Next Article in Journal
Pesticides Risk Assessment Review: Status, Modeling Approaches, and Future Perspectives
Previous Article in Journal
Screening of Ecotypes and Construction of Evaluation System for Drought Resistance during Seed Germination in Kudouzi (Sophora alopecuroides)
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Genome-Wide Analysis of Potato CCT Family Genes and Its Response to Auxin Substances

1
Tibetan Plateau Ethnic Medicinal Resources Protection and Utilization Key Laboratory of National Ethnic Affairs Commission of the People’s Republic of China, Southwest Minzu University, Chengdu 610225, China
2
Sichuan Provincial Qiang-Yi Medicinal Resources Protection and Utilization Technology Engineering Laboratory, Southwest Minzu University, Chengdu 610225, China
3
Sichuan Zoige Alpine Wetland Ecosystem National Observation and Research Station, Southwest Minzu University, Chengdu 610041, China
4
Ecological Security and Protection Key Laboratory of Sichuan Province, Mianyang Normal University, Mianyang 621000, China
5
College of Life Science & Biotechnology, Mianyang Normal University, Mianyang 621000, China
6
Haidong Municipal Pingan District Bureau of Agriculture and Rural Affairs, Haidong 810600, China
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Agronomy 2024, 14(10), 2298; https://doi.org/10.3390/agronomy14102298
Submission received: 2 August 2024 / Revised: 17 September 2024 / Accepted: 4 October 2024 / Published: 6 October 2024
(This article belongs to the Section Crop Breeding and Genetics)

Abstract

The control of flowering time plays an important role in the growth and development of potato tubers. The CCT (CO, COL and TOC1) gene family is involved in the flowering process of plants. In this study, a total of 32 StCCT family genes were identified and further classified into five subfamilies, including COL (17 members), PRR (4 members), ZIM (3 members), ASML2 (6 members) and TCR1 (2 members), based on their phylogenetic relationship. An analysis of the gene structure, motif compositions and conserved domain provided support for this classification. The StCCT genes were unevenly distributed on 12 chromosomes of the potato plant. In total, six gene duplication events were observed, which played a crucial role in the expansion of the StCCT family genes in the potato. The expression profiles exhibited diverse expression patterns of the StCCT genes in six tissues (leaf, shoot, root, tuber, stolon, and flower), StCCT32 is only expressed in flowers, while StCCT19 and StCCT8 are highly expressed in flowers and tubers, respectively. The StCCT genes exhibit different expression patterns in response to IAA and TIBA treatments at different concentrations across three tissues (leaf, stem, and tuber). After IAA and TIBA treatments, it was found that the expression level of StCCT7 was low in leaves and stems but significantly increased in tubers. Collectively, this study provided valuable information for the further study of potato formation and development and provided candidate genes for molecular breeding in the potato.

1. Introduction

As the world’s fourth largest staple crop, potatoes offer advantages, such as cold and drought tolerance, wide adaptability, high yield and rich nutritional content, making them a valuable crop for addressing the global food crisis [1,2]. The tuber, which is the edible part of the potato, directly determines its economic value through its yield and quality [3]. As a key nutrient storage tissue, tuber growth and development are closely linked to the flower bud differentiation processes [4]. A study published in 2011 reported that potato flower bud differentiation occurs simultaneously with tuber expansion, suggesting that flowering time significantly influences tuber formation [5]. Therefore, understanding the regulatory mechanisms of flowering time on tuber development is crucial for enhancing potato yield and quality.
Pathways regulating flowering in plants include the photoperiod pathway, vernalization pathway, autonomous pathway, gibberellin pathway, and age pathways [6]. Light influences flowering in two main ways: it regulates the production of assimilates through photosynthesis under the light quality of blue- and red-light conditions [7], and it affects flowering time through the photoperiod [8]. The CCT [CO (CONSTANS), COL (CONSTANS-LIKE), and TOC1 (TIME OF CAB1)] gene family plays a key role in the photoperiodic pathway, comprising genes that encode proteins with the CCT structural domains. These genes are classified into several subfamilies: COL, PRR (pseudo-response regulator), ZIM (Zinc-finger protein expressed in Inflorescence Meristem), ASML2 (Activator of Spomin::LUC2), and TCR1 (Tunicamycin-induced COL-related 1) [9,10,11,12]. Primarily found in plants, these subfamilies are involved in various physiological processes, including flower morphogenesis and stress tolerance, by responding to the photoperiod and the core oscillator of the biological clock. The CO gene, a critical member of the CCT family, regulates the expression of the FLOWERING LOCUS T (FT) in response to the photoperiod, thus influencing flowering time [13]. Additionally, CO can synergize with other flowering regulatory genes, such as FLOWERING LOCUS C (FLC), SHORT VEGETATIVE PHASE (SVP), and SUPPRESSOR OF OVEREXPRESSION OF CO 1 (SOC1), to further control the flowering process [14]. Another family member, the PRR gene, acts as a pseudo-response regulator of the conserved clock components and enhances flowering by stabilizing CO accumulation under long-day (LD) conditions [15,16].
Current research on the potato CCT gene family has primarily focused on the roles of the COL and PRR subfamilies in tuber formation. The COL subfamily gene StCOL1 directly activates the FLOWERING LOCUS T-like (FT-like) gene S. tuberosum SELF-PRUNING 5G (StSP5G) under LD conditions, while StSP5G represses the expression of the FT-like gene S. tuberosum SELF-PRUNING 6A (StSP6A), thereby inhibiting tuber formation under LD conditions [17,18]. The PRR subfamily gene, S. tuberosum time of cab1 (StTOC1), whose expression increases during tuber development at high temperatures, functions as a temperature-responsive negative regulator of the StSP6A signaling pathway in stolon tissue. The overexpression of StTOC1 decreases the StSP6A expression in leaves and reduces tuber yield [19,20]. Additionally, other gene subfamilies, such as ZIM, ASML2 and TCR1, have been shown to play critical roles in flowering, seed development, and stress response in other species, suggesting that these genes may have similar functions in the potato [10,12,21,22]. Therefore, the CCT gene family in potato is crucial for determining tuber yield and quality.
Auxin plays a crucial role in various physiological processes in plants, including embryogenesis, seedling growth, flower development, root elongation, and resistance to external stresses [23,24]. Tao Lu et al. reported that spraying auxin delayed flowering, though the underlying mechanism was not clearly defined [25]. Studies have demonstrated that elevated auxin levels activate the auxin-responsive transcription factor monopteros/auxin response factor 5 (MP/ARF5), which directly induces the expression of LEAFY (LFY), FILAMENTOUS FLOWER (FIL), and AINTEGUMENTA (ANT) in inflorescences, thereby promoting floral primordium formation [26,27]. In Fragaria ananassa, F. ananassa auxin response factor 4 (FaARF4) has been found to affect flowering time by regulating the expression of APETALA1 (AP1) and FRUITFULL (FUL), which are genes that are key markers of the floral meristem [28]. Furthermore, the increased expression of ZmIAA29 in maize has been shown to significantly advance tasseling, pollen shed and silking times, leading to earlier flowering and higher yields [29]. These findings indicate that auxin not only regulates overall plant growth and development but influences flower morphogenesis and flowering time through multiple pathways and the regulation of key genes.
Studies on the function of potato CCT genes and their regulation by plant auxin signals remain limited [30]. To investigate whether the potato CCT family responds to auxin, subsequently affecting flowering and tuber development, this study employed a bioinformatics approach to identify the potato CCT family genes (StCCT) and performed comprehensive analyses of their chromosomal locations, sequence characteristics, gene structures, phylogenetic relationships and expression patterns. Additionally, the expression patterns of select StCCT members were examined in various tissues under the influence of different concentrations of exogenous hormones, including IAA (indole-3-acetic acid) and TIBA (2,3,5-triiodobenzoic acid), an inhibitor of IAA transport. The findings of this study provide a foundation for the further exploration and utilization of the StCCT family genes and their regulation by plant auxin signaling, ultimately enhancing our understanding of their roles in potato growth and development.

2. Materials and Methods

2.1. Identification of StCCT Family Genes

The genome sequence of the potato was downloaded from the Ensembl Plant database (http://plants.ensembl.org/index.html (accessed on 12 July 2023)). The hidden Markov model of the CCT domain (PF06203) was downloaded from the Pfam database (http://pfam.xfam.org/ (accessed on 12 July 2023)). The StCCT family genes were selected from the genomic database using HMMER 3.1 (http://hmmer.janelia.org (accessed on 12 July 2023)) with a threshold of <10e−5. Using the same criteria, Arabidopsis thaliana CCT genes were screened from the genome database (http://plants.ensembl.org/index.html (accessed on 14 July 2023)). The candidate genes were identified in the National Center for Biotechnology Information (NCBI) (https://www.ncbi.nlm.nih.gov/cdd/ (accessed on 14 July 2023)) and the genes containing the CCT conserved domain were screened. Using the 40 screened Arabidopsis CCT genes, the potato genome database was blasted and identified in the NCBI (https://www.ncbi.nlm.nih.gov/cdd/ (accessed on 14 July 2023)). The two results obtained were then combined to remove duplicate values.

2.2. Subcellular Localization, Protein Characteristics, Chromosome Localization and Phylogenetic Tree Construction of StCCT Family Proteins

The subcellular localization prediction tool BUSCA (http://busca.biocomp.unibo.it (accessed on 2 March 2024)) was used to predict the possible location of the protein [31]. The protein properties of StCCT were analyzed using the Protein Paramter Calc tool of TBtools-II v2.025 [32]. TBtools-II v2.025 software was used to map the chromosome positions of the genes.
The protein sequences of the CCT domain-containing genes in Arabidopsis thaliana, Oryza sativa, Physcomitrium patens, Amborella trichopoda, Glycine max, Selaginella moellendorffii, and Zea mays were downloaded from the Ensembl Plant database based on relevant research reports. The full-length CCT sequences of Arabidopsis thaliana, Oryza sativa, Physcomitrium patens, Amborella trichopoda, Glycine max, Selaginella moellendorffii, and Zea mays were selected for comparison using MEGA 11 software [33]. Subsequently, phylogenetic analysis was performed using IQ-TREE 2 software on the compared protein sequences and a tree was constructed using the maximum likelihood method, with a bootstrap value of 1000 [34]. In addition, multiple sequence alignment was performed using MEGA 11 software to construct a neighbor-joining method phylogenetic tree with a Poisson model, pairwise deletion and 1000 bootstrap replications. The phylogenetic tree was analyzed by iTOL (http://itol.embl.de (accessed on 8 April 2024)).

2.3. Analysis of Collinear Relationship, Gene Structure, Conserved Motifs and Conserved Domains

The genome-wide duplication (WGD)/fragment duplication and tandem duplication of potato genomes were identified using a multicollinearity scanning tool (MCScan X). The homologous CCT genes of the potato and other selected varieties (Arabidopsis thaliana/Oryza sativa/Solanum lycopersicum/Capsicum annuum) were analyzed using the MCScan X tools.
The collinear relationship and location data of the potato and Arabidopsis thaliana, Oryza sativa, Solanum lycopersicum, and Capsicum annuum were drawn using the TBtools-II v2.025 software. The locations of introns, exons and untranslated regions in the StCCT genes were analyzed using Gene Finder File (GFF3). The motif compositions of the potato StCCT protein were analyzed using the MEME server (http://meme-suite.org/ (accessed on 27 November 2023)).

2.4. Prediction of Cis-Elements

TBtools-II v2.025was used to extract the 2000 bp sequence upstream of the transcription start site of the StCCT family genes. PlantCARE (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/ (accessed on 28 February 2024)) was used to predict and analyze the cis-acting elements in the promoter region of the obtained StCCT genes and the predicted results were visualized using TBtools-II v2.025 and GraphPad 9.5 software.

2.5. Plant Materials and Experimental Treatments

The experimental material used in this study was the cultivated potato variety ‘Favorita’. Potato plants were grown in a greenhouse under controlled conditions of 8 h of light, 16 h of darkness, and a constant temperature of 20 °C. Virus-free ‘Favorita’ potato tubers were planted in polyethylene pots (21 cm in height and 27 cm in diameter) with nutrient soil, with a total of 21 pots. The plants were irrigated every 3 days with clean water to ensure healthy growth. After 30 days of growth, plants were treated with IAA and TIBA solutions at three different concentrations: 10 mg/mL, 25 mg/mL, and 50 mg/mL. Each concentration was separately applied to 3 pots, with 1.5 mL of solution sprayed per pot. Additionally, three pots were sprayed with the same volume of water as a control check (ck). After 24 h, tissues samples from the treated plants, including leaves, stems and tubers, were collected. For each sample, three biological replicates were taken, flash-frozen in liquid nitrogen and stored at −80 °C for RNA extraction and qRT-PCR analysis.

2.6. Transcriptome Expression Analysis and qPCR of StCCT Genes

The transcriptomic data used in this study were downloaded from the NCBI SRA database under the accession number PRJNA63145 [35]. According to the manufacturer’s instructions, total RNA was extracted from each tissue sample using a plant RNA extraction kit (Vazyme Biotech Co., Ltd., Nanjing, China). The cDNA was synthesized from 1 µg of total RNA using the HiScript III All-in-one RT SuperMix (Vazyme Biotech Co., Ltd.). The qRT-PCR analysis was performed using Taq Pro Universal SYBR qPCR Master Mix on the StepOnePlus™ Real-Time PCR System, with three biological replicates and three technical replicates. The qRT-PCR primers for the StCCT genes listed in Table S1 were designed using the online software Primer3 (https://www.ncbi.nlm.nih.gov/tools/primer-blast/ (accessed on 10 November 2023)). The primers were synthesized by Beijing Tsingke Biotech Co., Ltd., Beijing, China. StEF-1α (AB061263) was used as the internal reference gene, and the relative expression of the StCCT genes was calculated using the 2−ΔΔCt method. Each PCR reaction was performed in a total volume of 20 μL, which included 2 μL of cDNA, 10 μL of 1 × Taq SYBR Green qPCR Premix (Monad, China), and 0.8 μL of primer pairs (final concentration of 0.2 μM). The three-step thermal cycling program was as follows: 95 °C for 30 s; followed by 40 cycles of 95 °C for 10 s and 60 °C for 30 s; and a final step at 95 °C for 15 s, 60 °C for 60 s, and 95 °C for 15 s. Each sample was analyzed with three technical replicates.

3. Results

3.1. Identification and Physicochemical Properties Analysis of StCCT Family Genes

A total of 32 StCCT genes were identified in the potato genome. According to the distribution of these genes on chromosomes, the genes were named StCCT1~StCCT32 (Table 1). The protein length of the 32 StCCT family members ranged from 150 aa (StCCT28) to 680 aa (StCCT7). The molecular weight was between 17.72 (StCCT28) and 74.47 (StCCT7) KDa. The theoretical pI was between 4.82 (StCCT1) and 8.46 (StCCT20), and the theoretical pI values of StCCT20, StCCT22, and StCCT28 were more than 7, which were basic proteins. The instability index ranged from 36.77 (StCCT19) to 73.54 (StCCT28) and only one protein (StCCT19) was stable, whereas all others were unstable. The aliphatic index ranged from 50.40 (StCCT24) to 74.43 (StCCT13). The grand average of hydropathicity ranged from −1.221 (StCCT28) to −0.331 (StCCT19), indicating that all the StCCT proteins were hydrophilic proteins. Subcellular prediction showed that except for StCCT6 (chloroplast), StCCT20 (chloroplast), and StCCT24 (extracellular space), the other StCCT proteins were localized in the nucleus.

3.2. Chromosome Mapping Analysis of StCCT Genes

To understand better the distribution of StCCT genes on chromosomes, a chromosome localization map was drawn (Figure 1). The 32 StCCT genes were distributed on 12 chromosomes of the potato, but the distribution was different. Among them, there were four genes with the lowest number distributed on chromosomes 3, 5, 7, and 12 and only one gene with the least number distributed on chromosomes 6, 10 and 11. At the same time, the StCCT genes on chromosomes 2, 3, 6, 9, and 11 were distributed at the lower end of the chromosome, while the StCCT genes on chromosomes 5 and 7 were more dispersed on the chromosome.

3.3. Gene Duplication and Synteny Analysis of StCCT Genes

To understand the evolutionary relationship of potato CCT genes, the gene duplication events among the potato genome were analyzed (Figure 2). A total of 12 genes constituted 6 gene pairs, including StCCT2 with StCCT12 and StCCT9 with StCCT18. To understand better the relationships within the StCCT gene family, the collinear relationships between the potato and typical plants (Arabidopsis thaliana and Oryza sativa) were analyzed (Figure 3A). A total of 16 StCCT genes formed 24 pairs of gene collinearity with the genes of Arabidopsis thaliana, and a total of 2 StCCT genes formed 3 pairs of gene collinearity with the genes of Oryza sativa. At the same time, the collinearity events between the potato and other important Solanaceae plants (Solanum lycopersicum and Capsicum annuum) were also analyzed (Figure 3B). A total of 24 StCCT genes formed 35 pairs of gene collinearity events with Solanum lycopersicum and a total of 19 StCCT genes formed 23 pairs of gene collinearity events with Capsicum annuum. The more homologous genes of the potato and Solanum lycopersicum may be due to the fact that they are not only the same family but the same genus. These results are of great significance for understanding the expansion and origin of StCCT genes.

3.4. Phylogenetic Analysis of StCCT Genes

To understand better the evolution of CCT genes in the potato, we constructed a maximum likelihood tree based on 292 full-length CCT protein sequences from eight species, of which 40 were from Arabidopsis thaliana, 36 were from Oryza sativa, 23 were from Physcomitrium patens, 17 were from Amborella trichopoda, 69 were from Glycine max, 23 were from Selaginella moellendorffii, 52 were from Zea mays and 32 were from Solanum tuberosum (Figure 4 and Table S2). These 292 proteins were divided into five subfamilies, including COL, PRR, ZIM, ASML2, and TCR1. The number of CCT proteins in the COL subfamily was the largest, including 131 members, of which 17 were StCCTs. The PRR subfamily contained 47 members, including 4 StCCTs. The ZIM subfamily contained 33 members, including 3 StCCTs. The ASML2 subfamily contained 61 members, including 6 StCCTs. The TCR1 subfamily had the lowest number of members, including 20 members, of which 2 were StCCTs. We then compared and analyzed the differences between the resulting maximum likelihood phylogenetic tree and the neighbor-joining phylogenetic tree. The vast majority of CCT proteins showed little difference in subfamily delineation (Figure 4 and Figure S1). However, neighbor-joining phylogenetic trees have lower bootstrap values on major branches compared to maximum likelihood phylogenetic trees, making the results of the evolutionary trees constructed by the maximum likelihood method more reliable. In addition, two proteins, AT1G05290 and AT2G32310, were reassigned from the COL subfamily in the maximum likelihood phylogenetic tree to the TCR1 subfamily in the neighbor-joining phylogenetic tree.

3.5. Motif Compositions, Conserved Domain, and Gene Structure of StCCT Genes

To explore the differences in gene structure among potato subfamilies, a neighbor-joining phylogenetic tree was constructed based on the full-length protein sequence of the potato. According to the subfamily classification criteria of Arabidopsis thaliana CCT genes, the StCCT family was divided into five subfamilies. To understand better the differences between different families, we analyzed the motif compositions, conserved domain, and gene structure.
Genes in the same subfamily have similar characteristics in terms of motif composition, conserved domain and gene structure (Figure 5 and Table S3). The COL subfamily contained 17 members, accounting for more than half of all StCCT genes. The COL subfamily was divided into four subgroups. Subgroup 1 was composed of three StCCT genes (StCCT10, StCCT11, and StCCT14), whose members contained only one B-box domain, one motif 2 (RVWVCEVCEEARAIVYCRADAAALCLSCDRDIHSANPLARRHERVPICP), and consisted of two exons and one intron. Subgroup 2 was composed of five CCT genes (StCCT4, StCCT5, StCCT19, StCCT23, and StCCT31), including two B-box domains at the N-terminus and a CCT domain at the C-terminus. The B-box near the N-terminus was composed of motif 3 (CNSTPAIVRCSADSVSLCQNCDWKGHAK), which was composed of 2–3 exons and 1–2 introns. The N-terminus of subgroup 3 (StCCT15, StCCT16, StCCT17, StCCT21, StCCT25, and StCCT29) contained two B-box domains. The B-box near the N-terminus was composed of motif 3 and motif 10 (HKRQPLSGYTGCPSAAELSSIWSFLLDDP) and consisted of 4 exons and 3–5 introns. A total of three genes (StCCT1, StCCT13, and StCCT30) were divided into subgroup 4, which had only one CCT conserved domain, and the motif was also composed of motif 1, motif 4 (SKPYMYNFTSQSISQSVSSSSLDVGVVPDHSAMTDVSNTFVM), motif 5 (KEGNDQIYYLFNDMDSYLDIDLMSCEQKPHILHHQQHQHGH), motif 6 (VVPVQNNNETSTHLPGPVVDGFPTYEIDF), and motif 7 (GEKSHGGDDVDADAVDDEKYFDSTDENPSQPEEEAEAASWILPTP), while the number of exons was 3–4. The number and location of B-box domains in the COL subfamily were different in the different subgroups. The PRR subfamily contained four members, which were further divided into two subgroups. Among them, the gene structure of subgroup 1 and subgroup 2 was highly conserved and there was little difference between the motif composition and the conserved domain. Subgroup 1 was composed of two StCCT genes (StCCT9, and StCCT18), whose members consisted of six exons and five introns, while subgroup 2 was composed of two StCCT genes (StCCT7, and StCCT27), whose members consisted of eight exons and seven introns. The ZIM subfamily contained three members (StCCT2, StCCT3, and StCCT12); in particular, the CCT domain was located in the middle of the protein sequence, and they also had another two domains, which were TIFY and GATA. The gene structure contained 11 exons and 10 introns. Both the ASML2 and TCR1 subfamilies contained CCT domains only at the C-terminus. Among them, the ASML2 subfamily was composed of six StCCT genes (StCCT8, StCCT22, StCCT24, StCCT26, StCCT28, and StCCT32), whose members contained motif 1 and motif 4, and the motif compositions and conserved domain were similar. The TCR1 subfamily was composed of two StCCT genes (StCCT6, and StCCT20), whose members contained only motif 1, and the motif compositions and conserved domain were similar.

3.6. Promoter Analysis of StCCT Genes

By analyzing the cis-acting elements of the StCCT genes, a total of 21 cis-elements were obtained (Figure 6), which were then divided into three classes, including abiotic and biotic stresses (ARE, LTR, MBS, and TC-rich), phytohormone responsive (ABRE, CGTCA-motif, P-box, TATC-box, TCA-element, TGACG-motif, and TGA-element) and plant growth and development (A-box, AE-box, Box-4, CAT-box, circadian, GA-motif, GATA-motif, G-box, GT1-motif, and I-box). A total of 12 and 10 ARE and ABRE cis-elements were identified in StCCT24 and StCCT9, respectively. In total, 10 G-box cis-elements were identified in both StCCT19 and StCCT9. A total of four cis-elements (ARE, ABRE, Box-4, and G-box) were identified in more than 25 StCCT genes. A total of six cis-elements (LTR, MBS, TATC-box, TGA-element, circadian, and GA-motif) were identified in fewer than 10 StCCT genes. MBS cis-elements were identified only in StCCT12. Among the 32 StCCT genes, StCCT24 identified the most cis-elements related to abiotic and biotic stresses, StCCT9 identified the most cis-elements related to phytohormone responsive, and StCCT4, StCCT7 and StCCT19 identified the most cis-elements related to plant growth and development.

3.7. Expression Analysis of StCCT Gene in Different Tissues

To understand the expression profiling of StCCT genes, a heatmap of StCCT genes in different potato tissues (leaf, shoot, root, tuber, stolon, and flower) was constructed (Figure 7A). A total of three genes (StCCT17, StCCT24, and StCCT28) were not expressed in the six tissues. The expression of the same gene in different tissues was then found. The number of StCCT genes with a high expression in leaf tissue was up to 9, followed by 7 in shoot tissue and 2 in tuber tissue. According to the upset diagram (Figure 7B), the highest number of StCCT genes were expressed in flower tissue, with a total of 28, followed by shoot tissue (27) and tuber tissue (22). A total of 21 StCCT genes were both expressed in the six tissues. StCCT1 was expressed in five tissues (all except tuber). StCCT19 was expressed in four tissues (all except tuber and root). In total, two StCCT genes (StCCT3, and StCCT14) were expressed in four tissues (all except tuber and stolon). StCCT11 was expressed in three tissues (leaf, shoot, and root), StCCT22 was also expressed in three tissues (flower, shoot, and tuber) and StCCT26 was expressed in two tissues (flower and stolon). StCCT32 was only expressed in flower tissue. The StCCT genes showed obvious tissue-specific expression.

3.8. Expression Profiling of StCCT Gene in Different Treatments

To study the response of StCCT genes to auxins, candidate genes were selected for a qPCR analysis. The expression patterns of StCCT genes in leaves after different concentrations of IAA treatment showed that the expression levels of StCCT2 and StCCT12 showed an increasing trend compared to that of the ck; the expression levels were the highest at 10 mg/mL (Figure 8(A1)). The expression levels of StCCT7, StCCT19, StCCT25, and StCCT27 showed a decreasing trend. The expression patterns of the StCCT genes in leaves after different concentrations of TIBA treatment showed that the expression levels of StCCT2 and StCCT12 showed an increasing trend compared to that of the ck; the expression levels of StCCT2 and StCCT12 were the highest at 25 mg/mL and 10 mg/mL, respectively (Figure 8(A2)). The expression levels of StCCT7, StCCT19, StCCT23, StCCT25, and StCCT27 showed a decreasing trend.
After treatment with different concentrations of IAA (Figure 8(B1)), the expression levels of StCCT2, StCCT19, StCCT23 and StCCT27 in stems showed an increasing trend compared to that of ck, and the expression changes in the different genes were different from the changes in IAA concentration. The expression levels of StCCT7, StCCT21, StCCT29, and StCCT31 showed a decreasing trend. After treatment with different concentrations of TIBA (Figure 8(B2)), the expression levels of StCCT12 and StCCT23 in stems showed an increasing trend compared to that of ck; the highest expression levels were all at 50 mg/mL. The expression levels of StCCT7, StCCT21, StCCT25, and StCCT29 showed a decreasing trend.
After treatment with different concentrations of IAA (Figure 8(C1)), the expression levels of StCCT7, StCCT12, StCCT27, and StCCT29 in tubers showed an increasing trend compared to that of ck, and the expression levels of StCCT7, StCCT12, and StCCT27 were all highest at 50 mg/mL, while the expression level of StCCT29 was highest at 25 mg/mL. After treatment with different concentrations of TIBA (Figure 8(C2)), the expression levels of StCCT7, StCCT12, StCCT27, StCCT29, and StCCT31 in tubers showed an increasing trend compared to the highest ck, and the change in expression trend was related to the difference in TIBA concentration.

4. Discussion

Molecular breeding has become increasingly prominent in crop improvement due to its short cycle time and precise breeding targets [36,37,38]. Identifying key genes that influence yield and quality is therefore essential. The CCT gene family has gained significant attention in recent years because of its critical roles in photoperiod regulation, growth, development, and other biological processes. For instance, 53 ZmCCT genes have been identified in Zea mays [39], 37 SiCCT genes have been identified in Setaria italica [40], and 36 MtCCT genes have been identified in Medicago truncatula [41], with most of these genes involved in regulating photoperiod and flowering. However, systematic studies on the CCT gene family in the potato remain limited, particularly in terms of their functions related to yield. In this study, 32 StCCT genes were identified in the potato genome, exhibiting considerable variation in protein length and molecular weight, which suggested functional diversity among these genes. Specifically, shorter proteins (StCCT28) may have more specialized roles, whereas longer proteins (StCCT7) could be involved in more complex regulatory networks. All identified StCCT proteins were found to be hydrophilic and predominantly localized in the nucleus, aligning with the established function of the CCT domain proteins in transcriptional regulation [42,43]. Interestingly, the extra-nuclear localization of StCCT6, StCCT20, and StCCT24 indicated a potential involvement in signaling pathways or an interaction with extra-nuclear components, suggesting unique functional roles within the gene family.
In addition to their roles in the photoperiod and circadian rhythm responses, the CCT gene family is crucial in various aspects of plant growth and development. For example, overexpression of the COL subfamily gene Ghd2 (grain number, plant height, and heading date2) in rice accelerates leaf senescence and reduces drought tolerance, a phenomenon linked to interaction with O. sativa at-rich interaction domain 3 (OsARID3), O. sativa pur-α (OsPURα), and three 14-3-3 proteins [44]. Similarly, the COL subfamily gene S. bicolor heading date 1 (SbHd1) in sorghum not only regulates flowering time but also influences grain yield [45]. In this study, we analyzed the expression patterns of the StCCT gene family in different potato tissues. The results revealed significant tissue-specific expression among the StCCT genes. Notably, StCCT gene expression was highest in flowers and relatively low in tubers. Specifically, StCCT11, StCCT15, StCCT16, and StCCT20 were expressed across leaves, shoots, and roots, indicating distinct tissue specificity. Of particular interest, StCCT32 was exclusively expressed in flowers, while StCCT19 showed exceptionally high expression levels in flowers. Similar patterns of co-expression and tissue-specific expression within the CCT family genes have been observed in other plant species, such as Medicago truncatula [41], Glycine max [46], and Aegilops tauschii [47]. Based on these expression profiles, it is plausible to hypothesize that members of the StCCT family play unique roles in the physiological processes of different potato tissues and that their expression is closely regulated by the tissue environment.
IAA is involved in almost all plant growth and metabolic processes [48], although there has been less research on how it is involved in the control of flowering time. It has been increasingly documented that plant CCT family genes respond to the IAA signaling pathway. Auxin response-related cis-acting elements, such as TGA-elements, have been identified on the promoter of the oilseed rape CCT family gene BnaCCT [49]. In this study, TGA-elements related to auxin response were also found in the StCCT family, suggesting that auxin may regulate the expression of these CCT genes. Some CCT family genes respond to auxin signaling regulation. The functions of CCT genes have been well defined in Arabidopsis studies. AtCCT9 (COL7) [50], and AtPRR1 (TOC1) [51] are mainly involved in the regulation of auxin homeostasis and the auxin modulation of the circadian rhythm of lateral root (LR), respectively. In the present study, StCCT10 and StCCT18 were closely related to these two AtCCT genes, suggesting that they may have related functions. In Medicago truncatula, the expression profiles of MtCCT genes vary under different hormone treatments, and most MtCCT genes are upregulated under IAA treatment, especially MtCCT13, MtCCT24, and MtCCT31 [41]. Similarly, in Aegilops tauschii, AetCCT genes can respond to different exogenous hormones, and the overall response to the hormones is consistent among the members after 24 and 72 h of IAA and NAA hormone application, but different members respond differently to the different hormones. IAA and NAA promoted the AetCCT1, AetCCT17, AetCCT18, and AetCCT19 expression, while suppressing the expression of AetCCT7, AetCCT12, and AetCCT22 [47]. In this study, in order to explore the expression pattern of StCCT genes in response to auxin, the expression of candidate genes in leaf, stem, and tuber tissues was determined via qPCR in the presence of different concentrations (10 mg/mL, 25 mg/mL and 50 mg/mL) of IAA and TIBA. The expression of StCCT12 and StCCT21 in leaves increased under 10 mg/mL IAA treatment but decreased significantly with increasing IAA concentration. Under TIBA treatment, the expression of StCCT12 and StCCT21 increased significantly. In addition, the expression of StCCT21 decreased in stems but increased in tubers under IAA and TIBA treatments. The expression of StCCT7, StCCT12, StCCT27, and StCCT29 increased in tubers under IAA and TIBA treatments. It is noteworthy that the expression of StCCT7 decreased in leaf and stem tissues but increased significantly in tubers with increasing concentrations of IAA and TIBA, suggesting that StCCT7 may respond to auxin signaling regulation in tubers, but its exact functional mechanism is not clear. These results provide a basis for further studies on the function of StCCT genes.

5. Conclusions

In this study, the potato CCT gene family was analyzed. A total of 32 full-length StCCT genes were identified and divided into five subfamilies. A phylogenetic tree and collinearity analysis of the selected StCCT genes provided an important basis for studying the evolutionary characteristics and gene expansion of StCCT genes. By analyzing the expression patterns of StCCT genes in different tissues and their response characteristics to hormones, this study provided valuable clues for revealing the potential functions of StCCT genes in the growth and development of the potato. This study provides a theoretical basis for future research on the function of StCCT genes and their role in the promotion in the growth and development in the potato.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/agronomy14102298/s1, Table S1. Primer information for qPCR used in this study. Table S2. Orthologs of StCCT family genes in different species. Table S3. Sequences of 10 predicted motifs of StCCT proteins. Figure S1. Neighbor-joining phylogenetic tree of StCCT genes with Arabidopsis thaliana (At), Oryza sativa (Os), Physcomitrium patens (Pp), Amborella trichopoda (Amtr), Glycine max (Gm), Selaginella moellendorffii (Sm), and Zea mays (Zm) CCT family genes. Blue circles, green circles, sepia circles, salmon pink circles, pink circles, dark blue circles, yellow circles and red stars represent the CCT proteins of Arabidopsis thaliana, Oryza sativa, Physcomitrium patens, Amborella trichopoda, Glycine max, Selaginella moellendorffii, Zea mays and Solanum tuberosum, respectively.

Author Contributions

Conceptualization, X.H. and C.C.; formal analysis, X.H., J.Y., Y.L., J.L. and S.Z.; funding acquisition, J.Y., L.L., Y.C. and C.C.; investigation, X.H., Y.B., F.L., Q.C. and W.Z.; methodology, X.H., J.Y. and Y.B.; project administration, C.C.; resources, C.C.; supervision, Y.L., J.L., S.Z. and Y.C.; visualization, X.H., J.Y., Y.B., F.L., Q.C., W.Z. and C.C.; writing—original draft, X.H. and J.Y.; writing—review and editing, L.L. and C.C. All authors have read and agreed to the published version of the manuscript.

Funding

The financial support for this study were provided by the Science & Technology Department of Sichuan Province Science and Technology Plan Project (2021YFN0113), the first batch of Scientific and Technological Innovation Team for Qinghai-Tibetan Plateau Research in Southwest Minzu University (Grant No. 2024CXTD04), the Fundamental Research Funds for the Central Universities, Southwest Minzu University (ZYN2023099), the Discipline Construction Project Southwest Minzu University (CX2023009), and the Tibetan Plateau Ecological Animal Husbandry Collaborative Innovation Center of Southwest Minzu University (2021PTJS30).

Data Availability Statement

Data used in this study are presented in the Supplementary Materials.

Acknowledgments

C.C., J.Y. and L.L. acknowledge the Science & Technology Department of Sichuan Province Science and Technology Plan Project; C.C. and Y.L. acknowledge the first batch of Scientific and Technological Innovation Team for Qinghai-Tibetan Plateau Research in Southwest Minzu University, and the Fundamental Research Funds for the Central Universities, Southwest Minzu University; Y.C. acknowledges the Discipline Construction Project Southwest Minzu University, and the Tibetan Plateau Ecological Animal Husbandry Collaborative Innovation Center of Southwest Minzu University.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Sun, W.J.; Ma, Z.T.; Chen, H.; Liu, M.Y. MYB Gene Family in Potato (Solanum tuberosum L.): Genome-Wide Identification of Hormone-Responsive Reveals Their Potential Functions in Growth and Development. Int. J. Mol. Sci. 2019, 20, 23. [Google Scholar] [CrossRef] [PubMed]
  2. Li, C.; Sun, Y.; Li, J.; Zhang, T.; Zhou, F.; Song, Q.; Liu, Y.; Brestic, M.; Chen, T.H.; Yang, X. ScCBF1 plays a stronger role in cold, salt and drought tolerance than StCBF1 in potato (Solanum tuberosum). J. Plant Physiol. 2022, 278, 153806. [Google Scholar] [CrossRef] [PubMed]
  3. Ahmad, D.; Zhang, Z.W.; Rasheed, H.; Xu, X.Y.; Bao, J.S. Recent Advances in Molecular Improvement for Potato Tuber Traits. Int. J. Mol. Sci. 2022, 23, 9982. [Google Scholar] [CrossRef]
  4. Plantenga, F.D.M.; Bergonzi, S.; Abelenda, J.A.; Bachem, C.W.B.; Visser, R.G.F.; Heuvelink, E.; Marcelis, L.F.M. The tuberization signal StSP6A represses flower bud development in potato. J. Exp. Bot. 2019, 70, 937–948. [Google Scholar] [CrossRef] [PubMed]
  5. Navarro, C.; Abelenda, J.A.; Cruz-Oró, E.; Cuéllar, C.A.; Tamaki, S.; Silva, J.; Shimamoto, K.; Prat, S. Control of flowering and storage organ formation in potato by FLOWERING LOCUS T. Nature 2011, 478, 119–122. [Google Scholar] [CrossRef] [PubMed]
  6. Pajoro, A.; Biewers, S.; Dougali, E.; Leal Valentim, F.; Mendes, M.A.; Porri, A.; Coupland, G.; Van de Peer, Y.; van Dijk, A.D.; Colombo, L.; et al. The (r)evolution of gene regulatory networks controlling Arabidopsis plant reproduction: A two-decade history. J. Exp. Bot. 2014, 65, 4731–4745. [Google Scholar] [CrossRef]
  7. Plantenga, F.; Siakou, M.; Bergonzi, S.; Heuvelink, E.; Bachem, C.; Visser, R.; Marcelis, L. Regulating flower and tuber formation in potato with light spectrum and day length. In Proceedings of the VIII International Symposium on Light in Horticulture 1134, East Lansing, MI, USA, 22–26 May 2016; pp. 267–276. [Google Scholar] [CrossRef]
  8. Searle, I.; Coupland, G.J.T.E.J. Induction of flowering by seasonal changes in photoperiod. EMBO J. 2004, 23, 1217–1222. [Google Scholar] [CrossRef]
  9. Griffiths, S.; Dunford, R.P.; Coupland, G.; Laurie, D.A. The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 2003, 131, 1855–1867. [Google Scholar] [CrossRef]
  10. Masaki, T.; Tsukagoshi, H.; Mitsui, N.; Nishii, T.; Hattori, T.; Morikami, A.; Nakamura, K. Activation tagging of a gene for a protein with novel class of CCT-domain activates expression of a subset of sugar-inducible genes in Arabidopsis thaliana. Plant J. Cell Mol. Biol. 2005, 43, 142–152. [Google Scholar] [CrossRef]
  11. Vanholme, B.; Grunewald, W.; Bateman, A.; Kohchi, T.; Gheysen, G. The tify family previously known as ZIM. Trends Plant Sci. 2007, 12, 239–244. [Google Scholar] [CrossRef]
  12. Iwata, Y.; Yamada, T.; Koizumi, N.J.P.b. Transcriptional regulation of an Arabidopsis gene encoding a CCT domain-containing protein during endoplasmic reticulum stress. Plant Biotechnol. 2008, 25, 397–402. [Google Scholar] [CrossRef]
  13. de Los Reyes, P.; Serrano-Bueno, G.; Romero-Campero, F.J.; Gao, H.; Romero, J.M.; Valverde, F.J.M.P. CONSTANS alters the circadian clock in Arabidopsis thaliana. Molecular Plant. 2024, 17, 1204–1220. [Google Scholar] [CrossRef] [PubMed]
  14. Jung, C.; Müller, A.E. Flowering time control and applications in plant breeding. Trends Plant Sci. 2009, 14, 563–573. [Google Scholar] [CrossRef] [PubMed]
  15. Farré, E.M.; Liu, T. The PRR family of transcriptional regulators reflects the complexity and evolution of plant circadian clocks. Curr. Opin. Plant Biol. 2013, 16, 621–629. [Google Scholar] [CrossRef] [PubMed]
  16. Hayama, R.; Sarid-Krebs, L.; Richter, R.; Fernández, V.; Jang, S.; Coupland, G. PSEUDO RESPONSE REGULATORs stabilize CONSTANS protein to promote flowering in response to day length. EMBO J. 2017, 36, 904–918. [Google Scholar] [CrossRef]
  17. Abelenda, J.A.; Cruz-Oró, E.; Franco-Zorrilla, J.M.; Prat, S. Potato StCONSTANS-like1 Suppresses Storage Organ Formation by Directly Activating the FT-like StSP5G Repressor. Curr. Biol. CB 2016, 26, 872–881. [Google Scholar] [CrossRef]
  18. Dutt, S.; Manjul, A.S.; Raigond, P.; Singh, B.; Siddappa, S.; Bhardwaj, V.; Kawar, P.G.; Patil, V.U.; Kardile, H.B. Key players associated with tuberization in potato: Potential candidates for genetic engineering. Crit. Rev. Biotechnol. 2017, 37, 942–957. [Google Scholar] [CrossRef]
  19. Morris, W.L.; Ducreux, L.J.M.; Morris, J.; Campbell, R.; Usman, M.; Hedley, P.E.; Prat, S.; Taylor, M.A. Identification of TIMING OF CAB EXPRESSION 1 as a temperature-sensitive negative regulator of tuberization in potato. J. Exp. Bot. 2019, 70, 5703–5714. [Google Scholar] [CrossRef]
  20. Hancock, R.D.; Morris, W.L.; Ducreux, L.J.; Morris, J.A.; Usman, M.; Verrall, S.R.; Fuller, J.; Simpson, C.G.; Zhang, R.; Hedley, P.E.; et al. Physiological, biochemical and molecular responses of the potato (Solanum tuberosum L.) plant to moderately elevated temperature. Plant Cell Environ. 2014, 37, 439–450. [Google Scholar] [CrossRef]
  21. Nishii, A.; Takemura, M.; Fujita, H.; Shikata, M.; Yokota, A.; Kohchi, T. Characterization of a novel gene encoding a putative single zinc-finger protein, ZIM, expressed during the reproductive phase in Arabidopsis thaliana. Biosci. Biotechnol. Biochem. 2000, 64, 1402–1409. [Google Scholar] [CrossRef]
  22. Shikata, M.; Matsuda, Y.; Ando, K.; Nishii, A.; Takemura, M.; Yokota, A.; Kohchi, T. Characterization of Arabidopsis ZIM, a member of a novel plant-specific GATA factor gene family. J. Exp. Bot. 2004, 55, 631–639. [Google Scholar] [CrossRef] [PubMed]
  23. Zhao, Y. Auxin biosynthesis and its role in plant development. Annu. Rev. Plant Biol. 2010, 61, 49–64. [Google Scholar] [CrossRef] [PubMed]
  24. Werghi, S.; Herrero, F.A.; Fakhfakh, H.; Gorsane, F. Auxin drives tomato spotted wilt virus (TSWV) resistance through epigenetic regulation of auxin response factor ARF8 expression in tomato. Gene 2021, 804, 145905. [Google Scholar] [CrossRef] [PubMed]
  25. Lu, T.; Ke, M.; Lavoie, M.; Jin, Y.; Fan, X.; Zhang, Z.; Fu, Z.; Sun, L.; Gillings, M.; Peñuelas, J.; et al. Rhizosphere microorganisms can influence the timing of plant flowering. Microbiome 2018, 6, 231. [Google Scholar] [CrossRef]
  26. Yamaguchi, N.; Wu, M.F.; Winter, C.M.; Berns, M.C.; Nole-Wilson, S.; Yamaguchi, A.; Coupland, G.; Krizek, B.A.; Wagner, D. A molecular framework for auxin-mediated initiation of flower primordia. Dev. Cell 2013, 24, 271–282. [Google Scholar] [CrossRef] [PubMed]
  27. Cheng, Y.; Zhao, Y.J.J.o.i.p.b. A role for auxin in flower development. J. Integr. Plant Biol. 2007, 49, 99–104. [Google Scholar] [CrossRef]
  28. Dong, X.; Li, Y.; Guan, Y.; Wang, S.; Luo, H.; Li, X.; Li, H.; Zhang, Z. Auxin-induced AUXIN RESPONSE FACTOR4 activates APETALA1 and FRUITFULL to promote flowering in woodland strawberry. Hortic. Res. 2021, 8, 115. [Google Scholar] [CrossRef]
  29. Ma, C.; Dang, K.; Xie, Q.; Sahito, J.H.; Yuan, B.; Wan, J.; Qiu, X.; Zhao, J.; Lin, Y.; Meng, S.J.A. Over-Expression of ZmIAA29, an AUX/IAA Transcription Factor, Improved Maize Flowering Time. Agronomy 2023, 13, 2028. [Google Scholar] [CrossRef]
  30. Li, R.N.; Li, T.; Wu, X.; Yao, X.Y.; Ai, H.; Zhang, Y.J.; Gan, Z.C.; Huang, X.Z. Genome-Wide Identification, Characterization and Expression Profiling of the CONSTANS-like Genes in Potato (Solanum tuberosum L.). Genes 2023, 14, 15. [Google Scholar] [CrossRef]
  31. Savojardo, C.; Martelli, P.L.; Fariselli, P.; Profiti, G.; Casadio, R. BUSCA: An integrative web server to predict subcellular localization of proteins. Nucleic Acids Res. 2018, 46, W459–W466. [Google Scholar] [CrossRef]
  32. Chen, C.J.; Wu, Y.; Li, J.W.; Wang, X.; Zeng, Z.H.; Xu, J.; Liu, Y.L.; Feng, J.T.; Chen, H.; He, Y.H.; et al. TBtools-II: A “one for all, all for one”bioinformatics platform for biological big-data mining. Mol. Plant 2023, 16, 1733–1742. [Google Scholar] [CrossRef] [PubMed]
  33. Tamura, K.; Stecher, G.; Kumar, S. MEGA11 Molecular Evolutionary Genetics Analysis Version 11. Mol. Biol. Evol. 2021, 38, 3022–3027. [Google Scholar] [CrossRef] [PubMed]
  34. Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [PubMed]
  35. Xu, X.; Pan, S.; Cheng, S.; Zhang, B.; Mu, D.; Ni, P.; Zhang, G.; Yang, S.; Li, R.; Wang, J.; et al. Genome sequence and analysis of the tuber crop potato. Nature 2011, 475, 189–195. [Google Scholar] [CrossRef]
  36. Slater, A.T.; Cogan, N.O.; Hayes, B.J.; Schultz, L.; Dale, M.F.; Bryan, G.J.; Forster, J.W. Improving breeding efficiency in potato using molecular and quantitative genetics. TAG. Theor. Appl. Genet. Theor. Und Angew. Genet. 2014, 127, 2279–2292. [Google Scholar] [CrossRef]
  37. Du, H.; Fang, C.; Li, Y.; Kong, F.; Liu, B. Understandings and future challenges in soybean functional genomics and molecular breeding. J. Integr. Plant Biol. 2023, 65, 468–495. [Google Scholar] [CrossRef]
  38. Lv, P.; Su, F.; Chen, F.; Yan, C.; Xia, D.; Sun, H.; Li, S.; Duan, Z.; Ma, C.; Zhang, H.; et al. Genome editing in rice using CRISPR/Cas12i3. Plant Biotechnol. J. 2024, 22, 379–385. [Google Scholar] [CrossRef]
  39. Jin, M.L.; Liu, X.G.; Jia, W.; Liu, H.J.; Li, W.Q.; Peng, Y.; Du, Y.F.; Wang, Y.B.; Yin, Y.J.; Zhang, X.H.; et al. ZmCOL3, a CCT gene represses flowering in maize by interfering with the circadian clock and activating expression of ZmCCT. J. Integr. Plant Biol. 2018, 60, 465–480. [Google Scholar] [CrossRef]
  40. Li, Y.T.; Yu, S.M.; Zhang, Q.Y.; Wang, Z.W.; Liu, M.L.; Zhang, A.; Dong, X.M.; Fan, J.J.; Zhu, Y.S.; Ruan, Y.Y.; et al. Genome-Wide Identification and Characterization of the CCT Gene Family in Foxtail Millet (Setaria italica) Response to Diurnal Rhythm and Abiotic Stress. Genes 2022, 13, 16. [Google Scholar] [CrossRef]
  41. Ma, L.; Yi, D.X.; Yang, J.F.; Liu, X.Q.; Pang, Y.Z. Genome-Wide Identification, Expression Analysis and Functional Study of CCT Gene Family in Medicago truncatula. Plants 2020, 9, 19. [Google Scholar] [CrossRef]
  42. Takagi, H.; Hempton, A.K.; Imaizumi, T. Photoperiodic flowering in Arabidopsis: Multilayered regulatory mechanisms of CONSTANS and the florigen FLOWERING LOCUS T. Plant Commun. 2023, 4, 100552. [Google Scholar] [CrossRef] [PubMed]
  43. Murphy, R.L.; Klein, R.R.; Morishige, D.T.; Brady, J.A.; Rooney, W.L.; Miller, F.R.; Dugas, D.V.; Klein, P.E.; Mullet, J.E. Coincident light and clock regulation of pseudoresponse regulator protein 37 (PRR37) controls photoperiodic flowering in sorghum. Proc. Natl. Acad. Sci. USA 2011, 108, 16469–16474. [Google Scholar] [CrossRef] [PubMed]
  44. Liu, J.; Shen, J.; Xu, Y.; Li, X.; Xiao, J.; Xiong, L. Ghd2, a CONSTANS-like gene, confers drought sensitivity through regulation of senescence in rice. J. Exp. Bot. 2016, 67, 5785–5798. [Google Scholar] [CrossRef] [PubMed]
  45. Liu, H.; Liu, H.; Zhou, L.; Zhang, Z.; Zhang, X.; Wang, M.; Li, H.; Lin, Z. Parallel Domestication of the Heading Date 1 Gene in Cereals. Mol. Biol. Evol. 2015, 32, 2726–2737. [Google Scholar] [CrossRef] [PubMed]
  46. Mengarelli, D.A.; Zanor, M.I. Genome-wide characterization and analysis of the CCT motif family genes in soybean (Glycine max). Planta 2021, 253, 15. [Google Scholar] [CrossRef]
  47. Zheng, X.; Li, X.; Ge, C.; Chang, J.; Shi, M.; Chen, J.; Qiao, L.; Chang, Z.; Zheng, J.; Zhang, J. Characterization of the CCT family and analysis of gene expression in Aegilops tauschii. PLoS ONE 2017, 12, e0189333. [Google Scholar] [CrossRef]
  48. Vanneste, S.; Friml, J. Auxin: A trigger for change in plant development. Cell 2009, 136, 1005–1016. [Google Scholar] [CrossRef]
  49. Yu, L.; Xia, J.; Jiang, R.; Wang, J.; Yuan, X.; Dong, X.; Chen, Z.; Zhao, Z.; Wu, B.; Zhan, L.; et al. Genome-Wide Identification and Characterization of the CCT Gene Family in Rapeseed (Brassica napus L.). Int. J. Mol. Sci. 2024, 25, 5301. [Google Scholar] [CrossRef]
  50. Zhang, Z.L.; Ji, R.H.; Li, H.Y.; Zhao, T.; Liu, J.; Lin, C.T.; Liu, B. CONSTANS-LIKE 7 (COL7) Is Involved in Phytochrome B (phyB)-Mediated Light-Quality Regulation of Auxin Homeostasis. Mol. Plant 2014, 7, 1429–1440. [Google Scholar] [CrossRef]
  51. Voß, U.; Wilson, M.H.; Kenobi, K.; Gould, P.D.; Robertson, F.C.; Peer, W.A.; Lucas, M.; Swarup, K.; Casimiro, I.; Holman, T.J.; et al. The circadian clock rephases during lateral root organ initiation in Arabidopsis thaliana. Nat. Commun. 2015, 6, 7641. [Google Scholar] [CrossRef]
Figure 1. Chromosomal distribution of StCCT genes.
Figure 1. Chromosomal distribution of StCCT genes.
Agronomy 14 02298 g001
Figure 2. Collinearity analysis of StCCT genes, red lines indicate syntenic StCCT gene pairs.
Figure 2. Collinearity analysis of StCCT genes, red lines indicate syntenic StCCT gene pairs.
Agronomy 14 02298 g002
Figure 3. Collinearity analysis of StCCT genes with Arabidopsis thaliana and Oryza sativa (A), Solanum lycopersicum and Capsicum annuum (B), the gray background represents synteny blocks between the whole genome, and red lines represent collinear gene pairs of CCT genes.
Figure 3. Collinearity analysis of StCCT genes with Arabidopsis thaliana and Oryza sativa (A), Solanum lycopersicum and Capsicum annuum (B), the gray background represents synteny blocks between the whole genome, and red lines represent collinear gene pairs of CCT genes.
Agronomy 14 02298 g003
Figure 4. Maximum likelihood phylogenetic tree of StCCT genes with Arabidopsis thaliana (At), Oryza sativa (Os), Physcomitrium patens (Pp), Amborella trichopoda (Amtr), Glycine max (Gm), Selaginella moellendorffii (Sm), and Zea mays (Zm) CCT family genes. Blue circles, green circles, sepia circles, salmon pink circles, pink circles, dark blue circles, yellow circles and red stars represent the CCT proteins of Arabidopsis thaliana, Oryza sativa, Physcomitrium patens, Amborella trichopoda, Glycine max, Selaginella moellendorffii, Zea mays, and Solanum tuberosum, respectively.
Figure 4. Maximum likelihood phylogenetic tree of StCCT genes with Arabidopsis thaliana (At), Oryza sativa (Os), Physcomitrium patens (Pp), Amborella trichopoda (Amtr), Glycine max (Gm), Selaginella moellendorffii (Sm), and Zea mays (Zm) CCT family genes. Blue circles, green circles, sepia circles, salmon pink circles, pink circles, dark blue circles, yellow circles and red stars represent the CCT proteins of Arabidopsis thaliana, Oryza sativa, Physcomitrium patens, Amborella trichopoda, Glycine max, Selaginella moellendorffii, Zea mays, and Solanum tuberosum, respectively.
Agronomy 14 02298 g004
Figure 5. Phylogenetic tree (A), motif compositions (B), conserved domain (C), and gene structure (D) of StCCT genes.
Figure 5. Phylogenetic tree (A), motif compositions (B), conserved domain (C), and gene structure (D) of StCCT genes.
Agronomy 14 02298 g005
Figure 6. Number of cis-elements of StCCT genes.
Figure 6. Number of cis-elements of StCCT genes.
Agronomy 14 02298 g006
Figure 7. Heatmap of StCCT genes in different tissues (A), upset diagram of StCCT genes in different tissues (B).
Figure 7. Heatmap of StCCT genes in different tissues (A), upset diagram of StCCT genes in different tissues (B).
Agronomy 14 02298 g007
Figure 8. Heatmap of StCCT genes in different tissues (leaf (A), stem (B), and tuber (C)) under different treatments (IAA (1), TIBA (2)).
Figure 8. Heatmap of StCCT genes in different tissues (leaf (A), stem (B), and tuber (C)) under different treatments (IAA (1), TIBA (2)).
Agronomy 14 02298 g008
Table 1. Physicochemical properties of StCCT genes.
Table 1. Physicochemical properties of StCCT genes.
NameGene IDChromosomal LocationsNumber of Amino AcidMolecular Weight (KDa)Theoretical pIInstability IndexAliphatic IndexGrand Average of HydropathicitySubcellular Localization
StCCT1PGSC0003DMG400026690Chr1: 44702628: 4470415126529.724.8245.0260−0.745nucleus
StCCT2PGSC0003DMG400033576Chr1: 82686049: 82692942328356.1345.8456.28−0.779nucleus
StCCT3PGSC0003DMG400010684Chr1: 82700202: 8270563137540.854.9354.4162.69−0.557nucleus
StCCT4PGSC0003DMG402010056Chr2: 45088023: 4509264741345.875.8243.3463.08−0.683nucleus
StCCT5PGSC0003DMG401010056Chr2: 45098374: 4510157740544.945.5741.6865.78−0.558nucleus
StCCT6PGSC0003DMG400012618Chr2: 47591315: 4759476832337.195.8755.8272.38−0.822chloroplast
StCCT7PGSC0003DMG400000584Chr3: 47434904: 4744004368074.476.3252.8666.29−0.702nucleus
StCCT8PGSC0003DMG400009122Chr3: 48578777: 4858295727931.335.2845.3466.81−0.494nucleus
StCCT9PGSC0003DMG400019518Chr3: 55634633: 5564167055162.666.1854.4570.22−0.65nucleus
StCCT10PGSC0003DMG400005633Chr3: 58929268: 5893091740145.835.6151.0464.99−0.806nucleus
StCCT11PGSC0003DMG400007749Chr4: 1419075: 142748942848.815.4449.6259.42−0.867nucleus
StCCT12PGSC0003DMG400009353Chr4: 65202650: 6520844835338.585.1145.4867.08−0.611nucleus
StCCT13PGSC0003DMG400006387Chr4: 65533307: 6553839232535.975.1545.274.43−0.537nucleus
StCCT14PGSC0003DMG400014566Chr5: 2941260: 294357044751.225.6242.3468.05−0.775nucleus
StCCT15PGSC0003DMG400025414Chr5: 16834679: 1683830545349.926.0946.9466.56−0.6nucleus
StCCT16PGSC0003DMG400005325Chr5: 35571410: 3557732141345.055.6159.9660.24−0.512nucleus
StCCT17PGSC0003DMG400001263Chr5: 42736399: 4273859942246.55.1350.5664.5−0.508nucleus
StCCT18PGSC0003DMG400033048Chr6: 51538785: 5154582854962.416.1660.8273.11−0.625nucleus
StCCT19PGSC0003DMG400027475Chr7: 2275710: 227732838542.46.0536.7771.48−0.331nucleus
StCCT20PGSC0003DMG400022983Chr7: 5787577: 579182143248.418.4650.6368.8−0.751chloroplast
StCCT21PGSC0003DMG400017411Chr7: 43164006: 4317266541145.675.4155.9257.18−0.593nucleus
StCCT22PGSC0003DMG400022124Chr7: 56533114: 5653452621324.847.6440.2954.04−1.029nucleus
StCCT23PGSC0003DMG400026311Chr8: 2052883: 205482634738.655.349.8561.04−0.595nucleus
StCCT24PGSC0003DMG400012193Chr8: 55059905: 5506257132537.545.3753.1950.4−0.883extracellular space
StCCT25PGSC0003DMG400011378Chr9: 52024565: 5202771337943.065.7856.7661.48−0.792nucleus
StCCT26PGSC0003DMG400017148Chr9: 56953130: 5695689541146.135.0952.7856.76−0.744nucleus
StCCT27PGSC0003DMG402011297Chr10: 124380: 13105364070.85.7146.0765.97−0.683nucleus
StCCT28PGSC0003DMG400015524Chr11: 45034220: 4503566215017.728.473.5451.33−1.221nucleus
StCCT29PGSC0003DMG400028818Chr12: 6077490: 608519440845.125.2659.4359.53−0.6nucleus
StCCT30PGSC0003DMG400042340Chr12: 18944287: 1894539325929.135.1545.4359.07−0.774nucleus
StCCT31PGSC0003DMG400029365Chr12: 58153725: 5815511835739.095.349.4762.91−0.486nucleus
StCCT32PGSC0003DMG400029253Chr12: 58571736: 5857459343649.055.2854.6657.71−0.81nucleus
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Huang, X.; Yang, J.; Bai, Y.; Liu, L.; Liu, F.; Cui, Q.; Liu, Y.; Chen, Y.; Zhang, W.; Li, J.; et al. Genome-Wide Analysis of Potato CCT Family Genes and Its Response to Auxin Substances. Agronomy 2024, 14, 2298. https://doi.org/10.3390/agronomy14102298

AMA Style

Huang X, Yang J, Bai Y, Liu L, Liu F, Cui Q, Liu Y, Chen Y, Zhang W, Li J, et al. Genome-Wide Analysis of Potato CCT Family Genes and Its Response to Auxin Substances. Agronomy. 2024; 14(10):2298. https://doi.org/10.3390/agronomy14102298

Chicago/Turabian Style

Huang, Xiongjie, Jingtian Yang, Yiting Bai, Lei Liu, Fang Liu, Qi Cui, Yuan Liu, Youjun Chen, Wenlu Zhang, Juan Li, and et al. 2024. "Genome-Wide Analysis of Potato CCT Family Genes and Its Response to Auxin Substances" Agronomy 14, no. 10: 2298. https://doi.org/10.3390/agronomy14102298

APA Style

Huang, X., Yang, J., Bai, Y., Liu, L., Liu, F., Cui, Q., Liu, Y., Chen, Y., Zhang, W., Li, J., Zhang, S., & Chen, C. (2024). Genome-Wide Analysis of Potato CCT Family Genes and Its Response to Auxin Substances. Agronomy, 14(10), 2298. https://doi.org/10.3390/agronomy14102298

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop