic single-stranded, circular, non-coding RNA molecules capable of infecting a diverse range of host plants of economic importance [4,15]. With their size ranging between 246–401 nucleotides (nt) and no capsid, they are considered as one of the smallest and simplest pathogens of life. They were first discovered in 1971 in potato (i.e., potato spindle tuber viroid—PSTVd), but since then, more than thirty different viroids have been identified [16,17]. They are divided into two families depending on their structure and their site of replication in host plants [4,18]. Pospiviroidae have a rod-shaped RNA genome and replicate in the nucleus via an asymmetric rolling-circle model, whereas Avsunviroidae possess a highly branched structure and replicate in chloroplasts via a symmetric rolling-circle mechanism [4,18,19]. In order to establish an infection, viroids need to use all the structural information found in their genome, which include stem loops for interactions with host proteins as well as viroid-derived small interfering RNAs (vd-siRNAs) produced by Dicer-like proteins, even though the mechanism by which this occurs remains poorly understood [20].
Although viroids have long been considered non-coding circular RNAs, in light of the discovery that some circRNAs and other small highly structured RNAs can be translated, the idea that viroids may also be translated reemerged. As an example, a plant circRNA satellite of 220nt, sharing important features with viroids, has been found capable of producing a small peptide of 16KDa [21]. The first studies attempting to answer this question were conducted in 1974, when PSTVd and Citrus exocortis viroid (CEVd) were tested for their ability to be translated using an in vitro translation system, but without success [22,23]. Attempts were also made in vivo with PSTVd-infected tomatoes, CEVd-infected Gynura aurantiaca, and CEVd-transfected Xenopus laevis, and again, microproteins were not identified [24,25,26]. These works helped establish the belief that viroid RNAs are most probably not translated. On the other hand, in 2019, Cottilli et al., using mainly CEVd-infected tomatoes, showed that viroid RNAs are found in ribosomal fractions, suggesting that at least in terms of localization, viroids are found very close to the translational machinery [27]. Furthermore, direct interaction of eIF1A, an important protein of the translation mechanism, and both CEVd and peach latent mosaic viroid (PLMVd) has been proposed [28,29]. A recent work by Marquez-Molins et al. has reignited the possibility that viroid RNAs might be translated [30].
In the present study, we revisit the question on the translation of viroid RNAs using more advanced techniques than those previously employed. Firstly, we have applied bioinformatics analysis using all available Pospiviroidae sequences and in order to identify putative ORFs. We then showed that a portion of PSTVd may localized to ribosomes, mostly in its circular form. Finally, we performed in vitro and in vivo experiments to identify possible viroid-encoded polypeptides. Taken together, by using distinct and more sensitive techniques, we have confirmed the results of classic studies, which indicate that viroids cannot produce any peptides, thus suggesting that viroid localization in proximity of ribosomes is due to reasons other than translation.

2. Materials and Methods

2.1. Bioinformatic Analysis

Nucleotide sequences of all available strains for 30 viroid species from the Pospiviroidae family were downloaded from the NCBI database in FASTA format. Sequences identified as duplicates were excluded from the analysis (Table S1). All the sequences were then analyzed for the existence of potential ORFs according to the following steps:
Open Reading Frame (ORF) detection: ORFs in circular genomes may originate at any point in the sequence and run the length of the genome or even exceed it. To identify candidate ORFs in the circular viroid genomes, we used artificial genome sequences as contigs composed of two copies of the same sequence joined together. All AUG and non-AUG starting codons (according to [2]) were identified in all three reading frames, and sequence strings that started with the detected starting codons and stopped at the end of the remaining sequence were obtained as ORF-containing candidates (putative ORFs). Each such putative ORF was then trimmed to contain contiguous subsequences between in-frame start and stop codons, which were retained for further analysis. In the case of multiple in-frame overlapping ORFs terminating at the same stop codon, only the longest ORF was kept in the final list of candidates.
Translation of ORFs: Each sequence from the final set of putative ORFs was in silico translated into a protein, based on the genetic code. For each viroid species, basic analyses were carried out, including the number of different peptides per species, mean peptide length, standard deviation of peptide length, mean molecular weight of peptides and standard deviation of peptide molecular weight (Table 1). BLASTp analysis was carried out to search for significant sequence similarity (p value < 0.05) with previously characterized proteins.
ORF emergence tendencies: To investigate if viroid genomes show a greater ORF frequency than expected by chance, the same procedure was subsequently used on randomly scrambled genome sequences with an identical nucleotide composition. Except from the actual number of ORFs per genome, the localization of the ORFs across the 5 characteristic genome domains, (the terminal left domain, the pathogenicity domain, the central domain, the variable domain and the terminal right domain) was also checked for enrichment in comparison with the scrambled genomes. To acquire the information about the characteristic domains, BED files with the coordinates of the start of each ORF and the coordinates of the domains, whenever available, were created. The intersect tool from the bedtools suite [31] was used to find the overlaps.
Conservation of ORFs: The conservation rate of the ORFs identified in Pospiviroidae genomes, inter- and intra-specifically, was obtained with the use of the MAFFT alignment algorithm (Multiple Alignment using Fast Fourier Transform) [32]. The percentage of occurrence of a nucleotide at each alignment position was calculated, and extended conserved regions were defined as areas having at least 40% similarity among the genomes included in the alignment. The occurrence rate of ORFs among the different strains per genome was also calculated by counting the number of strains where a specific ORF is predicted by dividing over the total number of strains of the species.
Detection of KOZAK motif: We generated a positional-specific scoring matrix (PSSM) through a comparison of the matrices for the KOZAK motif, based on [33], and a background matrix, created from 5074 random sequences (a number equal to the viroid sequences used in the study). We then conducted a motif search using a custom R script that scans the target sequence with the PSSM matrix and returns instances of matrix similarity according to an arbitrary threshold of 0.65.

2.2. Plants and Infections

Tomato (Solanum lycopersicum cv Rutgers; Livingston Seed Co, Columbus, OH, USA) and Nicotiana benthamiana plants were infected with either PSTVdRG1 (GenBank Acc. No. U23058) or PSTVdNB (GenBank Acc. No. AJ634596.1). Infections were either performed mechanically or via agro-infiltration. For mechanical infections, the dimeric construct of PSTVdRG1 was used to synthesize infectious dimeric transcripts as described previously [34]. PSTVd RNA transcript (1 µg) was inoculated into both plant types. All plants were grown in a growth chamber at a temperature of 25 °C with 16 h of light and 8 h of darkness [35]. For agroinfiltration experiments, N. benthamiana plants were agroinfiltrated with an A. tumefaciens GV3101 strain carrying an infectious PSTVdNB dimer, kindly provided by Dr. De Alba and Dr. Flores (Institute for Cellular and Molecular Plant Biology—IBMCP), as described previously [36]. Plants were grown in a glasshouse under ambient temperature and light conditions.

2.3. Total Ribosome Isolation, Polysome Fractionation and RNA Preparation

Total ribosomes and polysomes were prepared as previously described [37] with modifications. Actively growing leaf samples (25 g) were frozen in liquid nitrogen and macerated to a fine powder. Two volumes of cold plant extraction buffer (50 mM Tris-HCl (pH 9.0) (Sigma, Burlington, VT, USA), 30 mM MgCl2 (Fischer chemicals, Chicago, IL, USA), 400 mM KCl (Fischer chemicals, Chicago, IL, USA), 17% (w/w) sucrose (Fischer chemicals, Chicago, IL, USA) were added and clarified by passage through DEPC-treated cheesecloth. The resulting extracts were centrifuged at 3000 rpm for 7 min at 4 °C. One-tenth volume of 20% Triton X-100 was added and samples were centrifuged at 12,000 rpm for 20 min. Clear supernatants were then layered (1:1) on a 60% sucrose cushion (20 mM Tris-HCl (pH 7.6), 5 mM MgCl2, 510 mM NH4Cl, 60% (w/w) sucrose) and centrifuged at 28,000 rpm for 19 h in a SW28 rotor in a Beckman Coulter ultracentrifuge (Beckman Coulter, Indianapolis, IN, USA). The resulting pellets were carefully rinsed with resuspension buffer (50 mM KCl, 20 mM Tris-HCl (pH 7.6), 5 mM MgCl2) and resuspended in 200 μL of the same buffer. The resuspended total ribosomes were fractionated on a 5–50% sucrose gradient by centrifugation at 16,000 rpm for 13 h in a SW28 rotor. The 40S, 60S and 80S ribosomes and the polyribosomes were purified, and the RNAs were extracted as described previously [38]. Briefly, the RNA was precipitated with 5.5 M guanidine HCl (Sigma, Burlington, VT, USA) and ethanol (Commercial alcohols, Toronto, ON, Canada), followed by acidic phenol:chloroform extraction and re-extraction of the supernatant with an equal volume of chloroform. Purified RNAs were treated with DNase I according to manufacturer’s instructions (Promega, Madison, WI, USA). RNA integrity was evaluated using a Agilent 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA, USA)).

2.4. High Throughput Sequencing for Detection of Quasi-Species

The results of small viroid RNA experiments have been described elsewhere [39]. PSTVd-sRNA sequences of PSTVdRG1-infected tomato plants (GEO Acc. No. GSM1717894) were analyzed for the presence of potential start codons. Initially, 21-nt long sRNA with a match score of 1 and mismatch cost of 2 to PSTVdRG1 were segregated using CLC Genomic Workbench version 4.6 software (https://www.qiagenbioinformatics.com/products/clc-genomics-workbench/version-11-available/ accessed on 8 December 2021) and were then manually re-examined for the presence of AUG codons.
HTS analysis for PSTVd genomes was performed as follows: PSTVdNB agroinfiltrated plants were collected at 3 weeks post infection (wpi) and RNA was extracted as described previously [40]. Following DNAse I (Roche Diagnostics, Basel, Switzerland) treatment and extraction with phenol/chloroform, the integrity of RNAs was assessed using the Agilent 2100 Bioanalyzer. Library construction used the Ion Total RNA-seq Kit (Life technologies-Merk group, Darmstadt, Germany), and sequencing was performed using the Ion Torrent Proton platform. The quality of the raw reads (a total of 21 928 628) before and after the various cleaning steps was assessed with FastQC [36]. Quality and adapter trimming was performed with fastp [41] using the following settings: -q 20 --length_required 21 --cut_tail --cut_front --cut_mean_quality 20. Cleaned fastq files were aligned to the PSTVdNB genome (AJ634596.1) using BBMap [42] with default settings. Aligned reads (54 426) were extracted with samtools view [43]. Nucleotide variants from bam files were produced with quasitools [44], ran as quasitools call ntvar. The resulting VCF file was then used to extract alternative start codons.

2.5. cDNA Synthesis, RT-PCR, RT-qPCR and Northern Blot for PSTVd Detection

Following RNA extraction, cDNA synthesis was performed using 250 ng of RNA and SuperScript III reverse transcriptase (Invitrogen, Carlsbad, CA, USA). PCR was carried out using Q5 DNA polymerase according to the manufacturer’s instructions (New England Biolabs, Ipswich, MA, USA). Primers were either designed for this study or published before (Table S2) [45,46]. PCR-produced fragments were cleaned and cloned in pGEM-T vector (Promega, Madison, WI, USA) using the manufacturer’s instructions, followed by sequencing. The resulting sequences were assembled and aligned using the CLC Free Workbench (https://digitalinsights.qiagen.com/products-overview/discovery-insights-portfolio/analysis-and-visualization/qiagen-clc-main-workbench/ accessed on 8 December 2021) and were then manually analyzed.
For the evaluation of the PSTVd titer in both the total RNA extract and the polysome fraction, cDNA was prepared by reverse transcribing 500 ng RNA (SuperScript III reverse transcriptase—Invitrogen, Carlsbad, CA, USA) in the presence of random primers. Three housekeeping genes, specifically the 5.8S, 18S, and 25S rRNAs, were used for normalization, and three biological and three technical replicates were used. The qBASE framework was used for the analysis [47].
The detection of PSTVd by northern blotting was carried out as described previously [34,36].

2.6. In Vitro Translation and Immunoblot Assays

In order to perform in vitro translation, both the Wheat Germ Extract kit (Promega, Madison, WI, USA) and the FluoroTect™ GreenLys Labeling System (Promega, Madison, WI, USA) were used according to manufacturer’s instructions with the following modifications. Briefly, the reaction was performed in 25 µL containing 5 µg viroid RNA (specifically, (+) dimeric, (−) dimeric, (+) monomeric and (−) monomeric) and 2 µL of FluoroTect™. The reactions were carried out at 25 °C for 60 min, followed by an incubation at 30 °C for 60 min. The reactions were then terminated by the addition of RNase A (Promega, Madison, WI, USA). For PSTVd-derived translational analysis, 5 µL of the in vitro translation reactions were separated on a 12% SDS-PAGE gel and were then transferred to polyvinylidene difluoride membranes (Bio-Rad Laboratories, CA, USA). Anti- BODIPY™ FL rabbit IgG (ThermoFischer Scientific Inc, Waltham, MA, USA) at a dilution of 1:500 dilution was used to detect the translation according to the manufacturer’s instructions (Invitrogen, Carlsbad, CA, USA), followed by a subsequent incubation with a 1:10,000 dilution of the IRDye 800CW donkey anti-rabbit-IgG polyclonal antibody (LI-COR). The proteins were subsequently visualized using an LiCOR scanner (LI-COR, Lincoln, NE, USA) at 700 nm.

2.7. Proteomic Analysis

Sp3-mediated protein digestion: N. benthamiana plants were agroinfected with PSTVdNB and upper leaves were collected 4 wpi. Leaf tissue was pooled and homogenized in 4% SDS, 0.1 M DTT, 0.1 M Tris pH 8 lysis buffer. Three biological replicas of each group (either non-inoculated or 4 wpi) were processed using the sensitive sp3 protocol [48]. Additionally, the sp3 protocol was used in parallel for the digestion of the 3 kDa ultra-filtrate (Sartorius AG, Göttingen, Germany) of the leaf extracts in order to assess the lower molecular weight protein portion. The cysteine residues were reduced in 100 mM DTT and alkylated in 100 mM iodoacetamide (Acros Organics, Thermo Fisher Scientific Inc., Waltham, MA, USA). Twenty micrograms of beads (1:1 mixture of hydrophilic and hydrophobic SeraMag carboxylate-modified beads (Cytiva, Marlborough, MA, USA, former GE Life Sciences) were added to each sample in 50% ethanol. Protein clean-up was performed on a magnetic rack. The beads were washed twice with 80% ethanol and once with 100% acetonitrile (Fisher Chemical, Thermo Fisher Scientific Inc., Waltham, MA, USA). The captured proteins were digested overnight at 37 °C under vigorous shaking (Thermomixer, Thermo Fisher Scientific Inc., Waltham, MA, USA) with 0.5 μg Trypsin/LysC (mixture MS grade, Promega, Madison, WI, USA) prepared in 25 mM ammonium bicarbonate. The next day, the supernatants were collected, dried using a vacuum centrifuge (Savant, Thermo Fisher Scientific Inc., Waltham, MA, USA), solubilized in a mobile phase A, sonicated and the peptide concentration was determined through measurement of the absorbance at 280 nm.
In-gel digestion: One hundred micrograms of homogenized leaf tissue was mixed with 500 μL of lysis buffer (100 mM Tris-HCl (pH8), 200 mM NaCl2, 1 mM EDTA, 3 mM MgCl2, 10% Glycerol, 1 mM DTT, 1 μg/μL PMSF, 10 μL/mL protease inhibitors cocktail set VI (Calbiochem-Merk group, Darmstadt, Germany), 1 μL/mL Tween 20 (Sigma-Merk group, Darmstadt, Germany), and separated on a 15% SDS PAGE. Gel was stained with ‘blue silver’ Coomassie colloidal blue stain (Thermo Fisher Scientific Inc, Waltham, USA) [49], and the lower part of the gel were excised and subjected to classic tryptic-mediated in-gel digestion [50]. Briefly, gel pieces were excised, transferred into small tubes, destained, dehydrated with acetonitrile and then rehydrated with 25 mM ammonium bicarbonate buffer. After repeating the dehydration, rehydration and dehydration cycles, the dried gel pieces were rehydrated with 12.5 ng/µL trypsin in 25 mM (NH4)HCO3 solution and incubated overnight at 37 °C. Peptides were extracted from each gel piece with 100 μL extraction buffer (1:2 (v/v) 5% formic acid/acetonitrile) for 30 min at 37 °C, and the solution was dried in a vacuum centrifuge. Finally, the samples were reconstituted in 2% (v/v) acetonitrile/0.1% (v/v) formic acid and sonicated in a water bath for 5 min.
LC-MS/MS: Nano-liquid chromatography of the resulting tryptic peptide mixture was carried out using a Ultimate3000 RSLC system configured with an Acclaim pepmap C18 trap column (Thermo Fisher Scientific Inc., Waltham, MA, USA), and a 25 cm-long pepsep nano column (pepsep.com, Marslev, Denmark) for a total of 500 ng of peptides was loaded on the precolumn at a flow rate of 6 µL/min for 4 min with 0.1% formic acid in water. The peptide separation was achieved using 0.1% (v/v) formic acid in water (mobile phase A) and 0.1% (v/v) formic acid in acetonitrile (mobile phase B). The flow rate was set to 350 nL/min in the first 12 min of the gradient and 250 nL/min in the main gradient. The gradient was linear from 8% to 28% phase B in 35 min, 28% to 36% in 5 min, 36 to 95% in 0.5 min, staying isocatic for 5 min and then equilibrating at 8% for 10 min at 350 nL/min.
The data acquisition was performed in positive mode using a Q Exactive HF-X Orbitrap mass spectrometer (Thermo Fisher Scientific Inc., Waltham, MA, USA). MS data were acquired in a data-dependent strategy, selecting up to the top 12 precursors based on precursor abundance in the survey scan (m/z 350–1500). The resolution of the survey scan was 120,000 (at m/z 200) with a target value of 3 × 10E6 ions and a maximum injection time of 100 ms. HCD MS/MS spectra were acquired with a target value of 1 × 105 and resolution of 15,000 (at m/z 200) using an NCE of 28. The maximum injection time for MS/MS was 22 ms. Dynamic exclusion was enabled for 20 s after one MS/MS spectra acquisition. The isolation window for MS/MS fragmentation was set to 1.2 m/z. Three technical replicas were acquired.
Data Analysis: The generated raw files were searched using the MaxQuant Software (1.6.14.0) (MaxPlanck, Germany) [51] using Andromeda, against the predicted proteome based on the N. benthamiana Genome v1.0.1 (Niben v1.0.1, containing 56701 proteins, 2015), with the predicted PSTVd ORFs and the MaxQuant common contaminant database. To be accepted for the identification, an error of less than 20 ppm (first recalibration search) and 4.5 ppm tolerance in the main search of peptide mass tolerance was accepted. Up to 2 missed cleavages were allowed and the modifications taken into account were: oxidation (M); acetylation (protein N-term); deamidation (NQ) as variable and carbamidomethylation (Cys) as fixed modifications. Matching between runs and second peptide options were activated. Protein, peptide and “site” identifications were validated at an FDR of 1% using a reversed database. The above data analysis was repeated using an “unspecific” search mode against the predicted PSTVd ORFs, removing the constraint for tryptic generated peptides.
Data visualization: The MaxQuant search engine quantitative (LFQ) results were analyzed and visualized using the Perseus computational framework (version 1.6.10.43) (MaxPlanck, Germany) [52]. The LFQ values were log2 transformed and the proteins were filtered for potential contaminants, reversed hit and those were only identified by site. The biological and technical replicates were grouped into non-inoculated or PSTVd-infected plants and the two groups were filtered based on at least 70% valid values present in at least one group. Remaining empty values were imputed based on normal distribution. The groups were compared using a student t-test using permutation-based FDR calculation (s0: 0.1, FDR < 0.05). The results after statistical analysis were visualized in a volcano graph based on the difference between the two samples expressed in log2(x) versus their statistical significance expressed in −Log10 (p value).
Enrichment analysis: Enrichment analysis was carried out on the PlantRegMap web service (http://plantregmap.gao-lab.org/ accessed on 8 December 2021), using the Niben1.0.1 annotations of N. benthamiana with threshold p-value ≤ 0.01 [53].

3. Results

3.1. Analysis of the Presence of ORFs in Viroid Sequences

To identify possible ORFs in viroid sequences, we used the nucleotide sequence of 30 different viroid species from the Pospiviroidae family, including all available isolates at the time of this study (Table S1). Firstly, we duplicated the sequence of each viroid to avoid ‘premature’ termination of a predicted ORF at the 3`/5` junction of the genomic sequences, since viroids are circular. Secondly, we used both AUG as well as non-AUG start codons, based on the work of Kearse and Wilusz [2]. Finally, in the case of overlapping ORFs, we decided to keep only the longer ORF. With these rules, we showed that all viroids are predicted to produce small peptides with a mean size of peptides for each species ranging from 3 to 15 kDa (Table 1). It is important to note that differences in the observed number of small peptides for each viroid species can be primarily attributed to the different number of isolates available for the analysis (Supplementary Table S1). All predicted peptides were then analyzed using BLASTp against the complete non-redundant NCBI protein database (nr) to test for similarity with known proteins, but none were identified.
Since the presence of an optimal Kozak sequence can enhance the production of a peptide [54], we studied if the predicted ORFs contain an optimum Kozak sequence associated with the identified start codons. For this purpose, we used the motif described in Joshi et al. [33]. As shown in Table 2, 17 PSTVd isolates present a Kozak frame, whereas CEVd, CSVd and CLVd present the same motif but only in a very small number of the tested isolates. This suggests that even though starting codons are present in viroids, only a few of them are highly favorable to be used for translation.
We then assessed the likelihood of the existence of ORFs in relation to their position throughout the genome. For this, we used two different approaches. Firstly, we calculated the degree of conservation of the various ORFs between the different isolates of the same species as the proportion of ORFs identified in the same position across genomes of the same species (see Methods). Histograms of mean conservation for the isolates are shown in Figure 1A (for PSTVd) and Supplementary Figure S1 (for the other viroids), with a conservation score of 1 corresponding to 100% sequence identity between isolates. For most of the viroids, including PSTVd, the score is close to 1, indicating that the ORFs identified in isolates of PSTVd are highly conserved. However, this feature is not shared by all species, since some viroids, such as IRVd and CBCVd2, lack ORF sequence conservation. PVd was not included in the analysis since we only accessed one isolate of this specific viroid. The second approach was to assess the possibility of ORF existence in artificially scrambled viral genome sequences. The results are presented in Figure 1B and Supplementary Figure S2, as scatterplots of numbers of observed ORFs in real vs. scrambled genome sequences. The presence of dots above the red diagonal line of the graph corresponds to a higher tendency for the ORFs in the real sequences, whereas the presence of dots below the red line corresponds to a higher frequency for ORFs in the scrambled genome sequence. For the tested viroid species, some of them present more ORFs in their real sequence compared to the scrambled sequences (e.g., PSTVd AGVd, and HLVd), suggesting that the identified ORFs are somewhat constrained by the genomic sequence structure. Again, this is not a general feature since viroids such as CEVd, CLVd and GYSVd show more ORFs in the scrambled genome, suggesting that not all viroids have the same tendency in terms of predicted ORFs, and that even though they are in the same family, viroids may work in a different way to produce infection (Figure S2).
We also explored the possibility of ORF “hotspots”, or positions in the genome with an increased likelihood to give rise to ORFs. By projecting each identified ORF coordinate on its genome of origin, we created aggregate plots of “ORF-density” over the length of the genome for each species. We then compared the density plot with the one obtained from scrambled genomes. Results are presented in Figure 1C and Supplementary Figure S3. In PSTVd isolates, a hotspot is observed between nucleotides at positions 45 to 62, which is clearly not observed when the genome was shuffled, suggesting that this region could be important for the production of peptides. Hotspots were also observed in all viroids; however, the number as well as their distribution varies depending on the viroid species (Figure S3).
Last, we performed a structural analysis of the viroid sequences with regard to the presence of these ORFs. If a ribosome is to be attached on the viroid sequence, this is more probable to happen in a loop region than in a self-complementary base-paired sequence. For this, we calculated the presence of ORF in loops, bulges and hairpins, using published structures of viroids [18,19,55,56,57,58,59]. Although not all viroids have a solved secondary structure, most of the tested viroids have starting codons in loops, suggesting that a ribosome could attach to this region to initiate translation (Table S3).
Taken together, the above results indicate that there are ORFs present in all tested viroids, even though very few are associated with a favorable Kozak sequence. Nevertheless, there are converging indications of spatial, sequence and structural constraints associated with the identified potential ORFs. A significant percentage of these are conserved between isolates and are preferably positioned in loops, which is suggestive of an increased likelihood for translation.
To investigate this hypothesis, we focused on only one viroid, PSTVd, an important quarantine viroid, and particularly on two strains that have been widely used in different works in recent years, PSTVdRG1 and PSTVdNb, which both contain a number of putative ORFs based on the analysis described.

3.2. Analysis of Potential Quasi-Species during Infections to Identify Possible Additional ORFs

As already mentioned, in this analysis we used two different PSTVd strains, PSTVdRG1 and PSTVdNB, both capable of creating quasi-species during infection. A previous study showed that PSTVd may exhibit a 1/3800 to 1/7000 mutation rate [60]. A point mutation could potentially generate start codons in several regions of the PSTVdRG1 sequence. The PSTVd-sRNA sequences of PSTVdRG1-infected tomato plants (GEO Acc. No. GSM1717894), which were previously generated by Adkar-Purushothama et al. [39], were analyzed for the presence of potential start codons. The results showed a total of 143 AUG out of the 4594 PSTVd-sRNA sequences analyzed (3.1%). All the mutations that led to the formation of an AUG initiation codon are shown in Figure 2A,B.
We then performed HTS analysis using either non-infected or PSTVdNB-infected N. benthamiana plants. PSTVdNB infection was confirmed by Northern blotting prior to sequencing (data not shown). HTS reads that mapped to PSTVdNB were used for the identification of quasi-species. This analysis allowed the identification of a mutation likelihood expressed as percentage to be determined for each nucleotide at all genome positions (Table S4). The overall likelihood for each position in the PSTVd genome was found to be <1%; however, at positions 40 to 60 of the PSTVd genomic sequence, the mutation percentage was as high as 7% (Table S4 and Figure S4). Subsequent analysis of the mutations identified 111 putative AUG codons generated at positions where nucleotide changes were observed. Mutations with the highest probability in each position are presented Figure 2C,D. These results suggest that even if native PSTVd sequences do not possess a large number of AUG initiation codons, there is a tendency for the generation of mutations during infection/replication, which may lead to the formation of ORFs, therefore allowing the translation of peptides from viroid RNAs during the infection process.

3.3. The Circular Form of PSTVd Is Associated with Ribosomes

It has been shown before that PSTVd is found in ribosomes, but only in tomatoes [27]. In order to understand the association of PSTVd with the host ribosome during infection, tomato and N. benthamiana plants infected with PSTVdRG1 were used. PSTVdRG1 is known to induce severe symptoms in tomato cv. Rutgers, while N. benthamiana is a symptomless host [39,61]. Viroid accumulation in both tomato and N. benthamiana plants was confirmed by RT-PCR from the upper leaves. Both tomato and N. benthamiana plants showed PSTVd-specific amplicons of approximately 360 nt (i.e., the full length; Figure 3A), which was confirmed by sequencing.
Then, we investigated the presence of the viroid in ribosomes. Lysate from collected tissue was subjected to centrifugations, including ultracentrifugation on a 60% sucrose cushion (Figure 3B). RT-PCR and Northern blot analysis confirmed the presence of PSTVd in the total ribosome fraction of the infected tomato and N. benthamiana plants (Figure 3C,D). Additionally, RT-qPCR assays were performed on both total RNA extracts and RNA extracts derived from the total ribosomal fraction to quantify the level of viroid enrichment in the ribosomes. Higher amounts of viroid molecules were detected in the total ribosomal fraction as compared to the total RNA extract, suggesting that PSTVd is indeed enriched in the ribosomes of both tomato and N. benthamiana plants (Figure 3E). These results confirmed that viroids are associated with the total ribosomal fraction of infected plants.
However, to verify whether viroid molecules are associated with non-translating ribosomes (40S, 60S and 80S) or with polysomes, the total ribosomal fractions from leaf samples were subjected to fractionation (Figure 4A). Briefly, the isolated ribosomal fractions were dissolved in resuspension buffer and then were layered on a 5–50% sucrose gradient cushion. During centrifugation, the heavier molecules move down the sucrose gradient faster than do the lighter ones. In other words, the polysomes move towards the bottom of the tube, followed by the 80S ribosomes (monosomes), while both the 60S and 40S ribosomal subunits remain on the top of the gradient. The fractionated RNAs were grouped into non-translating ribosomes and polysomes and were subjected to RT (using the Vid-RE primer), followed by PCR amplification using the Vid-FW/Vid-RE primers. Results showed the presence of full-length PSTVd-specific amplicons were derived only from the polysome fraction of PSTVdRG1-inoculated tomato and N. benthamiana plants. No PCR amplification was detected with the RNA isolated from the non-translation ribosome fractions of the infected plants. None of the mock-inoculated plants showed any amplification (Figure 4B). The PSTVd-specific bands were cloned and sequenced in order to confirm their identity. The data presented here suggest that PSTVd is associated with polysomes in both infected tomato and N. benthamiana plants. It is worthy to highlight that, as described in Cottilli et al., a peak corresponding to 40S fraction is very low, suggesting that PSTVd could be affecting the 18S rRNA maturation, and therefore the 40S formation, also in N. benthamiana [27].
The simplest and most powerful tool with which to verify whether these polysome-associated PSTVd molecules are linear or circular RNA is cDNA synthesis using a target-specific primer followed by two independent PCRs, as described in Figure 4C. If the target is circRNA, both PCRs should yield amplicons equivalent to the full-length targets, whereas if the target is monomeric linear, only one PCR will yield a full-length target. Hence, second full-length PCR amplification was performed using a new set of primers (PSTVd-254F/PSTVd-253R) on the RT product which was synthesized using the Vid-RE primer. Results revealed the presence of full-length PSTVd amplicons in the polysome fraction of PSTVd inoculated plants (also verified by sequencing), but not in either the ribosome fraction or in the mock-inoculated plants (Figure 4D). Taken together, these results suggest that circular PSTVd molecules are found in translating ribosomes of both tomato and N. benthamiana plants.

3.4. In Vitro Translation of PSTVd

In order to verify potential start codons, in vitro translation assays were performed using the wheat germ extract system with the idea of verifying whether or not PSTVdRG1 ORFs could be translated into peptides. For this purpose, in vitro-generated circular (+) PSTVd and both (+) and (−) monomeric and dimeric PSTVds RNAs were prepared using a synthetic PSTVdRG1 sequence. The positive control (i.e., luciferase control RNA) produced a high intensity band, while none of the tested viroid transcripts permitted the detection of peptides by immunoblot assays (Figure 5). These experiments were repeated under many different conditions, including the use of various concentrations of both magnesium (2 to 5 mM MgCl2) and potassium (50 to 150 mM KCl), as well as of various incubation times (60–120 min) and temperatures (25 °C to 30 °C). Regardless of the conditions tested, it was not possible to detect the synthesis of any peptides derived from the PSTVd template.

3.5. Using Mass Spectrometry to Identify PSTVd Produced Small Peptides

To study in vivo possible PSTVd peptide production, we performed MS analysis in infected plants. N. benthamiana plants were inoculated with PSTVdNB and 4 wpi leaves were collected and tested for viroid presence (Figure 6A). Since we have used PSTVdNB, the expected peptides to be produced were known and are shown in Table 3. We selected and performed three biological and three technical replicates for not infected and PSTVd-infected plants. We identified 3730 different proteins, and after filtering (see Materials and Methods), we kept 3227 proteins for further analysis, presented in Table S5. We first focused on the analysis of the proteins found in order to validate the MS technique. After statistical analysis, 85 proteins were identified as having their expression altered by PSTVd infection and are shown in a volcano plot (Figure 7A) as well as in detail in Table 4. The log2 difference is derived from the statistical comparison of the LFQ intensities between the two groups (infected samples vs. control samples). In order to verify the results, we looked at older published data [28]. Proteins such as oxygen-evolving enhancer protein 2 (OEE2) or pathogen-related protein 10 (PR10) were found in our experimental set as statistically significantly altered by PSTVd, as has been previously described for CEVd [28]. Therefore, we considered that our results were of good quality to be used for further analysis.
By analyzing the ontology of the identified proteins in detail (Table 4), it was revealed that certain proteins involved in metabolism and stress are influenced by the viroid infection. In addition, most of the affected proteins are located in the cytoplasm or in the chloroplast and not in the nucleus (Figure S5). Furthermore, an important number of proteins involved in translation seem to be affected. In Figure 7B, the red dots of the Volcano plot represent all identified proteins involved in translation, and it is obvious that there is a tendency for under-expression of these proteins upon viroid infection. Some of these proteins have been found with statistically significant changes (Figure 7C). This result suggests that translation is leading to a shut down during viroid infection.
Then, we focused on the presence of small PSTVd peptides. Even though in the performed analysis we were able to recognize a significant number of small peptides (as small as 3kDa), none of the in silico-predicted PSTVd microproteins were positively identified. Therefore, we proceeded with two alternative strategies (Figure 6B). We reasoned that the previous highly complex in-protein experiment may have masked some small peptides due to the large number of cellular proteins found in the lysate. For that reason, we opted for the filtration of the lysate to enrich our samples for low-molecular-weight proteins (Figure 6B). We also performed a third strategy, where we performed a 15% SDS-PAGE gel, cut bands under 30kDa and repeated the proteomic analysis. The data analysis of the above strategies was performed using both specific trypsin digestion as well as the non-stringent “unspecific digestion” alternative. Unfortunately, even though small peptides were identified originating from other proteins, we were not able to identify any of the predicted PSTVd peptides.

4. Discussion

Since the discovery of viroids, it has been generally accepted that they do not encode ORFs. However, recent research developments suggest that viroids can bind to ribosomes [27]. In addition, endogenous circRNAs have the capacity of being translated and produce small peptides called micropeptides [8,9,10,11]. With this in mind, we decided to revisit the idea that viroid RNAs are not translated by using distinct and sensitive techniques.
We performed thorough bioinformatics analysis using 30 different Pospiviroidae species, including 2441 published isolates. We showed that all tested viroid sequences contain small ORFs with mean sizes of putative polypeptides ranging between 3 and 15 kDa. We have considered ORFs that started with AUG or non-AUG starting codons [2]; however, very few of them presented a favorable Kozak sequence that would predict enhanced translation. The presence of these ORFs does not appear to be random since, as suggested by the spatial preference of ORFs to occur in the same position across genomes. Finally, by analyzing all viroid isolates, we determined ‘hotspots’ usually found in structurally loose regions of the genome. For PSTVd the hotspot was mostly located between positions 40 to 60 in the pathogenicity region. These analyses provide evidence that viroid genomes possess potential ORFs that could be translated.
The production of microproteins from small ORFs, including from circRNA, has been described previously [8,9,10,11]. Precursors of miRNAs, which have been previously proposed to have similar structural features to viroids, have also been found to interact with ribosomes and produce micropeptides ranging from 4 to 60 aa [62,63,64]. ORF translation from UTR has also been produced by uORFs (upstream ORFs in the 3′UTR) or sORFs (small ORFs generally in 5′UTRs). Most uORFs are found upstream of major mRNA ORFs and are most often initiated using an AUG start codon. However, almost 50% of uORFs have been found to start from non-AUG start codons [65]. The production of peptides from uORFs has been found essential in translation since it can either enhance translation (e.g., ribosomal shunt) or reduce it [66,67]. Finally, circular RNA satellites, which are small pathogens sharing a few common characteristics with viroids, have been found capable of producing small peptides [21].
In this work, we have specifically focused on PSTVd to study the possible production of peptides by viroids in the two different strains used in this work, PSTVdRG1 and PSTVdNB. Although there was no AUG present, there were a few non-AUG starting codons, allowing the production of peptides ranging from 3 to 204 aa for PSTVdNB and from 2 to 61aa for PSTVdRG1. However, upon infection, a significant number of point mutations are produced (3% and 7% depending on the system) as has been shown before [60], also generating AUG starting codons, that can be used for initiation of translation. However, the number of recognized quasi-species with these mutations is relatively small to significantly affect viroid biology.
It has been shown that CEVd genomic RNA as well as viroid-derived siRNAs have been localized in ribosomes [27], suggesting that pospiviroidae species have the tendency of accumulating in ribosomes. In this work, we have shown that the circular PSTVd genome localizes in ribosomes in N. benthamiana and tomato plants too. Therefore, applying a combination of new and older techniques, we aimed to test the hypothesis that viroids can be translated. We first performed in vitro experiments, but no translation products were found in any of the different conditions tested. Older experiments using both PSTVd and CEVd in in vitro translation experiments showed similar results [22,23]. In addition, analogous experiments in viroid PLMVd of the Avsunviroidae family again did not produce any peptides (F. Cote and J.P. Perreault, unpublished results). Taken together, these results suggest that no peptides are produced in cell-free in vitro systems. Nevertheless, this system has some limitations, including low protein yield [68], and therefore we cannot exclude the possibility that peptides may be produced but not detected. Consequently, we opted for an in vivo experiment to look for peptides using a different technique.
We performed proteomic analysis in lysates of PSTVd-infected N. benthamiana plants, using a robust dataset containing three biological replicas and three technical replicas. We showed altered expression of 85 proteins during PSTVd infection. Some, such as OEE2 and PR10, have also been described previously, suggesting that our analysis was accurate [28]. We found that an important number of PSTVd deregulated proteins are localized in the cytoplasm. In addition, we found that apart from proteins usually affected upon infection, such as stress proteins or proteins related to different metabolic pathways, proteins related to the translation mechanism were also influenced, showing a trend of under-expression. This phenomenon could be related to ribosomal stress. It has been proposed before that during CEVd infection, ribosomal biogenesis in tomato plants was affected [27]. Downregulation of proteins related to translation could also be a result of a translation shut-off. Viruses benefit from a decrease in the translation of endogenous transcripts as this protects them from defense-related proteins. In addition, they may divert translation to their own benefit [69]. This can be achieved by different mechanisms such as influencing translation initiation factors or even cleaving endogenous mRNAs. Hence, the most common ‘strategy’ used by viruses is to either bind or affect the phosphorylation translation initiation or elongation factors [69]. It has been proposed before by independent studies that CEVd, PSTVd and PMLVd bind eIF1A [28,29]. Other factors such as eEF2 and eIF5A have been found to be influenced by CEVd infectivity [27], suggesting that viroids may decrease the translation rate in order to gain time for establishing host propagation.
From the standard LC-MS/MS lysate analysis, no PSTVd-expressed microprotein was identified. We reasoned this could be due to the large number of proteins identified, that could in a way ‘mask’ small peptides. Therefore, we have opted firstly for a filtering of the lysate, keeping only small peptides, and, secondly assessed proteins smaller than 30 kDa following electrophoresis, using LC-MS/MS. Again, both strategies failed to identify PSTVd-derived peptides. It cannot be excluded that technical limitations may be responsible for this. One possibility is that these peptides are extremely hydrophilic, making them difficult to be detected by the LC-MS/MS technique. Then again, we have tested the predicted peptides with a specific software for hydrophobicity, and they were found adequate for LC-MS/MS (data not shown). Another issue could be the low quantity of the produced peptides. Yet, as shown in a Northern blot, the quantity of viroid present at 4 wpi is high enough to assume that if a peptide is produced by each molecule, then its quantity should be detectable. Another possibility could be a fast peptide degradation procedure that would increase the difficulty to obtain a peptide fragment in LC-MS/MS, even though a protease inhibitor was added into the lysis buffer. We cannot also exclude that a probable PSTVd peptide could be retained in a specific cellular domain that we cannot obtain using this work specific conditions. Finally, the used lysis buffer could be improved for small peptides as it was recently published [70].

5. Conclusions

Our results suggest that even though viroids are present in ribosomes and have ORFs which are potentially translatable, no peptide was identified using either in vitro or in vivo translation experiments. Therefore, viroids may be ‘using’ ribosomes for reasons other than translation. One possibility could be binding to ribosomes for protection. It has been shown before that the ribosome protects the portion of RNA enclosed within its subunits [71,72]. Although usually only around 35 nt are protected, more than one ribosome can typically be found associated with an mRNA [72]. Therefore, we could speculate that through binding to PSTVd RNAs, multiple ribosomes can provide protection from the action of different cellular nucleases. An alternative explanation may be related to the movement of viroid RNAs. Ribosomes localize at the surface of the endoplasmic reticulum, the mitochondria, as well as freely in the cytosol. Cytosolic ribosomes are suggested to use microtubules to circulate in cells [73], so it could be speculated that viroids use ribosomes to move within the cell. Finally, another possibility could be that viroids are binding to ribosomes to hijack the translation mechanism. However, if and to what extent the interaction of viroid ribosomes is related to viroid pathogenicity remains unclear. Taken together, this study shows that even though ORFs are present in viroids, in our experimental conditions, they do not seem to be translated. Nevertheless, viroids may utilize ribosomes for a different reason. Further experimentation is needed to test such a hypothesis.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/cells11020265/s1, Figure S1: Conservation rate in viroid species, Figure S2: Comparison between bioinformatically shuffled genome and real genome for viroids, Figure S3: Presence of ‘hotspots’ in viroid genomes, Figure S4: Nucleotide mutation rate for PSTVd, Figure S5: GO enrichment analysis using PlantRegMap, focusing of cellular compartment, Table S1: Viroids and strains used for this analysis (by NCBI), Table S2: Primers used in this study, Table S3: ORF present in different part of viroid structure, Table S4: Presence of alternative nucleotides in different PSTVd positions, Table S5: Proteins identified by MS in PSTVd infected vs. Healthy N. benthamiana plants.

Author Contributions

K.K. (Konstantina Katsarou), C.R.A.-P., E.T. performed the experiments. M.S. performed the LC-MS/MS experiments and analysis. C.A., E.T., C.N. performed the bioinformatics analysis. K.K. (Konstantina Katsarou), C.R.A.-P., E.T., M.S., C.A., C.N., P.L., J.-P.P., K.K. (Kriton Kalantidis). wrote the article. All authors have read and agreed to the published version of the manuscript.

Funding

Katsarou K. and Kalantidis K. are supported in part by the grant Emblematic Action for Research in the Cretan Agrofood sector: Four Institutions, Four References’ (AGRO4CRETE—2018ΣΕ01300000) held by the General Secretary for Research and Technology of Greece as well as the National Flagship Initiative “The paths of Grapevine” of the public investments programs of the GSRT:2018ΣE0100000.Proteomic platform was supported by the project “The Greek Research Infrastructure for Personalized Medicine (pMED-GR)” (MIS 5002802) which is implemented under the Action “Reinforcement of the Research and Innovation Infrastructure”, funded by the Operational Program “Competitiveness, Entrepreneurship and Innovation” (NSRF 2014-2020) and co-financed by Greece and the European Union (European Regional Development Fund). J.-P.P. was funded by the Natural Sciences and Engineering Research Council of Canada [155219-17 to J.-P.P.]; The RNA group is supported by a grant from the Université de Sherbrooke. J.-P.P. holds the Research Chair of the Université de Sherbrooke in RNA Structure and Genomics and is a member of the Centre de Recherche du CHUS.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE [74] partner repository with the dataset identifier PXD030755.

Acknowledgments

We thank George Stamataki for his help in the proteomics experiments.

Conflicts of Interest

The authors declare that there is no conflict of interest. This work does not contain any human/animal experiments, and no personal information was used.

References

  1. Parsyan, A. Translation and Its Regulation in Cancer Biology and Medicine; Springer Publishing: Cham, Switzerland, 2014. [Google Scholar]
  2. Kearse, M.G.; Wilusz, J.E. Non-AUG translation: A new start for protein synthesis in eukaryotes. Genes Dev. 2017, 31, 1717–1731. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Wu, J.; Xiao, J.; Zhang, Z.; Wang, X.; Hu, S.; Yu, J. Ribogenomics: The Science and Knowledge of RNA. Genom. Proteom. Bioinform. 2014, 12, 57–63. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Katsarou, K.; Rao, A.; Tsagris, M.; Kalantidis, K. Infectious long non-coding RNAs. Biochime 2015, 117, 37–47. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Hsu, M.-T.; Coca-Prados, M. Electron microscopic evidence for the circular form of RNA in the cytoplasm of eukaryotic cells. Nature 1979, 280, 339–340. [Google Scholar] [CrossRef] [Scilit]
  6. Chen, L.-L.; Yang, L. Regulation of circRNA biogenesis. RNA Biol. 2015, 12, 381–388. [Google Scholar] [CrossRef] [Scilit]
  7. Chen, L.-L. The expanding regulatory mechanisms and cellular functions of circular RNAs. Nat. Rev. Mol. Cell Biol. 2020, 21, 475–490. [Google Scholar] [CrossRef] [Scilit]
  8. Wang, Y.; Wang, Z. Efficient backsplicing produces translatable circular mRNAs. RNA 2014, 21, 172–179. [Google Scholar] [CrossRef] [Scilit]
  9. Legnini, I.; Di Timoteo, G.; Rossi, F.; Morlando, M.; Briganti, F.; Sthandier, O.; Fatica, A.; Santini, T.; Andronache, A.; Wade, M.; et al. Circ-ZNF609 Is a Circular RNA that Can Be Translated and Functions in Myogenesis. Mol. Cell 2017, 66, 22–37.e9. [Google Scholar] [CrossRef] [Scilit]
  10. Pamudurti, N.R.; Bartok, O.; Jens, M.; Ashwal-Fluss, R.; Stottmeister, C.; Ruhe, L.; Hanan, M.; Wyler, E.; Perez-Hernandez, D.; Ramberger, E.; et al. Translation of CircRNAs. Mol. Cell 2017, 66, 9–21.e7. [Google Scholar] [CrossRef] [Scilit]
  11. Yang, Y.; Fan, X.; Mao, M.; Song, X.; Wu, P.; Zhang, Y.; Jin, Y.; Yang, Y.; Chen, L.-L.; Wang, Y.; et al. Extensive translation of circular RNAs driven by N6-methyladenosine. Cell Res. 2017, 27, 626–641. [Google Scholar] [CrossRef] [Scilit]
  12. Fan, X.; Yang, Y.; Wang, Z. Pervasive translation of circular RNAs driven by short IRES-like elements. bioRxiv 2020, 473207. [Google Scholar] [CrossRef] [Scilit]
  13. Heesch, V.S.; Witte, F.; Schneider-Lunitz, V.; Schulz, J.F.; Adami, E.; Faber, A.B.; Kirchner, M.; Maatz, H.; Blachut, S.; Sandmann, C.-L.; et al. The Translational Landscape of the Human Heart. Cell 2019, 178, 242–260.e29. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Sogo, J.; Koller, T.; Diener, T. Potato spindle tuber viroid. Virology 1973, 55, 70–80. [Google Scholar] [CrossRef] [Scilit]
  15. Flores, R.; Di Serio, F.; Navarro, B.; Duran-Vila, N.; Owens, R. Viroids and viroid diseases of plants. Wiley Blackwell 2011, 12, 307–341. [Google Scholar]
  16. Diener, T.O. Potato spindle tuber “virus”. Virology 1971, 45, 411–428. [Google Scholar] [CrossRef] [Scilit]
  17. Di Serio, F.; Flores, R.; Verhoeven, K.; Li, S.; Pallas, V.; Randles, J.; Sano, T.; Vidalakis, G.; Owens, R.A. Current status of viroid taxonomy. Arch. Virol. 2014, 159, 3467–3478. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Rao, A.; Kalantidis, K. Virus-associated small satellite RNAs and viroids display similarities in their replication strategies. Virology 2015, 479, 627–636. [Google Scholar] [CrossRef] [Scilit]
  19. Steger, G.; Perreault, J.-P. Structure and Associated Biological Functions of Viroids; Elsevier: Amsterdam, The Netherlands, 2016; Volume 94, pp. 141–172. [Google Scholar]
  20. Adkar-Purushothama, C.R.; Perreault, J. Current overview on viroid–host interactions. Wiley Interdiscip. Rev. RNA 2020, 11, e1570. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. AbouHaidar, M.G.; Venkataraman, S.; Golshani, A.; Liu, B.; Ahmad, T. Novel coding, translation, and gene expression of a replicating covalently closed circular RNA of 220 nt. Proc. Natl. Acad. Sci. USA 2014, 111, 14542–14547. [Google Scholar] [CrossRef] [Scilit]
  22. Davies, J.; Kaesberg, P.; Diener, T. Potato spindle tuber viroid. XII. An investigation of viroid RNA as a messenger for protein synthesis. Virology 1974, 61, 281–286. [Google Scholar] [CrossRef] [Scilit]
  23. Hall, T.C. Functional Citrus Distinctions Viroid between the Ribonucleic Reactions Acids from Translation Exocortis and Plant Viruses: And Aminoacylation. Virology 1974, 492, 486–492. [Google Scholar] [CrossRef] [Scilit]
  24. Conejero, V.; Semancik, J. Exocortis viroid: Alteration in the proteins of Gynura aurantiaca accompanying viroid infection. Virology 1977, 77, 221–232. [Google Scholar] [CrossRef] [Scilit]
  25. Zaitlin, M.; Hariharasubramanian, V. A gel electrophoretic analysis of proteins from plants infected with tobacco mosaic and potato spindle tuber viruses. Virology 1972, 47, 296–305. [Google Scholar] [CrossRef] [Scilit]
  26. Semancik, J.; Conejero, V.; Gerhart, J. Citrus exocortis viroid: Survey of protein synthesis in Xenopus laevis oocytes following addition of viroid RNA. Virology 1977, 80, 218–221. [Google Scholar] [CrossRef] [Scilit]
  27. Cottilli, P.; Belda-Palazon, B.; Adkar-Purushothama, C.R.; Perreault, J.-P.; Schleiff, E.; Rodrigo, I.; Ferrando, A.; Lisón, P. Citrus exocortis viroid causes ribosomal stress in tomato plants. Nucleic Acids Res. 2019, 47, 8649–8661. [Google Scholar] [CrossRef] [Scilit]
  28. Lisón, P.; Tárraga, S.; López-Gresa, P.; Saurí, A.; Torres, C.; Campos, L.; Bellés, J.M.; Conejero, V.; Rodrigo, I. A noncoding plant pathogen provokes both transcriptional and posttranscriptional alterations in tomato. Proteomics 2013, 13, 833–844. [Google Scholar] [CrossRef] [Scilit]
  29. Dubé, A.; Bisaillon, M.; Perreault, J.-P. Identification of Proteins from Prunus persica That Interact with Peach Latent Mosaic Viroid. J. Virol. 2009, 83, 12057–12067. [Google Scholar] [CrossRef] [Scilit]
  30. Marquez-Molins, J.; Navarro, J.A.; Seco, L.C.; Pallas, V.; Gomez, G. Might exogenous circular RNAs act as protein-coding transcripts in plants? RNA Biol. 2021, 18, 98–107. [Google Scholar] [CrossRef] [Scilit]
  31. Quinlan, A.R.; Hall, I.M. BEDTools: A flexible suite of utilities for comparing genomic features. Bioinformatics 2010, 26, 841–842. [Google Scholar] [CrossRef] [Scilit]
  32. Kazutaka, K.; Misakwa, K.; Kei-ichi, K.; Miyata, T. MAFFT: A novel method for rapid multiple sequence alignment based on fast Fourier transform. Nucleic Acids Res. 2002, 30, 3059–3066. [Google Scholar] [CrossRef] [Scilit]
  33. Joshi, C.P.; Zhou, H.; Huang, X.; Chiang, V.L. Context sequences of translation initiation codon in plants. Plant Mol. Biol. 1997, 35, 993–1001. [Google Scholar] [CrossRef] [Scilit]
  34. Adkar-Purushothama, C.R.; Brosseau, C.; Giguère, T.; Sano, T.; Moffett, P.; Perreault, J.-P. Small RNA Derived from the Virulence Modulating Region of the Potato spindle tuber viroid Silences callose synthase Genes of Tomato Plants. Plant Cell 2015, 27, 2178–2194. [Google Scholar] [CrossRef] [Scilit]
  35. Adkar-Purushothama, C.R.; Perreault, J.-P. Alterations of the viroid regions that interact with the host defense genes attenuate viroid infection in host plant. RNA Biol. 2018, 15, 955–966. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Katsarou, K.; Mavrothalassiti, E.; Dermauw, W.; Van Leeuwen, T.; Kalantidis, K. Combined Activity of DCL2 and DCL3 Is Crucial in the Defense against Potato Spindle Tuber Viroid. PLoS Pathog. 2016, 12, e1005936. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Rivera, M.C.; Maguire, B.; Lake, J.A. Purification of Polysomes. Cold Spring Harb. Protoc. 2015, 2015, 303–305. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Parenteau, J.; Lavoie, M.; Catala, M.; Malik-Ghulam, M.; Gagnon, J.; Elela, S.A. Preservation of Gene Duplication Increases the Regulatory Spectrum of Ribosomal Protein Genes and Enhances Growth under Stress. Cell Rep. 2015, 13, 2516–2526. [Google Scholar] [CrossRef] [Scilit]
  39. Adkar-Purushothama, C.R.; Iyer, P.S.; Perreault, J.-P. Potato spindle tuber viroid infection triggers degradation of chloride channel protein CLC-b-like and Ribosomal protein S3a-like mRNAs in tomato plants. Sci. Rep. 2017, 7, 8341. [Google Scholar] [CrossRef] [Scilit]
  40. Dadami, E.; Boutla, A.; Vrettos, N.; Tzortzakaki, S.; Karakasilioti, I.; Kalantidis, K. DICER-LIKE 4 But Not DICER-LIKE 2 May Have a Positive Effect on Potato Spindle Tuber Viroid Accumulation in Nicotiana benthamiana. Mol. Plant 2013, 6, 232–234. [Google Scholar] [CrossRef] [Scilit]
  41. Chen, S.; Zhou, Y.; Chen, Y.; Gu, J. fastp: An ultra-fast all-in-one FASTQ preprocessor. Bioinformatics 2018, 34, i884–i890. [Google Scholar] [CrossRef] [Scilit]
  42. OFFICIAL STATEMENT. BMJ 1854, s3-2, 68–70. [CrossRef] [Scilit]
  43. Li, H.; Handsaker, B.; Wysoker, A.; Fennell, T.; Ruan, J.; Homer, N.; Marth, G.; Abecasis, G.; Durbin, R.; 1000 Genome Project Data Processing Subgroup. The Sequence Alignment/Map format and SAMtools. Bioinformatics 2009, 25, 2078–2079. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Marinier, E.; Enns, E.; Tran, C.; Fogel, M.; Peters, C.; Kidwai, A.; Ji, H.; Van Domselaar, G. Quasitools: A Collection of Tools for Viral Quasispecies Analysis. bioRxiv 2019, 1–4. [Google Scholar] [CrossRef] [Scilit]
  45. Verhoeven, K.; Jansen, C.; Willemen, T.; Kox, L.; Owens, R.; Roenhorst, J. Natural infections of tomato by Citrus exocortis viroid, Columnea latent viroid, Potato spindle tuber viroid and Tomato chlorotic dwarf viroid. Eur. J. Plant Pathol. 2004, 110, 823–831. [Google Scholar] [CrossRef] [Scilit]
  46. Boonham, N.; González-Pérez, L.; Mendez, M.; Peralta, E.; Blockley, A.; Walsh, K.; Barker, I.; Mumford, R. Development of a real-time RT-PCR assay for the detection of Potato spindle tuber viroid. J. Virol. Methods 2004, 116, 139–146. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Hellemans, J.; Mortier, G.; De Paepe, A.; Speleman, F.; Vandesompele, J. qBase relative quantification framework and software for management and automated analysis of real-time quantitative PCR data. Genome Biol. 2007, 8, R19. [Google Scholar] [CrossRef] [Scilit]
  48. Hughes, C.S.; Foehr, S.; Garfield, A.D.; Furlong, E.; Steinmetz, L.; Krijgsveld, J. Ultrasensitive proteome analysis using paramagnetic bead technology. Mol. Syst. Biol. 2014, 10, 757. [Google Scholar] [CrossRef] [Scilit]
  49. Candiano, G.; Bruschi, M.; Musante, L.; Santucci, L.; Ghiggeri, G.M.; Carnemolla, B.; Orecchia, P.; Zardi, L.; Righetti, P.G. Blue silver: A very sensitive colloidal Coomassie G-250 staining for proteome analysis. Electrophor. 2004, 25, 1327–1333. [Google Scholar] [CrossRef] [Scilit]
  50. Shevchenko, A.; Tomas, H.; Havlis, J.; Olsen, J.; Mann, M.J. In-gel digestion for mass spectrometric characterization of proteins and proteomes. Nat. Protoc. 2006, 1, 2856–2860. [Google Scholar] [CrossRef] [Scilit]
  51. Cox, J.; Mann, M. MaxQuant enables high peptide identification rates, individualized p.p.b.-range mass accuracies and proteome-wide protein quantification. Nat. Biotechnol. 2008, 26, 1367–1372. [Google Scholar] [CrossRef] [Scilit]
  52. Tyanova, S.; Temu, T.; Sinitcyn, P.; Carlson, A.; Hein, M.Y.; Geiger, T.; Mann, M.; Cox, J. The Perseus computational platform for comprehensive analysis of (prote)omics data. Nat. Methods 2016, 13, 731–740. [Google Scholar] [CrossRef] [Scilit]
  53. Tian, F.; Yang, D.-C.; Meng, Y.-Q.; Jin, J.; Gao, G. PlantRegMap: Charting functional regulatory maps in plants. Nucleic Acids Res. 2019, 48, D1104–D1113. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Kozak, M. Context effects and inefficient initiation at non-AUG codons in eucaryotic cell-free translation systems. Mol. Cell. Biol. 1989, 9, 5073–5080. [Google Scholar] [CrossRef] [Scilit]
  55. Keese, P.; Symons, R.H. Domains in viroids: Evidence of intermolecular RNA rearrangements and their contribution to viroid evolution. Proc. Natl. Acad. Sci. USA 1985, 82, 4582–4586. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Zhong, X.; Archual, A.J.; Amin, A.A.; Ding, B. A Genomic Map of Viroid RNA Motifs Critical for Replication and Systemic Trafficking. Plant. Cell. 2008, 20, 35–47. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Nagy, P.D. Recombination in plant RNA viruses. In Plant Virus Evolution; Roossinck, M.J., Ed.; Springer: Berlin/Heidelberg, Germany, 2008; pp. 133–156. ISBN 978-3-540-75762-7. [Google Scholar]
  58. Giguère, T.; Adkar-Purushothama, C.R.; Perreault, J.-P. Comprehensive Secondary Structure Elucidation of Four Genera of the Family Pospiviroidae. PLoS ONE 2014, 9, e98655. [Google Scholar] [CrossRef] [Scilit]
  59. Giguère, T.; Perreault, J.-P. Classification of the Pospiviroidae based on their structural hallmarks. PLoS ONE 2017, 12, e0182536. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. López-Carrasco, A.; Ballesteros, C.; Sentandreu, V.; Delgado, S.; Zachert, S.G.; Flores, R.; Sanjuán, R. Different rates of spontaneous mutation of chloroplastic and nuclear viroids as determined by high-fidelity ultra-deep sequencing. PLoS Pathog. 2017, 13, e1006547. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Kalantidis, K.; Denti, M.A.; Tzortzakaki, S.; Marinou, E.; Tabler, M.; Tsagris, M. Virp1 Is a Host Protein with a Major Role in Potato Spindle Tuber Viroid Infection in Nicotiana Plants. J. Virol. 2007, 81, 12872–12880. [Google Scholar] [CrossRef] [Scilit]
  62. Hill, J.M.; Ezhao, Y.; Ebhattacharjee, S.; Lukiw, W.J. miRNAs and viroids utilize common strategies in genetic signal transfer. Front. Mol. Neurosci. 2014, 7, 10. [Google Scholar] [CrossRef] [Scilit]
  63. Lauressergues, D.; Couzigou, J.-M.; Clemente, H.S.; Martinez, Y.; Dunand, C.; Bécard, G.; Combier, J.-P. Primary transcripts of microRNAs encode regulatory peptides. Nature 2015, 520, 90–93. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Yadav, A.; Sanyal, I.; Rai, S.P.; Lata, C. An overview on miRNA-encoded peptides in plant biology research. Genomics 2021, 113, 2385–2391. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Hellens, R.P.; Brown, C.; Chisnall, M.A.; Waterhouse, P.M.; Macknight, R.C. The Emerging World of Small ORFs. Trends Plant. Sci. 2016, 21, 317–328. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. Schepetilnikov, M.; Schott, G.; Katsarou, K.; Thiébeauld, O.; Keller, M.; Ryabova, L.A. Molecular dissection of the prototype foamy virus (PFV) RNA 5′-UTR identifies essential elements of a ribosomal shunt. Nucleic Acids Res. 2009, 37, 5838–5847. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. González, M.D.L.L.G.; Rodríguez-Kessler, M.; Jiménez-Bremont, J.F. uORF, a regulatory mechanism of the Arabidopsis polyamine oxidase 2. Mol. Biol. Rep. 2014, 41, 2427–2443. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Zemella, A.; Thoring, L.; Hoffmeister, C.; Kubick, S. Cell-Free Protein Synthesis: Pros and Cons of Prokaryotic and Eukaryotic Systems. ChemBioChem 2015, 16, 2420. [Google Scholar] [CrossRef] [Scilit]
  69. Walsh, D.; Mathews, M.B.; Mohr, I. Tinkering with Translation: Protein Synthesis in Virus-Infected Cells. Cold Spring Harb. Perspect. Biol. 2013, 5, a012351. [Google Scholar] [CrossRef] [Scilit]
  70. Wang, S.; Tian, L.; Liu, H.; Li, X.; Zhang, J.; Chen, X.; Jia, X.; Zheng, X.; Wu, S.; Chen, Y.; et al. Large-Scale Discovery of Non-conventional Peptides in Maize and Arabidopsis through an Integrated Peptidogenomic Pipeline. Mol. Plant. 2020, 13, 1078–1093. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  71. Castles, J.J.; Singer, M.F. Degradation of polyuridylic acid by ribonuclease II: Protection by ribosomes. J. Mol. Biol. 1969, 40, 1–17. [Google Scholar] [CrossRef] [Scilit]
  72. Wolin, S.L.; Walter, P. Ribosome pausing and stacking during translation of a eukaryotic mRNA. EMBO J. 1988, 7, 3559–3569. [Google Scholar] [CrossRef] [Scilit]
  73. Noma, K.; Goncharov, A.; Ellisman, M.H.; Jin, Y. Microtubule-dependent ribosome localization in C. elegans neurons. ELife 2017, 6, 1–23. [Google Scholar] [CrossRef] [Scilit]
  74. Perez-Riverol, Y.; Csordas, A.; Bai, J.; Bernal-Llinares, M.; Hewapathirana, S.; Kundu, D.J.; Inuganti, A.; Griss, J.; Mayer, G.; Eisenacher, M.; et al. The pride database and related tools and resources in 2019: Improving support for quantification data. Nucleic Acids Res. 2019, 47, 442–450. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. Identification of Possible ORFs in PSTVd. (A) Conservation rate in PSTVd isolates. (B) Comparison between artificially shuffled genome and real genome for PSTVd. (C) Presence of ‘hotspots’ in PSTVd genome.
Figure 1. Identification of Possible ORFs in PSTVd. (A) Conservation rate in PSTVd isolates. (B) Comparison between artificially shuffled genome and real genome for PSTVd. (C) Presence of ‘hotspots’ in PSTVd genome.
Cells 11 00265 g001
Figure 2. Identification of possible quasi-species using viroid-derived siRNA and total RNA NGS analysis. (A,C) To locate the potential translation start codons on the PSTVdRG1 and PSTVdNB molecule, the in silico detected alternate start codons (indicated by green line over the nucleotides), the point mutation that could lead into a start codon (blue font), and the stop codons (red font) are shown on secondary structure of PSTVd. The green letters indicate the different nucleotides between PSTVdRG1 and PSTVdNB. (B) Analysis of sRNA derived from PSTVdRG1-inoculated plants revealed the presence of translation start codon (AUG) on PSTVdRG1 sequence. Location and changes in sequence variation that lead into the formation of potential start codons are shown on the secondary structure of PSTVdRG1. The red font indicates the nucleotide that was changed during infection. The two or three mutations that led into the formation of AUG are shown by blue font and an asterisk (*) indicates the nucleotide that showed both point mutation and double mutation. (D) Colors represent the same as in B but for PSTVdNB. However, only the mutations with the higher percentage range per position are represented in this figure (described in Table S4).
Figure 2. Identification of possible quasi-species using viroid-derived siRNA and total RNA NGS analysis. (A,C) To locate the potential translation start codons on the PSTVdRG1 and PSTVdNB molecule, the in silico detected alternate start codons (indicated by green line over the nucleotides), the point mutation that could lead into a start codon (blue font), and the stop codons (red font) are shown on secondary structure of PSTVd. The green letters indicate the different nucleotides between PSTVdRG1 and PSTVdNB. (B) Analysis of sRNA derived from PSTVdRG1-inoculated plants revealed the presence of translation start codon (AUG) on PSTVdRG1 sequence. Location and changes in sequence variation that lead into the formation of potential start codons are shown on the secondary structure of PSTVdRG1. The red font indicates the nucleotide that was changed during infection. The two or three mutations that led into the formation of AUG are shown by blue font and an asterisk (*) indicates the nucleotide that showed both point mutation and double mutation. (D) Colors represent the same as in B but for PSTVdNB. However, only the mutations with the higher percentage range per position are represented in this figure (described in Table S4).
Cells 11 00265 g002
Figure 3. Detection of ribosome-associated PSTVd in host plants. Both Tomato cv. Rutgers and N. benthamiana plants were inoculated with PSTVdRG1. (A) Total RNA extracted and RT-PCR assay from these plants at 3 wpi was used to monitor the PSTVd infection. Lane L (Ladder); TC (tomato control), mock inoculated tomato plants; TP, PSTVdRG1 inoculated tomato plants; BC (N. benthamiana control), mock inoculated N. benthamiana plants; BP, PSTVdRG1-inoculated N. benthamiana plants; +ve, RT-PCR positive control; RT ve, RT negative control and, ve, PCR negative control. (B) Flow chart illustrating the details of the isolation of total ribosomes from leaf samples (see Materials and Methods). The resulting precipitates were subjected to RNA purification and analyzed by (C) RT-PCR and (D) Northern blot assays. The lanes were loaded as in (C). (E) RT-qPCR to evaluate the enrichment of PSTVdRG1 in the ribosomes. The expression change is presented on a log2 scale. Error bars indicate the standard deviation (SD).
Figure 3. Detection of ribosome-associated PSTVd in host plants. Both Tomato cv. Rutgers and N. benthamiana plants were inoculated with PSTVdRG1. (A) Total RNA extracted and RT-PCR assay from these plants at 3 wpi was used to monitor the PSTVd infection. Lane L (Ladder); TC (tomato control), mock inoculated tomato plants; TP, PSTVdRG1 inoculated tomato plants; BC (N. benthamiana control), mock inoculated N. benthamiana plants; BP, PSTVdRG1-inoculated N. benthamiana plants; +ve, RT-PCR positive control; RT ve, RT negative control and, ve, PCR negative control. (B) Flow chart illustrating the details of the isolation of total ribosomes from leaf samples (see Materials and Methods). The resulting precipitates were subjected to RNA purification and analyzed by (C) RT-PCR and (D) Northern blot assays. The lanes were loaded as in (C). (E) RT-qPCR to evaluate the enrichment of PSTVdRG1 in the ribosomes. The expression change is presented on a log2 scale. Error bars indicate the standard deviation (SD).
Cells 11 00265 g003
Figure 4. Polysome fractionation. (A) Flow chart illustrating the details of the separation of the 40S, the 60S and 80S ribosomes and of the polysomes. (B) RNA isolated from the fractionated non-translating ribosomes and from the polysomes were subjected to the RT-PCR assay using the Vid-FW/Vid-RE primer pair. Ladder (L); RNA extracted from mock inoculated tomato plants (TC), PSTVd inoculated tomato plants (TP), mock inoculated N. benthamiana plants (BC) and PSTVd inoculated N. benthamiana plants (BP). RNA extracted from non-translating ribosomes is indicated as NTR, and the RNA extracted from the polysome fraction is denoted by PS. +ve, RT-PCR positive control; RT ve, RT negative control; and ve, PCR negative control. (C) Schematic representation of the differentiation of circular PSTVd RNA by RT-PCR assay. In the figure, the red right arrowhead indicates the Vid-FW primer, red left arrowhead indicates the Vid-RE primer, blue right arrowhead indicates the PSTVd-254F primer, and the blue left arrowhead indicates the PSTVd-253R primer. R indicates the reverse primer and F indicates the forward primer. The black dotted lines indicate the cRNA, the red dotted lines indicate the PCR product obtained with the Vid-FW/Vid-RE primer pair and the blue dotted lines indicates the PCR product obtained with the PSTVd-254F/253R primer pair. Vid-FW is complementary to nucleotide positions 355-16 of PSTVdRG1, Vid-RE is complementary to positions 354-336 of PSTVdRG1, PSTVd-254F is complementary to positions 254-273 of PSTVdRG1 and, PSTVd-253R is complementary to positions 253-234 of PSTVdRG1. The number 1 indicates the first nucleotide of PSTVdRG1, and the number 359 indicates the last nucleotide of PSTVdRG1. (D) PCR performed on the cDNA generated by the Vid-RE primer using the PSTVd-254F/PSTVd-253R primer set. The lanes are loaded as shown for (B).
Figure 4. Polysome fractionation. (A) Flow chart illustrating the details of the separation of the 40S, the 60S and 80S ribosomes and of the polysomes. (B) RNA isolated from the fractionated non-translating ribosomes and from the polysomes were subjected to the RT-PCR assay using the Vid-FW/Vid-RE primer pair. Ladder (L); RNA extracted from mock inoculated tomato plants (TC), PSTVd inoculated tomato plants (TP), mock inoculated N. benthamiana plants (BC) and PSTVd inoculated N. benthamiana plants (BP). RNA extracted from non-translating ribosomes is indicated as NTR, and the RNA extracted from the polysome fraction is denoted by PS. +ve, RT-PCR positive control; RT ve, RT negative control; and ve, PCR negative control. (C) Schematic representation of the differentiation of circular PSTVd RNA by RT-PCR assay. In the figure, the red right arrowhead indicates the Vid-FW primer, red left arrowhead indicates the Vid-RE primer, blue right arrowhead indicates the PSTVd-254F primer, and the blue left arrowhead indicates the PSTVd-253R primer. R indicates the reverse primer and F indicates the forward primer. The black dotted lines indicate the cRNA, the red dotted lines indicate the PCR product obtained with the Vid-FW/Vid-RE primer pair and the blue dotted lines indicates the PCR product obtained with the PSTVd-254F/253R primer pair. Vid-FW is complementary to nucleotide positions 355-16 of PSTVdRG1, Vid-RE is complementary to positions 354-336 of PSTVdRG1, PSTVd-254F is complementary to positions 254-273 of PSTVdRG1 and, PSTVd-253R is complementary to positions 253-234 of PSTVdRG1. The number 1 indicates the first nucleotide of PSTVdRG1, and the number 359 indicates the last nucleotide of PSTVdRG1. (D) PCR performed on the cDNA generated by the Vid-RE primer using the PSTVd-254F/PSTVd-253R primer set. The lanes are loaded as shown for (B).
Cells 11 00265 g004
Figure 5. In vitro translation of PSTVdRG1. In vitro translation of (A) circular RNA (cRNA), dimeric (+) PSTVd RNA (+ dRNA), dimeric (−) PSTVd RNA (-dRNA) and (B) monomeric (+) PSTVd RNA (+ mRNA), monomeric (−) PSTVd RNA (- mRNA). A reaction mixture without any template RNA was used as negative control (ve cont), and luciferase control RNA was used as the positive control (+ve cont).
Figure 5. In vitro translation of PSTVdRG1. In vitro translation of (A) circular RNA (cRNA), dimeric (+) PSTVd RNA (+ dRNA), dimeric (−) PSTVd RNA (-dRNA) and (B) monomeric (+) PSTVd RNA (+ mRNA), monomeric (−) PSTVd RNA (- mRNA). A reaction mixture without any template RNA was used as negative control (ve cont), and luciferase control RNA was used as the positive control (+ve cont).
Cells 11 00265 g005
Figure 6. Experimental design for MS experiments. (A) Northern blot for the detection of PSTVdNB in N. benthamiana plants. Total RNA staining (methylene blue) was used as loading control. (B) Three different strategies were followed in this study. In strategy 1, total lysate from both infected and non-infected plants was used for further MS analysis. In strategy 2, total lysate was filtered through specialized column to keep only small peptides, and then proceed with MS analysis. In strategy 3, a 15% polyacrylamide gel was used to separate proteins and only proteins smaller than 30 kDa were kept for further MS analysis.
Figure 6. Experimental design for MS experiments. (A) Northern blot for the detection of PSTVdNB in N. benthamiana plants. Total RNA staining (methylene blue) was used as loading control. (B) Three different strategies were followed in this study. In strategy 1, total lysate from both infected and non-infected plants was used for further MS analysis. In strategy 2, total lysate was filtered through specialized column to keep only small peptides, and then proceed with MS analysis. In strategy 3, a 15% polyacrylamide gel was used to separate proteins and only proteins smaller than 30 kDa were kept for further MS analysis.
Cells 11 00265 g006
Figure 7. MS analysis. (A) Volcano plot showing all proteins affected in PSTVd-infected N. benthamiana plants. In total, 85 proteins were shown to be statistically affected. (B) Volcano plot showing proteins related to the translation mechanism affected upon PSTVd infection of N. benthamiana plants. (C) Heat map of proteins related to translation statistically affected by the infection of PSTVd. All graphs were created using the Perseus 1.6.10.43 software [52]. More details in Table S5.
Figure 7. MS analysis. (A) Volcano plot showing all proteins affected in PSTVd-infected N. benthamiana plants. In total, 85 proteins were shown to be statistically affected. (B) Volcano plot showing proteins related to the translation mechanism affected upon PSTVd infection of N. benthamiana plants. (C) Heat map of proteins related to translation statistically affected by the infection of PSTVd. All graphs were created using the Perseus 1.6.10.43 software [52]. More details in Table S5.
Cells 11 00265 g007
Table 1. Identified Small Peptides in Viroids.
Table 1. Identified Small Peptides in Viroids.
ViroidsAbbreviationsNumber of Different PeptidesMean of Peptides Molecular Weight (Da)Deviation of Peptides Molecular Weight (Da)Mean Number of NucleotidesDeviation of Number of Nucleotides
Apple Dimple viroidADFVd1124,985,4723,839,693124,48892,301
Apple Scar Skin viroidASSVd4035,357,0673,545,36313,65187,982
Australian Grapevine viroidAGVd3855,797,6813,301,071146,78582,668
Chrysanthemum Stunt viroidCSVd3915,696,3923,064,454138,37271,622
Citrus Bark Cracking viroidCBCVd1095,614,0573,736,423139,10689,363
Citrus Bent leaf viroidCBLVd1974,559,2653,222,127118,0548299
Citrus Dwarfing viroidCDVd3174,235,9542,457,5681,043,12257,357
Citrus Exocortis viroidCEVd7178,908,622414,26722,654103,926
Citrus viroid VCVd-V794,790,3073,350,29612383,618
Citrus viroid VICVd-VI804,946,4143,800,323122,96392,295
Coconut cadang-cadang viroidCCCVd27848,8744,918,339209,777116,172
Columnea Latent viroidCBVd12907,315,8685,184,612187,693134,273
Coleus Blumei viroid 1CBVd2265,725,483295,522144,38771,306
Coleus Blumei viroid 2CBVd31414,849,2664,436,371376133,152
Coleus Blumei viroid 3CBVd5125,500,9164,175,93213,475101,042
Coleus Blumei viroid 5CBVd61276,0253,621,197196,28593,803
Coleus Blumei viroid 6CLVd711,385,7148,186,838287,571208,934
Dahlia Latent viroidDLVd1030242,759,5047871,233
Grapevine Yellow Speckle viroid 1GYSVd140470,593381,389177,65394,235
Grapevine Yellow Speckle viroid 2GYSVd22029564501,981236,137121,745
Hop Latent viroid HLVd486,968,0534,348,142175,553110,481
Hop stunt viroid HSVd1187797,4815,295,96419,715129,347
Iresine viroid 1IrVd368,082,9254,206,52920,98510,268
Mexican Papita viroidMPVd409,292,1664,819,751229,214116,252
Pear Blister Canker viroidPBCVd199442,312303,03511,37576,997
Pepper Chat Fruit viroidPCFVd13385,162,875443,5072135108,787
Persimmon viroid 2PVd8405,2252,535,42810356605
Potato Spindle Tuber viroidPSTVd61210,691,6886,520,371269,44116,247
Tomato Apical Stunt viroidTASVd102684,758408,64116,8631001
Tomato Chlorotic Dwarf viroidTCDVd565943470,73114,877117,745
Table 2. Presence of Kozak Frame in Viroid Species.
Table 2. Presence of Kozak Frame in Viroid Species.
Viroid.Number of Isolates
PSTVd17
CEVd1
CSVd8
CLVd1
Table 3. Predicted Peptides for PSTVdNB.
Table 3. Predicted Peptides for PSTVdNB.
Start SiteStop SiteAmino Sequence LengthMolecular Weight
3342LTSSTOP3355
51156KKKEGGSEERFRDPRGNLERTGKKGRWGVPSGRQESTOP354621
58311KKAARRSASGIPGETWSELAKKDGGECPAADRSNSRRNRVFTLPFFGFPSSRPQDHPSPPLRCRFGYYPVETTEAPENRFFSILLAPGRGCLALGTAVGSSELNSWFLWFTPDLLTRKEKRRRLGGALQGSPGKPGANWQKRTVGSAQRPTGVIPAETGFSPFLSSGFLPRARRTTPRPLCAVASAITRWKQLKLPRTAFSLSYSTOP20424,375
243276LSLRLLPGGNNSTOP111332
32434RVFSPWNRSWFLGTKLVVPVVHTSTOP233119
3386LEPQLVPRNSTOP91208
Table 4. List of Identified Proteins Affected During Viroid Infection.
Table 4. List of Identified Proteins Affected During Viroid Infection.
C: Human-Readable-Description
Sol GenomicsBenth GenomeLog2 Difference (Infected Samples-Control Samples)
Signaling
Protein phosphatase 2C family proteinProbable protein phosphatase 2C 55−1.3518609
Peroxiredoxin-2BPeroxiredoxin-2B (probable),thioredoxin peroxidase 10.4045086
SIT4 ph isoform 1 [Theobroma cacao];SIT4 phosphatase-associated family protein SIT4 phosphatase-associated family proteinserine threonine-protein phosphatase 6 regulatory subunit 3-like isoform x1−0.7918434
Pleckstrin homology (PH) domain-containing protein/lipid-binding START domain-containing proteinprotein enhanced disease resistance 2-like isoform x1−1.538706
Ankyrin repeat domain-containing protein 6Protein LHCP
TRANSLOCATION
DEFECT (probable)
−1.6666896
Protein kinase superfamily proteinserine threonine-protein kinase at5g01020−2.4678752
Methylation
S-adenosyl-L-methionine-dependent methyltransferases superfamily proteinProbable methyltransferase PMT26 (probable)−0.5842584
sterol methyltransferase 2 24-methylenesterol c-methyltransferase 2-like−1.4808227
Sterol 24-C-methyltransferase;sterol methyltransferase 1cycloartenol-c-24-methyltransferase 1-like−1.2608874
Translation
Polyadenylate-binding protein;Polyadenylate-binding protein 1;Polyadenylate-binding protein 5;Polyadenylate-binding protein 8Polyadenylate-binding protein RBP45B (probable)−2.3749559
50S ribosomal protein L660S ribosomal protein L9-1 (probable),60s ribosomal protein l9-1-like−0.5959295
50S ribosomal protein L1850S ribosomal protein L18, chloroplastic (probable)1.8289892
40S ribosomal protein S640S ribosomal protein S6 (probable)−0.3994783
30S rib PSRP-3 [Prochlorococcus marinus str. SB];rib PSRP-3/Ycf65 [Halothece sp. PCC 7418]30s ribosomal protein chloroplastic-like−1.1850082
Polyadenylate-binding protein 833 kDa ribonucleoprotein, chloroplastic (probable)−0.5907972
50S ribosomal protein L7Aeh aca ribonucleoprotein complex subunit 2-like protein−0.5377388
50S ribosomal protein L950S ribosomal protein L9, chloroplastic (probable)−2.379722
60S ribosomal protein L4-160s ribosomal protein l4-1-like−0.3906072
Nucleolar protein 58probable nucleolar protein 5-2−0.6824243
Metabolism
Glucose-1-phosphate adenylyltransferase family proteinGlucose-1-phosphate adenylyltransferase large subunit 1 (probable)2.093622
N-succinylglutamate 5-semialdehyde dehydrogenasedelta-1-pyrroline-5-carboxylate dehydrogenase mitochondrial0.5348445
Threonine synthaseThreonine synthase, chloroplastic (probable)−0.9644074
2-dehydro-3-deoxyphosphoheptonate aldolase (3-deoxy-d-arabino-heptulosonate 7-phosphate synthase) [Medicago truncatula] gb|AES98110.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Medicago truncatula]Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic (probable)−0.5528278
2-dehydro-3-deoxyphosphoheptonate aldolase (3-deoxy-d-arabino-heptulosonate 7-phosphate synthase) [Medicago truncatula] gb|AES98110.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Medicago truncatula] −1.2349175
alanine aminotransferase 2 alanine aminotransferase 2−1.469876
Cytochrome P450 superfamily protein;Cytochrome P450 superfamily proteinsterol 14-demethylase-like, sterol 14-demethylase-like−0.9758828
3-isopropylmalate dehydratase large subunitaconitate cytoplasmic−0.6276336
Isoflavone reductase homologisoflavone reductase homolog0.5225232
S-adenosylmethionine synthase 3s-adenosylmethionine synthase 2-like−0.4216976
alanine aminotransferase 2Glutamate--glyoxylate aminotransferase 20.3580829
Aspartate aminotransferase, mitochondrial;aspartate aminotransferase 5Aspartate aminotransferase, chloroplastic (probable)0.3257779
ATP-dependent zinc metalloprotease FtsHcell division cycle protein 48 homolog−1.3560431
adenylate cyclase [Zea mays]triphosphate tunel metalloenzyme 3 isoform x1−0.9491795
Acetolactate synthaseacetolactate synthase chloroplastic-like−0.4911346
Methylenetetrahydrofolate reductase 1Probable methylenetetrahydrofolate reductase (probable)−0.4068656
ornithine carbamoyltransferasePistil-specific extensin-like protein (probable)−1.4021558
Linoleate 9S-lipoxygenase 6lipoxygenase−1.3354193
GDSL esterase/lipasegdsl esterase lipase at1g29670-like−1.5272558
GDSL esterase/lipasegdsl esterase lipase at5g33370-like0.6638832
Gamma-glutamyl phosphate reductasedelta-1-pyrroline-5-carboxylate synthase-like isoform x20.5598941
senescence-associated protein [Arabidopsis thaliana];Thiosulfate sulfurtransferase GlpERhodanese-like domain-containing protein 15, chloroplastic (probable)1.1901923
3-phosphoshikimate 1-carboxyvinyltransferase3-phosphoshikimate 1-carboxyvinyltransferase 2−1.5891065
aminoacyl peptidase [Xanthomonas axonopodis]probable glutamyl chloroplastic isoform x11.1461201
Eukaryotic aspartyl protease family proteinaspartic proteinase nepenthesin-1-like−2.7812869
Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] gb|EEF30179.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis]ribulose- bisphosphate carboxylase oxygenase large subunit n- chloroplastic1.5090357
iron-binding protein [Pyrus pyrifolia]Ferritin-1, chloroplastic (probable)−1.68272
iron-binding protein [Pyrus pyrifolia]Ferritin-2, chloroplastic (probable)−1.8307396
Stress
Protein GrpEgrpe protein mitochondrial−1.6075834
Annexin D1annexin d1-like0.4671304
Heavy metal transport/detoxification superfamily proteinpollen-specific leucine-rich repeat extensin-like protein 13.9868143
Universal stress protein A-like proteinUniversal stress protein A-like protein0.5305178
Glutathione S-transferase U8glutathione transferase gst 23-like0.7272462
IMP dehydrogenase/GMP reductase [Synechocystis sp. PCC 6714]probable uncharacterized protein ycf23-like0.6426404
Glutamate dehydrogenase Bglutamate dehydrogenase b0.7839004
Plastid-lipid associated protein PAP / fibrillin family proteinfibrillin 1 protein0.6953284
membrane related
Pyrophosphate-energized vacuolar membrane proton pumppyrophosphate-energized vacuolar membrane proton pump 1-like3.7827212
CASP-like protein 4D1casp-like protein 4d1−2.1034703
Transmembrane emp24 domain-containing protein ATransmembrane emp24 domain-containing protein p24beta3-like−1.2165958
Aspartic proteinase;Aspartic proteinase A1aspartic proteinase-like−1.2461262
GRIP and coiled-coil domain-containing protein, putative [Ricinus communis] gb|EEF50040.1| GRIP and coiled-coil domain-containing protein, putative [Ricinus communis]uncharacterized abhydrolase domain-containing protein ddb_g0269086-like−0.4647138
Signal peptidase complex subunit 3BSignal peptidase complex subunit 3B (probable)−1.5427202
Aquaporin-2;Aquaporin-like superfamily proteinaquaporin tip2-1-like−0.4083201
ATP synthase subunit a, chloroplasticProteasome subunit beta type-1 (probable)1.6636887
Photosynthesis
Plastocyanin A’/A’’plastocyanin a a−1.5127553
Oxygen-evolving enhancer protein 2-1, chloroplasticoxygen-evolving enhancer protein 2- chloroplastic0.4273438
Oxygen-evolving enhancer protein 2, chloroplasticoxygen-evolving enhancer protein 2- chloroplastic0.4711001
Photosystem II CP47 reaction center proteinPhotosystem II CP47 chlorophyll apoprotein (probable), photosystem ii 47 kda protein−3.5313221
Glutamyl-tRNA reductase-binding protein, chloroplastic;pyridoxamine 5’-phosphate oxidase [Mycobacterium abscessus]glutamyl-trna reductase-binding chloroplastic−0.4534192
Protein folding
Thioredoxin superfamily protein [Theobroma cacao] gb|EOX91756.1| Thioredoxin superfamily protein [Theobroma cacao];Thioredoxin superfamily protein prostamide prostaglandin f synthase0.6359446
Calnexin homologcalnexin homolog−0.8004602
transcription
potyviral VPg interacting protein 2 [Phaseolus vulgaris]Protein OBERON 2 (probable)2.9606433
glycine-rich RNA-binding protein 2glycine-rich rna-binding, glycine-rich rna-binding−1.1653803
Chromodomain-helicase-DNA-binding protein 1ATP-dependent helicase BRM (probable)2.1251746
Defence proteins
Major pollen allergen Bet v 1-D/Hpathogenesis-related protein sth-2-like0.6196096
MLP-like protein 31pr-10 type pathogenesis-related protein1.6111262
Diverse roles or unknown roles
Peptidyl-prolyl cis-trans isomerase-like 1 peptidyl-prolyl cis-trans isomerase chloroplastic0.4489725
protein of unknown function (DUF1995) [Leptolyngbya sp. PCC 6406]probable uncharacterized protein LOC104217371−0.6120353
14-3-3-like protein GF14 nu;14-3-3-like protein GF14-C14-3-3-like protein a, 14-3-3 protein 4-like1.8770383
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein36.4 kDa proline-rich protein (probable)−3.6962613
Fructokinase-2fructokinase 2−0.4746384
ubiquitin family proteinubiquitin domain-containing protein dsk2b-like isoform x1−1.3615259
26S proteasome non-ATPase regulatory subunit 12 homolog A26s proteasome non-atpase regulatory subunit 12 homolog a-like−1.1566838
DNA replication licensing factor MCM2DNA replication licensing factor mcm2 (probable)−0.7461614
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Katsarou, K.; Adkar-Purushothama, C.R.; Tassios, E.; Samiotaki, M.; Andronis, C.; Lisón, P.; Nikolaou, C.; Perreault, J.-P.; Kalantidis, K. Revisiting the Non-Coding Nature of Pospiviroids. Cells 2022, 11, 265. https://doi.org/10.3390/cells11020265

AMA Style

Katsarou K, Adkar-Purushothama CR, Tassios E, Samiotaki M, Andronis C, Lisón P, Nikolaou C, Perreault J-P, Kalantidis K. Revisiting the Non-Coding Nature of Pospiviroids. Cells. 2022; 11(2):265. https://doi.org/10.3390/cells11020265

Chicago/Turabian Style

Katsarou, Konstantina, Charith Raj Adkar-Purushothama, Emilios Tassios, Martina Samiotaki, Christos Andronis, Purificación Lisón, Christoforos Nikolaou, Jean-Pierre Perreault, and Kriton Kalantidis. 2022. "Revisiting the Non-Coding Nature of Pospiviroids" Cells 11, no. 2: 265. https://doi.org/10.3390/cells11020265

APA Style

Katsarou, K., Adkar-Purushothama, C. R., Tassios, E., Samiotaki, M., Andronis, C., Lisón, P., Nikolaou, C., Perreault, J.-P., & Kalantidis, K. (2022). Revisiting the Non-Coding Nature of Pospiviroids. Cells, 11(2), 265. https://doi.org/10.3390/cells11020265

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop