Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions
Abstract
1. Introduction
2. Biological Properties of Wasp Venom, and Their Isolated and Synthesized Bioactive Peptides
2.1. Biological Properties
2.1.1. Antimicrobial Activities
2.1.2. Anti-Inflammatory Activities
2.1.3. Genotoxicity
2.1.4. Anticoagulant
2.2. Isolated and Synthesized Bioactive Peptides from Wasp Venoms
2.2.1. Mastoparans
Mastoparan (MP)
Mastoparan-B (MP-B)
Mastoparan-M
2.2.2. Anoplin
2.2.3. Decoralin
2.2.4. Polybia-MP-I
2.2.5. Polybia-CP
2.2.6. Polydim-I
2.2.7. Protonectarina-MP and Agelaia-MP
2.2.8. Philanthotoxin-433 (PhTX-433)
3. Application of Wasp Venom and Their Nests in Nanotechnology
4. Wasp Venom, Allergies, and Sensitization: A Double-Edged Sword
5. Concluding Remarks
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Konno, K.; Kazuma, K.; Nihei, K. Peptide toxins in solitary wasp venoms. Toxins 2016, 8, 114. [Google Scholar] [CrossRef] [Scilit]
- Lin, Z.; Cheng, Y.; Wang, R.J.; Du, J.; Volovych, O.; Li, J.C.; Hu, Y.; Lu, Z.Y.; Lu, Z.; Zou, Z. A metalloprotease homolog venom protein from a parasitoid wasp suppresses the toll pathway in host hemocytes. Front. Immunol. 2018, 9, 2301–2315. [Google Scholar] [CrossRef] [Scilit]
- Gong, J.; Yuan, H.; Gao, Z.; Hu, F. Wasp venom and acute kidney injury: The mechanisms and therapeutic role of renal replacement therapy. Toxicon 2019, 163, 1–7. [Google Scholar] [CrossRef] [Scilit]
- Kim, Y.; Son, M.; Noh, E.Y.; Kim, S.; Kim, C.; Yeo, J.H.; Park, C.; Lee, K.W.; Bang, W.Y. MP-V1 from the venom of social wasp Vespula vulgaris is a de novo type of mastoparan that displays superior antimicrobial activities. Molecules 2016, 21, 512. [Google Scholar] [CrossRef] [Scilit]
- Chen, W.; Yang, X.; Yang, X.; Zhai, L.; Lu, Z.; Liu, J.; Yu, H. Antimicrobial peptides from the venoms of Vespa bicolor Fabricius. Peptides 2008, 29, 1887–1892. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wu, R.; Li, D.; Tang, Q.; Wang, W.; Xie, G.; Dou, P. A novel peptide from Vespa ducalis induces apoptosis in osteosarcoma cells by activating the p38 mapk and jnk signaling pathways. Biol. Pharm. Bull. 2018, 41, 458–464. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Danneels, E.L.; Gerlo, S.; Heyninck, K.; Van Craenenbroeck, K.; De Bosscher, K.; Haegeman, G.; De Graaf, D.C. How the venom from the ectoparasitoid wasp Nasonia vitripennis exhibits anti-inflammatory properties on mammalian cell lines. PLoS ONE 2014, 9, e96825. [Google Scholar] [CrossRef] [Scilit]
- Torres, M.D.T.; Silva, A.F.; Andrade, G.P.; Pedron, C.N.; Cerchiaro, G.; Ribeiro, A.O.; Oliveira, V.X.; de la Fuente-Nunez, C. The wasp venom antimicrobial peptide polybia-CP and its synthetic derivatives display antiplasmodial and anticancer properties. Bioeng. Transl. Med. 2020, 5, e10167. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vila-Farrés, X.; López-Rojas, R.; Pachón-Ibáñez, M.E.; Teixidó, M.; Pachón, J.; Vila, J.; Giralt, E. Sequence-activity relationship, and mechanism of action of mastoparan analogues against extended-drug resistant Acinetobacter baumannii. Eur. J. Med. Chem. 2015, 101, 34–40. [Google Scholar] [CrossRef] [Scilit]
- Chionis, K.; Krikorian, D.; Koukkou, A.; Sakarellos-daitsiotis, M.; Panou-pomonis, E. Synthesis and biological activity of lipophilic analogs of the cationic antimicrobial active peptide anoplin. Pept. Sci. 2016, 22, 731–736. [Google Scholar] [CrossRef] [Scilit]
- Torres, M.D.T.; Pedron, C.N.; da Silva Lima, J.A.; da Silva, P.I.; da Silva, F.D.; Oliveira, V.X. Antimicrobial activity of leucine-substituted decoralin analogs with lower hemolytic activity. J. Pept. Sci. 2017, 23, 818–823. [Google Scholar] [CrossRef] [Scilit]
- Wang, K.; Zhang, B.; Zhang, W.; Yan, J.; Li, J.; Wang, R. Antitumor effects, cell selectivity and structure-activity relationship of a novel antimicrobial peptide polybia-MPI. Peptides 2008, 29, 963–968. [Google Scholar] [CrossRef] [Scilit]
- Wang, K.; Jia, F.; Dang, W.; Zhao, Y.; Zhu, R. Antifungal effect and action mechanism of antimicrobial peptide polybia-CP. Pept. Sci. 2016, 22, 28–35. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, K.; Yan, J.; Liu, X.; Zhang, J.; Chen, R.; Zhang, B.; Dang, W.; Zhang, W.; Kai, M.; Song, J.; et al. Novel cytotoxity exhibition mode of polybia-CP, a novel antimicrobial peptide from the venom of the social wasp Polybia paulista. Toxicology 2011, 288, 27–33. [Google Scholar] [CrossRef] [Scilit]
- Coutinho, R.; Trentini, M.M.; De Castro, J.; Simon, K.S.; Bocca, A.L.; Silva, L.P.; Mortari, R.; Kipnis, A.; Junqueira-Kipnis, A.P. Antimycobacterial activity of a new peptide polydim-I isolated from Neotropical social wasp Polybia dimorpha. PLoS ONE 2016, 11, e0149729. [Google Scholar]
- Gonçalves, J.; Rangel, M.; Biolchi, A.; Alves, E.; Moreira, K.; Silva, L.; Mortari, M. Antinociceptive properties of the mastoparan peptide Agelaia-MPI isolated from social wasps. Toxicon 2016, 120, 15–21. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Da Silva, A.V.R.; De Souza, B.M.; Dos Santos Cabrera, M.P.; Dias, N.B.; Gomes, P.C.; Neto, J.R.; Stabeli, R.G.; Palma, M.S. The effects of the C-terminal amidation of mastoparans on their biological actions and interactions with membrane-mimetic systems. Biochim. Biophys. Acta—Biomembr. 2014, 1838, 2357–2368. [Google Scholar] [CrossRef] [Scilit]
- Hilchie, A.L.; Sharon, A.J.; Haney, E.F.; Hoskin, D.W.; Bally, M.B.; Franco, O.L.; Corcoran, J.A.; Hancock, R.E.W. Mastoparan is a membranolytic anti-cancer peptide that works synergistically with gemcitabine in a mouse model of mammary carcinoma. Biochim. Biophys. Acta—Biomembr. 2016, 1858, 3195–3204. [Google Scholar] [CrossRef] [Scilit]
- Jalaei, J.; Layeghi-Ghalehsoukhteh, S.; Hosseini, A.; Fazeli, M. Antibacterial effects of gold nanoparticles functionalized with the extracted peptide from Vespa orientalis wasp venom. J. Pept. Sci. 2018, 24, e3124–e3133. [Google Scholar] [CrossRef] [Scilit]
- Kalansuriya, P.; Quezada, M.; Espósito, B.P.; Capon, R.J. Talarazines A–E: Noncytotoxic iron (III) chelators from an Australian mud dauber wasp-associated fungus, talaromyces sp. (CMB-W045). J. Nat. Prod. 2017, 80, 609–615. [Google Scholar] [CrossRef] [Scilit]
- Pepe, D.; Carvalho, V.F.M.; McCall, M.; de Lemos, D.P.; Lopes, L.B. Transportan in nanocarriers improves skin localization and antitumor activity of paclitaxel. Int. J. Nanomed. 2016, 11, 2009–2019. [Google Scholar]
- Perkins, J.B.; Yates, A.B. Allergy to stinging insects: Diagnosis and management. EMJ Allergy Immunol. 2018, 3, 99–105. [Google Scholar]
- Pospischil, I.M.; Kagerer, M.; Cozzio, A.; Angelova-Fischer, I.; Guenova, E.; Ballmer-Weber, B.; Hoetzenecker, W. Comparison of the safety profiles of 3 different Hymenoptera venom immunotherapy protocols: A retrospective 2-center study of 143 patients. Int. Arch. Allergy Immunol. 2020, 181, 783–789. [Google Scholar] [CrossRef] [Scilit]
- Sahiner, U.M.; Durham, S.R. Hymenoptera venom allergy: How does venom immunotherapy prevent anaphylaxis from bee and wasp stings? Front. Immunol. 2019, 10, 1959–1966. [Google Scholar] [CrossRef] [Scilit]
- Baracchi, D.; Tragust, S. Venom as a component of external immune defense. In Evolution of Venomous Animals and Their Toxins; Gopalakrishnakone, P., Malhotra, A., Eds.; Springer Nature Switzerland AG: Cham, Switzerland, 2017; Volume 11, pp. 213–233. ISBN 9789400764583. [Google Scholar]
- Chen, X.; Zhang, L.; Wu, Y.; Wang, L.; Ma, C.; Xi, X.; Bininda-Emonds, O.R.P.; Shaw, C.; Chen, T.; Zhou, M. Evaluation of the bioactivity of a mastoparan peptide from wasp venom and of its analogues designed through targeted engineering. Int. J. Biol. Sci. 2018, 14, 599–607. [Google Scholar] [CrossRef] [Scilit]
- Danneels, E.L.; Formesyn, E.M.; de Graaf, D.C. Exploring the potential of venom from Nasonia vitripennis as therapeutic agent with high-throughput screening tools. Toxins 2015, 7, 2051–2070. [Google Scholar] [CrossRef] [Scilit]
- Czaikoski, P.G.; Menaldo, D.L.; Marcussi, S.; Baseggio, A.L.; Fuly, A.L.; Paula, R.C.; Quadros, A.U.; Romao, P.R.; Buschini, M.L.; Cunha, F.Q.; et al. Anticoagulant and fibrinogenolytic properties of the venom of Polybia occidentalis social wasp. Blood Coagul. Fibrinolysis 2010, 21, 653–659. [Google Scholar] [CrossRef] [Scilit]
- Hoshina, M.M.; Santos, L.D.; Palma, M.S.; Marin-morales, M.A. Cytotoxic, genotoxic/antigenotoxic and mutagenic/antimutagenic effects of the venom of the wasp Polybia paulista. Toxicon 2013, 72, 64–70. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yang, X.; Wang, Y.; Lee, W.H.; Zhang, Y. Antimicrobial peptides from the venom gland of the social wasp Vespa tropica. Toxicon 2013, 74, 151–157. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jalaei, J.; Fazeli, M.; Rajaian, H.; Shekarforoush, S.S. In vitro antibacterial effect of wasp (Vespa orientalis) venom. J. Venom. Anim. Toxins Incl. Trop. Dis. 2014, 20, 22–27. [Google Scholar] [CrossRef] [Scilit]
- Baracchi, D.; Mazza, G.; Turillazzi, S. From individual to collective immunity: The role of the venom as antimicrobial agent in the Stenogastrinae wasp societies. J. Insect Physiol. 2011, 58, 188–193. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pålsson-McDermott, E.M.; O’Neill, L.A.J. Targeting immunometabolism as an anti-inflammatory strategy. Cell Res. 2020, 30, 300–314. [Google Scholar] [CrossRef] [Scilit]
- Kaushik, D.K.; Thounaojam, M.C.; Mitra, A.; Basu, A. Vespa tropica venom suppresses lipopolysaccharide-mediated secretion of pro-inflammatory cyto-chemokines by abrogating nuclear factor-κ B activation in microglia. Inflamm. Res. 2014, 63, 657–665. [Google Scholar] [CrossRef] [Scilit]
- Saba, E.; Shafeeq, T.; Irfan, M.; Lee, Y.Y.; Kwon, H.W.; Seo, M.G.; Park, S.J.; Lee, K.Y.; Rhee, M.H. Anti-inflammatory activity of crude venom isolated from parasitoid wasp, Bracon hebetor Say. Mediat. Inflamm. 2017, 2017, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Danneels, E.L.; Rivers, D.B.; de Graaf, D.C. Venom proteins of the parasitoid wasp Nasonia vitripennis: Recent discovery of an untapped pharmacopee. Toxins 2010, 2, 494–516. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- De Castro e Silva, J.; Lopes do Couto, L.; de Oliveira Amaral, H.; Maria Medeiros Gomes, F.; Avohay Alves Campos, G.; Paulino Silva, L.; Renata Mortari, M. Neuropolybin: A new antiseizure peptide obtained from wasp venom. Biochem. Pharmacol. 2020, 181, 114119. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- De Azevedo, R.A.; Figueiredo, C.R.; Ferreira, A.K.; Matsuo, A.L.; Massaoka, M.H.; Girola, N.; Auada, A.V.; Farias, C.F.; Pasqualoto, K.F.; Rodrigues, C.P.; et al. Mastoparan induces apoptosis in B16F10-Nex2 melanoma cells via the intrinsic mitochondrial pathway and displays antitumor activity in vivo. Peptides 2015, 68, 113–119. [Google Scholar] [CrossRef] [Scilit]
- Hirai, Y.; Ueno, Y.; Yasuhara, T.; Yoshida, H.; Nakajima, T. A new mast cell degranulating peptide, polistes mastoparan, in the venom of Polistes jadwigae. Biomed. Res. 1980, 1, 185–187. [Google Scholar] [CrossRef] [Scilit]
- Da Silva, A.M.B.; Silva-Gonçalves, L.C.; Oliveira, F.A.; Arcisio-Miranda, M. Pronecrotic activity of cationic mastoparan peptides in human glioblastoma multiforme cells via membranolytic action. Mol. Neurobiol. 2018, 55, 5490–5504. [Google Scholar] [CrossRef] [Scilit]
- Vila-Farres, X.; Garcia de la Maria, C.; López-Rojas, R.; Pachón, J.; Giralt, E.; Vila, J. In vitro activity of several antimicrobial peptides against colistin-susceptible and colistin-resistant Acinetobacter baumannii. Clin. Microbiol. Infect. 2012, 18, 383–387. [Google Scholar] [CrossRef] [Scilit]
- Mizuno, K.; Nakahata, N.; Ohizumi, Y. Characterization of mastoparan-induced histamine release from RBL-2H3 cells. Toxicon 1998, 36, 447–456. [Google Scholar] [CrossRef] [Scilit]
- Yamada, Y.; Shinohara, Y.; Kakudo, T.; Chaki, S.; Futaki, S.; Kamiya, H.; Harashima, H. Mitochondrial delivery of mastoparan with transferrin liposomes equipped with a pH-sensitive fusogenic peptide for selective cancer therapy. Int. J. Pharm. 2005, 303, 1–7. [Google Scholar] [CrossRef] [Scilit]
- Nakahata, N.; Imata, K.; Okawa, T.; Watanabe, Y.; Ishimoto, H.; Ono, T.; Ohizumi, Y.; Nakanishi, H. Mastoparan elicits prostaglandin E 2 generation and inhibits inositol phosphate accumulation via different mechanisms in rabbit astrocytes Norimichi. Biochim. Biophys. Acta (BBA)—Molecular Cell Res. 1996, 1310, 60–66. [Google Scholar] [CrossRef] [Scilit]
- Irazazabal, L.N.; Porto, W.F.; Ribeiro, S.M.; Casale, S.; Humblot, V.; Ladram, A.; Franco, O.L. Selective amino acid substitution reduces cytotoxicity of the antimicrobial peptide mastoparan. Biochim. Biophys. Acta—Biomembr. 2016, 1858, 2699–2708. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- De Souza, B.M.; Cabrera, M.P.D.S.; Gomes, P.C.; Dias, N.B.; Stabeli, R.G.; Leite, N.B.; Neto, J.R.; Palma, M.S. Structure-activity relationship of mastoparan analogs: Effects of the number and positioning of Lys residues on secondary structure, interaction with membrane-mimetic systems and biological activity. Peptides 2015, 72, 164–174. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Galeane, M.C.; Gomes, P.C.; De L Singulani, J.; De Souza, B.M.; Palma, M.S.; Mendes-Giannini, M.J.S.; Almeida, A.M.F. Study of mastoparan analog peptides against Candida albicans and safety in zebrafish embryos (Danio rerio). Future Microbiol. 2019, 14, 1087–1097. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ha, Y.J.; Kim, S.W.; Lee, C.W.; Bae, C.H.; Yeo, J.H.; Kim, I.S.; Gal, S.W.; Hur, J.; Jung, H.K.; Kim, M.J.; et al. Anti-Salmonella activity modulation of mastoparan V1—A wasp venom toxin—Using protease inhibitors, and its efficient production via an Escherichia coli secretion system. Toxins 2017, 9, 321. [Google Scholar] [CrossRef] [Scilit]
- Ho, C.L.; Hwang, L.L. Structure and biological activities of a new mastoparan isolated from the venom of the hornet Vespa basalis. Biochem. J. 1991, 274, 453–456. [Google Scholar] [CrossRef] [Scilit]
- Ho, C.L.; Hwang, L.L.; Lin, Y.L.; Chen, C.T.; Yu, H.M.; Wang, K.T. Cardiovascular effects of mastoparan B and its structural requirements. Eur. J. Pharmacol. 1994, 259, 259–264. [Google Scholar] [PubMed]
- Park, N.G.; Yamato, Y.; Lee, S.; Sugihara, G. Interaction of mastoparan-B from venom of a hornet in taiwan with phospholipid bilayers and its antimicrobial activity. Biopolymers 1995, 36, 793–801. [Google Scholar] [CrossRef] [Scilit]
- Hirai, Y.; Yasuhara, T.; Yoshida, H.; Nakajima, T. A new mast cell degranulating peptide, mastoparan-M, in the venom of the hornet Vespa mandarinia. Biomed. Res. 1981, 2, 447–449. [Google Scholar] [CrossRef] [Scilit]
- Wu, T.M.; Chou, T.C.; Ding, Y.A.; Li, M.L. Stimulation of TNF-α, IL-1β and nitrite release from mouse cultured spleen cells and lavaged peritoneal cells by mastoparan M. Immunol. Cell Biol. 1999, 77, 476–482. [Google Scholar] [CrossRef] [Scilit]
- Li, M.; Liao, R.; Qiu, J.; Wang, Z.; Wu, T. Antimicrobial activity of synthetic all- D mastoparan M. Int. J. Antimicrob. Agents 2000, 13, 203–208. [Google Scholar] [CrossRef] [Scilit]
- Konno, K.; Hisada, M.; Fontana, R.; Lorenzi, C.C.B.; Naoki, H.; Itagaki, Y.; Miwa, A.; Kawai, N.; Nakata, Y.; Yasuhara, T.; et al. Anoplin, a novel antimicrobial peptide from the venom of the solitary wasp Anoplius samariensis. Biochim. Biophys. Acta—Protein Struct. Mol. Enzymol. 2001, 1550, 70–80. [Google Scholar] [CrossRef] [Scilit]
- Zhu, L.; Fu, C.; Zhang, S.; Chen, W.; Jin, Y. Novel cytotoxic exhibition mode of antimicrobial peptide anoplin in MEL cells, the cell line of murine Friend leukemia virus-induced leukemic cells. Pept. Sci. 2013, 19, 566–574. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ifrah, D.; Doisy, X.; Ryge, T.S.; Hansen, P.R. Structure-activity relationship study of anoplin. J. Pept. Sci. 2005, 11, 113–121. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Perez, M.; Santos, D.O.S.; Arcisio-miranda, M.; Broggio, T.; Ruggiero, R.; Ao, J.O. Study of the mechanism of action of anoplin, a helical antimicrobial decapeptide with ion channel-like activity, and the role of the amidated C -terminus. J. Pept. Sci. 2008, 661–669. [Google Scholar]
- Won, A.; Khan, M.; Gustin, S.; Akpawu, A.; Seebun, D.; Avis, T.J.; Leung, B.O.; Hitchcock, A.P.; Ianoul, A. Investigating the effects of L- to D-amino acid substitution and deamidation on the activity and membrane interactions of antimicrobial peptide anoplin. Biochim. Biophys. Acta—Biomembr. 2011, 1808, 1592–1600. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, Y.; Chen, J.; Zheng, X.; Yang, X.; Ma, P.; Cai, Y.; Zhang, B.; Chen, Y. Design of novel analogues of short antimicrobial peptide anoplin with improved antimicrobial activity. J. Pept. Sci. 2014, 20, 945–951. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Konno, K.; Rangel, M.; Oliveira, J.S.; dos Santos Cabrera, M.P.; Fontana, R.; Hirata, I.Y.; Hide, I.; Nakata, Y.; Mori, K.; Kawano, M.; et al. Decoralin, a novel linear cationic α-helical peptide from the venom of the solitary eumenine wasp Oreumenes decoratus. Peptides 2007, 28, 2320–2327. [Google Scholar] [CrossRef] [Scilit]
- Torres, M.D.T.; Andrade, G.P.; Sato, R.H.; Pedron, C.N.; Manieri, T.M.; Cerchiaro, G.; Ribeiro, A.O.; de la Fuente-Nunez, C.; Oliveira, V.X. Natural and redesigned wasp venom peptides with selective antitumoral activity. Beilstein J. Org. Chem. 2018, 14, 1693–1703. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Torres, M.D.T.; Pedron, C.N.; Araújo, I.; Silva, P.I.; Silva, F.D.; Oliveira, V.X. Decoralin analogs with increased resistance to degradation and lower hemolytic activity. ChemistrySelect 2017, 2, 18–23. [Google Scholar] [CrossRef] [Scilit]
- Torres, M.D.T.; Silva, A.F.; Pedron, C.N.; Capurro, M.L. Peptide design enables reengineering of an inactive wasp venom peptide into synthetic antiplasmodial agents. ChemistrySelect 2018, 3, 5859–5863. [Google Scholar] [CrossRef] [Scilit]
- Ribeiro, S.P.; Mendes, M.A.; Dos Santos, L.D.; De Souza, B.M.; Marques, M.R.; De Azevedo, W.F.; Palma, M.S. Structural and functional characterization of N-terminally blocked peptides isolated from the venom of the social wasp Polybia paulista. Peptides 2004, 25, 2069–2078. [Google Scholar] [CrossRef] [Scilit]
- Luong, H.X.; Kim, D.H.; Lee, B.J.; Kim, Y.W. Antimicrobial activity and stability of stapled helices of polybia-MP1. Arch. Pharm. Res. 2017, 40, 1414–1419. [Google Scholar] [CrossRef] [Scilit]
- Dos Santos Cabrera, M.P.; Arcisio-Miranda, M.; Gorjão, R.; Leite, N.B.; De Souza, B.M.; Curi, R.; Procopio, J.; Ruggiero Neto, J.; Palma, M.S. Influence of the bilayer composition on the binding and membrane disrupting effect of polybia-MP1, an antimicrobial mastoparan peptide with leukemic T-lymphocyte cell selectivity. Biochemistry 2012, 51, 4898–4908. [Google Scholar] [CrossRef] [Scilit]
- Brigatte, P.; Cury, Y.; De Souza, B.M.; Baptista-Saidemberg, N.B.; Saidemberg, D.M.; Gutierrez, V.P.; Palma, M.S. Hyperalgesic and edematogenic effects of peptides isolated from the venoms of honeybee (Apis mellifera) and neotropical social wasps (Polybia paulista and Protonectarina sylveirae). Amino Acids 2011, 40, 101–111. [Google Scholar] [CrossRef] [Scilit]
- De Souza, B.M.; Dos Santos Cabrera, M.P.; Neto, J.R.; Palma, M.S. Investigating the effect of different positioning of lysine residues along the peptide chain of mastoparans for their secondary structures and biological activities. Amino Acids 2011, 40, 77–90. [Google Scholar] [CrossRef] [Scilit]
- Wang, K.; Yan, J.; Dang, W.; Liu, X.; Chen, R.; Zhang, J.; Zhang, B.; Zhang, W.; Kai, M.; Yan, W.; et al. Membrane active antimicrobial activity and molecular dynamics study of a novel cationic antimicrobial peptide polybia-MPI, from the venom of Polybia paulista. Peptides 2013, 39, 80–88. [Google Scholar] [CrossRef] [Scilit]
- Wang, K.; Yan, J.; Dang, W.; Xie, J.; Yan, B.; Yan, W.; Sun, M.; Zhang, B.; Ma, M.; Zhao, Y.; et al. Dual antifungal properties of cationic antimicrobial peptides polybia-MPI: Membrane integrity disruption and inhibition of biofilm formation. Peptides 2014, 56, 22–29. [Google Scholar] [CrossRef] [Scilit]
- Wang, K.; Yan, J.; Chen, R.; Dang, W.; Zhang, B.; Zhang, W.; Song, J.; Wang, R. Membrane-active action mode of polybia-CP, a novel antimicrobial peptide isolated from the venom of Polybia paulista. Antimicrob. Agents Chemother. 2012, 56, 3318–3323. [Google Scholar] [CrossRef] [Scilit]
- Rangel, M.; Dos Santos Castro, F.F.; Mota-Lima, L.D.; Clissa, P.B.; Martins, D.B.; Dos Santos Cabrera, M.P.; Mortari, M.R. Polydim-I antimicrobial activity against MDR bacteria and its model membrane interaction. PLoS ONE 2017, 12, e0178785. [Google Scholar] [CrossRef] [Scilit]
- Mendes, M.A.; De Souza, B.M.; Marques, M.R.; Palma, M.S. Structural and biological characterization of two novel peptides from the venom of the neotropical social wasp Agelaia pallipes pallipes. Toxicon 2004, 44, 67–74. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, K.; Yan, J.; Chen, R.; Dang, W.; Zhang, B.; Zhang, W.; Song, J.; Wang, R.; Yan, J.; Chen, R.; et al. Membrane perturbation action mode and structure-activity relationships of protonectin, a novel antimicrobial peptide from the venom of the neotropical social wasp Agelaia pallipes pallipes. Antimicrob. Agents Chemother. 2013, 56, 4632–4639. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, F.; Manku, S.; Hall, D.G. Solid phase syntheses of polyamine toxins HO-416b and PhTX-433. Use of an efficient polyamide reduction strategy that facilitates access to branched analogues. Org. Lett. 2000, 2, 1581–1583. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Choi, S.K.; Kalivretenos, A.G.; Usherwood, P.N.R.; Nakanishi, K. Labeling studies of photolabile philanthotoxins with nicotinic acetylcholine receptors: Mode of interaction between toxin and receptor. Chem. Biol. 1995, 2, 23–32. [Google Scholar] [CrossRef] [Scilit]
- Kachel, H.S.; Franzyk, H.; Mellor, I.R. Philanthotoxin analogues that selectively inhibit ganglionic nicotinic acetylcholine receptors with exceptional potency. J. Med. Chem. 2019, 62, 6214–6222. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Crandall, Y.M.; Bruch, M.D. Characterization of the structure and dynamics of mastoparan-X during folding in a TFE by CD and NMR spectroscopy. Biopolymers 2007, 89, 197–209. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Henriksen, J.R.; Etzerodt, T.; Gjetting, T.; Andresen, T.L. Side chain hydrophobicity modulates therapeutic activity and membrane selectivity of antimicrobial peptide mastoparan-X. PLoS ONE 2014, 9, e91007. [Google Scholar] [CrossRef] [Scilit]
- Konno, K.; Hisada, M.; Naoki, H.; Itagaki, Y.; Kawai, N.; Miwa, A.; Yasuhara, T.; Morimoto, Y.; Nakata, Y. Structure and biological activities of eumenine mastoparan-AF (EMP-AF), a new mast cell degranulating peptide in the venom of the solitary wasp (Anterhynchium flavomarginatum micado). Toxicon 2000, 38, 1505–1515. [Google Scholar] [CrossRef] [Scilit]
- Ramon, R.; De Souza, B.M.; Havt, A.; Mario, S.; Pires, R.; Lins, E.; Albuquerque, D.; Nogueira, V.; Maria, A.; Martins, C. Trypanocidal activity of mastoparan from Polybia paulista wasp venom by interaction with TcGAPDH. Toxicon 2017, 137, 168–172. [Google Scholar]
- Xu, X.; Li, J.; Lu, Q.; Yang, H.; Zhang, Y.; Lai, R. Two families of antimicrobial peptides from wasp (Vespa magnifica) venom. Toxicon 2006, 47, 249–253. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hisada, M.; Konno, K.; Itagaki, Y.; Naoki, H.; Nakajima, T. Sequencing wasp venom peptides by endopeptidase digestion and nested collision-induced dissociation/post-source decay methods. Rapid Commun. Mass Spectrom. 2002, 16, 1040–1048. [Google Scholar] [CrossRef] [Scilit]
- Parkinson, N.; Smith, I.; Audsley, N.; Edwards, J. Purification of pimplin, a paralytic heterodimeric polypeptide from venom of the parasitoid wasp Pimpla hypochondriaca, and cloning of the cDNA encoding one of the subunits. Insect Biochem. Mol. Biol. 2002, 32, 1769–1773. [Google Scholar] [CrossRef] [Scilit]
- Hisada, M.; Konno, K.; Itagaki, Y.; Naoki, H.; Nakajima, T. Advantages of using nested collision induced dissociation/post-source decay with matrix-assisted laser desorption/ionization time-of-flight mass spectrometry: Sequencing of novel peptides from wasp venom. Rapid Commun. Mass Spectrom. 2000, 14, 1828–1834. [Google Scholar] [CrossRef] [Scilit]
- Pizzo, A.B.; Beleboni, R.O.; Gomes Carolino, R.O.; de Oliveira, L.; Miranda, A.; Coutinho-Netto, J.; Fontana, A.C.K.; dos Santos, W.F. Isolation and chemical characterization of agelaiatoxin8 (AvTx8) from Agelaia vicina wasp venom and its biological effects on GABA neurotransmission. J. Biochem. Mol. Toxicol. 2017, 31, e21941. [Google Scholar] [CrossRef] [Scilit]
- Baptista-Saidemberg, N.B.; Saidemberg, D.M.; Palma, M.S. Profiling the peptidome of the venom from the social wasp Agelaia pallipes pallipes. J. Proteom. 2011, 74, 2123–2137. [Google Scholar] [CrossRef] [Scilit]
- Konno, K.; Hisada, M.; Itagaki, Y.; Naoki, H.; Kawai, N.; Miwa, A.; Yasuhara, T.; Takayama, H. Isolation and structure of pompilidotoxins, novel peptide neurotoxins in solitary wasp venoms. Biochem. Biophys. Res. Commun. 1998, 250, 612–616. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Baptista-Saidemberg, N.B.; Saidemberg, D.M.; de Souza, B.M.; César-Tognoli, L.M.; Ferreira, V.M.; Mendes, M.A.; dos Santos Cabrera, M.P.; Neto, J.R.; Palma, M.S. Protonectin (1–6): A novel chemotactic peptide from the venom of the social wasp Agelaia pallipes pallipes. Toxicon 2010, 56, 880–889. [Google Scholar] [CrossRef] [Scilit]
- Murata, K.; Shinada, T.; Ohfune, Y.; Hisada, M.; Yasuda, A.; Naoki, H.; Nakajima, T. Novel mastoparan and protonectin analogs isolated from a solitary wasp, Orancistrocerus drewseni drewseni. Amino Acids 2009, 37, 389–394. [Google Scholar] [CrossRef] [Scilit]
- Gomes, P.C.; de Souza, B.M.; Dias, N.B.; Brigatte, P.; Mourelle, D.; Arcuri, H.A.; dos Santos Cabrera, M.P.; Stabeli, R.G.; Neto, J.R.; Palma, M.S. Structure–function relationships of the peptide paulistine: A novel toxin from the venom of the social wasp Polybia paulista. Biochim. Biophys. Acta (BBA)—Gen. Subj. 2014, 1840, 170–183. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Argiolas, A.; Pisano, J.J. Isolation and characterization of two new peptides, mastoparan C and crabrolin, from the venom of the European hornet, Vespa crabro. J. Biol. Chem. 1984, 259, 10106–10111. [Google Scholar] [CrossRef] [Scilit]
- Aschi, M.; Bozzi, A.; Luzi, C.; Bouchemal, N.; Sette, M. Crabrolin, a natural antimicrobial peptide: Structural properties. J. Pept. Sci. 2017, 23, 693–700. [Google Scholar] [CrossRef] [Scilit]
- Konno, K.; Hisada, M.; Naoki, H.; Itagaki, Y.; Fontana, R.; Rangel, M.; Oliveira, J.S.; dos Santos Cabrera, M.P.; Neto, J.R.; Hide, I.; et al. Eumenitin, a novel antimicrobial peptide from the venom of the solitary eumenine wasp Eumenes rubronotatus. Peptides 2006, 27, 2624–2631. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rangel, M.; dos Santos Cabrera, M.P.; Kazuma, K.; Ando, K.; Wang, X.; Kato, M.; Nihei, K.; Hirata, I.Y.; Cross, T.J.; Garcia, A.N.; et al. Chemical and biological characterization of four new linear cationic α-helical peptides from the venoms of two solitary eumenine wasps. Toxicon 2011, 57, 1081–1092. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Konno, K.; Kazuma, K.; Rangel, M.; Stolarz-de-Oliveira, J.; Fontana, R.; Kawano, M.; Fuchino, H.; Hide, I.; Yasuhara, T.; Nakata, Y. New mastoparan peptides in the venom of the solitary eumenine wasp Eumenes micado. Toxins 2019, 11, 155. [Google Scholar] [CrossRef] [Scilit]
- Dias, N.B.; De Souza, B.M.; Gomes, P.C.; Brigatte, P.; Palma, M.S. Peptidome profiling of venom from the social wasp Polybia paulista. Toxicon 2015, 107, 290–303. [Google Scholar] [CrossRef] [Scilit]
- Klochkov, S.G.; Pikhtelev, A.R.; Kozlovskii, V.I. A new peptide from venom of the East-European hornet Vespa orientalis. Mass spectrometric de novo sequence. Chem. Nat. Compd. 2008, 44, 63–66. [Google Scholar] [CrossRef] [Scilit]
- Dos Anjos, L.C.; Gomes, F.M.M.; Do Couto, L.L.; Mourão, C.A.; Moreira, K.G.; Silva, L.P.; Mortari, M.R. Anxiolytic activity and evaluation of potentially adverse effects of a bradykinin-related peptide isolated from a social wasp venom. Life Sci. 2016, 149, 153–159. [Google Scholar] [CrossRef] [Scilit]
- Andrew, K.; Kim, K.; Kim, A.; Han, Y.; Young, W. Selective anti-tumor activities of venom peptides from the lesser paper wasp Parapolybia varia. J. Asia. Pac. Entomol. 2016, 19, 821–828. [Google Scholar]
- Yu, H.; Yang, H.; Ma, D.; Lv, Y.; Liu, T.; Zhang, K.; Lai, R.; Liu, J. Vespid chemotactic peptide precursor from the wasp, Vespa magnifica (Smith). Toxicon 2007, 50, 377–382. [Google Scholar] [CrossRef] [Scilit]
- Zhou, Z. The first report of kininogen from invertebrates. Biochem. Biophys. Res. Commun. 2006, 347, 1099–1102. [Google Scholar] [CrossRef] [Scilit]
- Baek, J.H.; Lee, S.H. Isolation and molecular cloning of venom peptides from Orancistrocerus drewseni (Hymenoptera: Eumenidae). Toxicon 2010, 55, 711–718. [Google Scholar] [CrossRef] [Scilit]
- Baek, J.H.; Ji, Y.; Shin, J.S.; Lee, S.; Lee, S.H. Venom peptides from solitary hunting wasps induce feeding disorder in lepidopteran larvae. Peptides 2011, 32, 568–572. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ye, J.; Zhao, H.; Wang, H.; Bian, J.; Zheng, R. A defensin antimicrobial peptide from the venoms of Nasonia vitripennis. Toxicon 2010, 56, 101–106. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lopes, K.S.; Campos, G.A.A.; Camargo, L.C.; de Souza, A.C.B.; Ibituruna, B.V.; Magalhães, A.C.M.; da Rocha, L.F.; Garcia, A.B.; Rodrigues, M.C.; Ribeiro, D.M.; et al. Characterization of two peptides isolated from the venom of social wasp Chartergellus communis (Hymenoptera: Vespidae): Influence of multiple alanine residues and C-terminal amidation on biological effects. Peptides 2017, 95, 84–93. [Google Scholar] [CrossRef] [Scilit]
- Montana, V.; Sontheimer, H. Bradykinin promotes the chemotactic invasion of primary brain tumors. J. Neurosci. 2011, 31, 4858–4867. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yasuhara, T.; Mantel, P.; Nakajima, T.; Piek, T. Two kinins isolated from an extract of the venom reservoirs of the solitary wasp Megascolia flavifrons. Toxicon 1987, 25, 527–535. [Google Scholar] [CrossRef] [Scilit]
- Mortari, M.R.; Cunha, A.O.S.; Carolino, R.O.G.; Coutinho-Netto, J.; Tomaz, J.C.; Lopes, N.P.; Coimbra, N.C.; Dos Santos, W.F. Inhibition of acute nociceptive responses in rats after i.c.v. injection of Thr 6-bradykinin, isolated from the venom of the social wasp, Polybia occidentalis. Br. J. Pharmacol. 2007, 151, 860–869. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Picolo, G.; Hisada, M.; Moura, A.B.; Machado, M.F.M.; Sciani, J.M.; Conceição, I.M.; Melo, R.L.; Oliveira, V.; Lima-Landman, M.T.R.; Cury, Y.; et al. Bradykinin-related peptides in the venom of the solitary wasp Cyphononyx fulvognathus. Biochem. Pharmacol. 2010, 79, 478–486. [Google Scholar] [CrossRef] [Scilit]
- Silva, J.C.; Neto, L.M.; Neves, R.C.; Gonçalves, J.C.; Trentini, M.M.; Mucury-filho, R.; Smidt, K.S.; Fensterseifer, I.C.; Silva, O.N.; Lima, L.D.; et al. Evaluation of the antimicrobial activity of the mastoparan Polybia-MPII isolated from venom of the social wasp Pseudopolybia vespiceps testacea (Vespidae, Hymenoptera). Int. J. Antimicrob. Agents 2017, 49, 167–175. [Google Scholar] [CrossRef] [Scilit]
- Tuichibaev, M.U.; Tashmukhamedov, B.A. Lysophospholipase activity of orientotoxin from the venom of the hornet Vespa orientalis. Chem. Nat. Compd. 1996, 20, 765–766. [Google Scholar] [CrossRef] [Scilit]
- Tuĭchibaev, M.U.; Tashmukhamedov, B.A.; Gotgil’f, I.G.; Mazannik, L.G. Orientotoxin--a new presynaptic neurotoxin from the venom of the giant hornet Vespa orientalis. Bioorg. Khim. 1984, 10, 318–322. [Google Scholar] [PubMed]
- L’vov, V.M.; Kolmakova, A.A.; Akhunov, A.A.; Mukhamedov, I.F. Vasoactive peptides from venom of the hornet Vespa orientalis physiochemical and functional characterization. Chem. Nat. Compd. 1988, 24, 218–221. [Google Scholar] [CrossRef] [Scilit]
- Moore, E.L.; Arvidson, R.; Banks, C.; Urenda, J.P.; Duong, E.; Mohammed, H.; Adams, M.E. Ampulexins: A new family of peptides in venom of the emerald jewel wasp, Ampulex compressa. Biochemistry 2018, 57, 1907–1916. [Google Scholar] [CrossRef] [Scilit]
- Turillazzi, S.; Mastrobuoni, G.; Dani, F.R.; Moneti, G.; Pieraccini, G.; La Marca, G.; Bartolucci, G.; Perito, B.; Lambardi, D.; Cavallini, V.; et al. Dominulin A and B: Two new antibacterial peptides identified on the cuticle and in the venom of the social paper wasp Polistes dominulus using MALDI-TOF, MALDI-TOF/TOF, and ESI-ion trap. J. Am. Soc. Mass Spectrom. 2006, 17, 376–383. [Google Scholar] [CrossRef] [Scilit]
- Mendes, M.A.; Palma, M.S. Two new bradykinin-related peptides from the venom of the social wasp Protopolybia exigua (Saussure). Peptides 2006, 27, 2632–2639. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ombati, R.; Wang, Y.; Du, C.; Lu, X.; Li, B.; Nyachieo, A.; Li, Y.; Yang, S.; Lai, R. A membrane disrupting toxin from wasp venom underlies the molecular mechanism of tissue damage. Toxicon 2018, 148, 56–63. [Google Scholar] [CrossRef] [Scilit]
- Yshii, L.M.; Souza, G.H.M.F.; Camargo, E.A.; Eberlin, M.N.; Ribela, M.T.C.P.; Muscará, M.N.; Hyslop, S.; Costa, S.K.P. Characterization of the mechanisms underlying the inflammatory response to Polistes lanio lanio (paper wasp) venom in mouse dorsal skin. Toxicon 2009, 53, 42–52. [Google Scholar] [CrossRef] [Scilit]
- Zhou, S.T.; Luan, K.; Ni, L.L.; Wang, Y.; Yuan, S.M.; Che, Y.H.; Yang, Z.Z.; Zhang, C.G.; Yang, Z. Bin A strategy for quality control of vespa magnifica (Smith) venom based on HPLC fingerprint analysis and multi-component separation combined with quantitative analysis. Molecules 2019, 24, 2920. [Google Scholar] [CrossRef] [Scilit]
- Hernández, C.; Konno, K.; Salceda, E.; Vega, R.; Zaharenko, A.J.; Soto, E. Sa12b peptide from solitary wasp inhibits ASIC currents in rat dorsal root ganglion neurons. Toxins 2019, 11, 585. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Freire, D.O.; da Cunha, N.B.; Leite, M.L.; Kostopoulos, A.G.C.; da Silva, S.N.B.; de Souza, A.C.B.; Nolasco, D.O.; Franco, O.L.; Mortari, M.R.; Dias, S.C. Wasp venom peptide, synoeca-MP, from Synoeca surinama shows antimicrobial activity against human and animal pathogenic microorganisms. Pept. Sci. 2020, 112, e24141. [Google Scholar] [CrossRef] [Scilit]
- Yang, H.; Xu, X.; Ma, D.; Zhang, K.; Lai, R. A phospholipase A1 platelet activator from the wasp venom of Vespa magnifica (Smith). Toxicon 2008, 51, 289–296. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Santos, L.D.; Santos, K.S.; de Souza, B.M.; Arcuri, H.A.; Cunha-Neto, E.; Castro, F.M.; Kalil, J.E.; Palma, M.S. Purification, sequencing and structural characterization of the phospholipase A1 from the venom of the social wasp Polybia paulista (Hymenoptera, Vespidae). Toxicon 2007, 50, 923–937. [Google Scholar] [CrossRef] [Scilit]
- Aoki, J.; Inoue, A.; Makide, K.; Saiki, N.; Arai, H. Structure and function of extracellular phospholipase A1 belonging to the pancreatic lipase gene family. Biochimie 2007, 89, 197–204. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, N.-Y.; Xu, Z.-W.; Yan, W.; Ren, X.-M.; Zhang, Z.-Q.; Zhu, J.-Y. Venomics reveals novel ion transport peptide-likes (ITPLs) from the parasitoid wasp Tetrastichus brontispae. Toxicon 2018, 141, 88–93. [Google Scholar] [CrossRef] [Scilit]
- De Oliveira, M.R.; Palma, M.S. Polybitoxins: A group of phospholipases A2 from the venom of the neotropical social wasp paulistinha (Polybia paulista). Toxicon 1998, 36, 189–199. [Google Scholar] [CrossRef] [Scilit]
- Mueller, U.; Elliott, W.; Reisman, R.; Ishay, J.; Walsh, S.; Steger, R.; Wypych, J.; Arbesman, C. Comparison of biochemical and immunologic properties of venoms from four hornet species. J. Allergy Clin. Immunol. 1981, 67, 290–298. [Google Scholar] [CrossRef] [Scilit]
- Allalouf, D.; Ber, A.; Ishay, J. Hyaluronidase activity of extracts of venom sacs of a number of vespinae (Hymenoptera). Comp. Biochem. Physiol.—Part B Biochem. 1972, 43, 119–123. [Google Scholar] [CrossRef] [Scilit]
- Rungsa, P.; Incamnoi, P.; Sukprasert, S.; Uawonggul, N.; Klaynongsruang, S.; Daduang, J.; Patramanon, R.; Roytrakul, S.; Daduang, S. Cloning, structural modelling and characterization of VesT2s, a wasp venom hyaluronidase (HAase) from Vespa tropica. J. Venom. Anim. Toxins Incl. Trop. Dis. 2016, 22, 1–11. [Google Scholar] [CrossRef] [Scilit]
- Bernheimer, A.W.; Avigad, L.S.; Schmidt, J.O.; Ishay, J.S. Proteins in venoms of two wasps, Polistes comanchus navajoe and Vespa orientalis. Comp. Biochem. Physiol. Part C Comp. Pharmacol. 1982, 71, 203–207. [Google Scholar] [CrossRef] [Scilit]
- Arcuri, H.A.; Kalil, J.E.; Palma, M.S. Using proteomic strategies for sequencing and post-translational modifications assignment of antigen-5, a major allergen from the venom of the social wasp Polybia paulista. J. Proteome Res. 2013, 13, 855–865. [Google Scholar]
- Yamamoto, T.; Arimoto, H.; Kinumi, T.; Oba, Y.; Uemura, D. Identification of proteins from venom of the paralytic spider wasp, Cyphononyx dorsalis. Insect Biochem. Mol. Biol. 2007, 37, 278–286. [Google Scholar] [CrossRef] [Scilit]
- Wu, M.; Ye, G.; Zhu, J.; Chen, X.; Hu, C. Isolation and characterization of an immunosuppressive protein from venom of the pupa-specific endoparasitoid Pteromalus puparum. J. Invertebr. Pathol. 2008, 99, 186–191. [Google Scholar] [CrossRef] [Scilit]
- Asgari, S.; Zareie, R.; Zhang, G.; Schmidt, O. Isolation and characterization of a novel venom protein from an endoparasitoid, Cotesia rubecula (Hym: Braconidae). Arch. Insect Biochem. Physiol. 2003, 53, 92–100. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Han, J.; You, D.; Xu, X.; Han, W.; Lu, Y.; Lai, R.; Meng, Q. An anticoagulant serine protease from the wasp venom of Vespa magnifica. Toxicon 2008, 51, 914–922. [Google Scholar] [CrossRef] [Scilit]
- Thiéry, D.; Bonnard, O.; Riquier, L.; De Revel, G.; Monceau, K. An alarm pheromone in the venom gland of Vespa velutina: Evidence revisited from the European invasive population. Entomol. Gen. 2018, 38, 145–156. [Google Scholar] [CrossRef] [Scilit]
- Elmquist, D.C.; Landolt, P.J.; Cooper, W.R.; Reed, H.; Foutz, J.; Clepper, T.; Kacprzyk, B.; Teig, D.; Zack, R.S. The venom compound N-(3-methylbutyl) acetamide attracts several Polistes (Fuscopolistes) Species (Hymenoptera: Vespidae). J. Econ. Entomol. 2020, 113, 1073–1079. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dani, F.R.; Jeanne, R.L.; Clarke, S.R.; Jones, G.R.; Morgan, E.D.; Francke, W.; Turillazzi, S. Chemical characterization of the alarm pheromone in the venom of Polybia occidentalis and of volatiles from the venom of P. sericea. Physiol. Entomol. 2000, 25, 363–369. [Google Scholar] [CrossRef] [Scilit]
- Lateef, A.; Ojo, S.A.; Elegbede, J.A. The emerging roles of arthropods and their metabolites in the green synthesis of metallic nanoparticles. Nanotechnol. Rev. 2016, 5, 601–622. [Google Scholar] [CrossRef] [Scilit]
- Lateef, A.; Akande, M.A.; Ojo, S.A.; Folarin, B.I.; Gueguim-Kana, E.B.; Beukes, L.S. Paper wasp nest-mediated biosynthesis of silver nanoparticles for antimicrobial, catalytic, anticoagulant, and thrombolytic applications. 3 Biotech 2016, 6, 140. [Google Scholar] [CrossRef] [Scilit]
- Chugh, A.; Eudes, F.; Shim, Y. Cell-penetrating peptides: Nanocarrier for macromolecule delivery in living cells. IUBMB Life 2010, 62, 183–193. [Google Scholar] [CrossRef] [Scilit]
- Zhang, C.; Ren, W.; Liu, Q.; Tan, Z.; Li, J.; Tong, C. Transportan-derived cell-penetrating peptide delivers siRNA to inhibit replication of influenza virus in vivo. Drug Des. Devel. Ther. 2019, 13, 1059. [Google Scholar] [CrossRef] [Scilit]
- Schiener, M.; Graessel, A.; Ollert, M.; Schmidt-Weber, C.B.; Blank, S. Allergen-specific immunotherapy of Hymenoptera venom allergy–also a matter of diagnosis. Hum. Vaccines Immunother. 2017, 13, 2467–2481. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chai, L.; Yang, X.; Liu, M.; Liu, C.; Han, L.; Guo, H.; Li, C.; Sun, Y.; Li, X.; Xiao, M.; et al. Biopanning of allergens from wasp sting patients. Biosci. Rep. 2018, 38, BSR20181113–BSR20181129. [Google Scholar] [CrossRef] [Scilit]
- Lâm, H.T.; Ekerljung, L.; Bjerg, A.; Vən Tuòng, N.; Lundbäck, B.; Rönmark, E. Sensitization to airborne allergens among adults and its impact on allergic symptoms: A population survey in northern Vietnam. Clin. Transl. Allergy 2014, 4, 6. [Google Scholar] [CrossRef] [Scilit]
- Charpin, D.; Birnbaum, J.; Vervloet, D. Epidemiology of Hymenoptera allergy. Clin. Exp. Allergy 1994, 24, 1010–1015. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Boz, C.; Velioglu, S.; Ozmenoglu, M. Acute disseminated encephalomyelitis after bee sting. Neurol. Sci. 2003, 23, 313–315. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bonifazi, F.; Jutel, M.; Biló, B.M.; Birnbaum, J.; Muller, U. Prevention and treatment of hymenoptera venom allergy: Guidelines for clinical practice. Allergy 2005, 60, 1459–1470. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bilo, F.; Bonifazi, B.M. Epidemiology of insect venom anaphylaxis. Curr. Opin. Allergy Clin. Immunol. 2008, 8, 330–337. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hoffman, D.R. Allergens in Hymenoptera venom XV: The immunologic basis of vespid venom cross-reactivity. J. Allergy Clin. Immunol. 1985, 75, 611–613. [Google Scholar] [CrossRef] [Scilit]
- Bilo, B.M.; Rueff, F.; Mosbech, H.; Bonifazi, F.; Oude-Elberink, J.N.G.; Hypersensitivity, E.I.G. on I.V. Diagnosis of Hymenoptera venom allergy. Allergy 2005, 60, 1339–1349. [Google Scholar] [CrossRef] [Scilit]
- An, S.; Chen, L.; Wei, J.-F.; Yang, X.; Ma, D.; Xu, X.; Xu, X.; He, S.; Lu, J.; Lai, R. Purification and characterization of two new allergens from the venom of Vespa magnifica. PLoS ONE 2012, 7, e31920–e31926. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bazon, M.L.; Silveira, L.H.; Simioni, P.U.; Brochetto-Braga, M.R. Current advances in immunological studies on the vespidae venom antigen 5: Therapeutic and prophylaxis to hypersensitivity responses. Toxins 2018, 10, 305. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bazon, M.L.; Perez-Riverol, A.; Dos Santos-Pinto, J.R.A.; Fernandes, L.G.R.; Lasa, A.M.; Justo-Jacomini, D.L.; Palma, M.S.; De Lima Zollner, R.; Brochetto-Braga, M.R. Heterologous expression, purification and immunoreactivity of the antigen 5 from Polybia paulista wasp venom. Toxins 2017, 9, 259. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dos Santos, L.D.; Santos, K.S.; Pinto, J.R.A.; Dias, N.B.; De Souza, B.M.; Dos Santos, M.F.; Perales, J.; Domont, G.B.; Castro, F.M.; Kalil, J.E.; et al. Profiling the proteome of the venom from the social wasp Polybia paulista: A clue to understand the envenoming mechanism. J. Proteome Res. 2010, 9, 3867–3877. [Google Scholar] [CrossRef] [Scilit]
- Peternelj, A.; Silar, M.; Bajrovic, N.; Adamic, K.; Music, E.; Kosnik, M.; Korosec, P. Diagnosis of venom allergy by flow cytometry. Correction with clinical history, skin tests, specific IgE, histamine and leukotriene C4 release. Clin. Exp. Allergy 2000, 30, 1166–1171. [Google Scholar]
- Eberlein, B.; Krischan, L.; Darsow, U.; Ollert, M.; Ring, J. Double positivity to bee and wasp venom: Improved diagnostic procedure by recombinant allergen-based IgE testing and basophil activation test including data about cross-reactive carbohydrate determinants. J. Allergy Clin. Immunol. 2012, 130, 155–161. [Google Scholar] [CrossRef] [Scilit]
- Gattinger, P.; Lupinek, C.; Kalogiros, L.; Silar, M.; Zidarn, M.; Korosec, P.; Koessler, C.; Novak, N.; Valenta, R.; Mittermann, I. The culprit insect but not severity of allergic reactions to bee and wasp venom can be determined by molecular diagnosis. PLoS ONE 2018, 13, e0199250. [Google Scholar] [CrossRef] [Scilit]
- Peternelj, A.; Silar, M.; Bajrovic, N.; Adamic, K.; Music, E.; Kosnik, M.; Korosec, P. Diagnostic value of the basophil activation test in evaluating Hymenoptera venom sensitization. Wien. Klin. Wochenschr. 2009, 12, 334–348. [Google Scholar] [CrossRef] [Scilit]
- Sturm, G.J.; Heinemann, A.; Schuster, C.; Wiednig, M.; Groselj-Strele, A.; Sturm, E.M.; Aberer, W. Ifluence of total IgE levels on severity on sting reactions in hymenoptera venom allergy. Allergy 2007, 62, 884–889. [Google Scholar] [CrossRef] [Scilit]
- Balzer, L.; Pennino, D.; Blank, S.; Seismann, H.; Darsow, U.; Schnedler, M.; McIntyre, M.; Ollert, M.W.; Durham, S.R.; Spillner, E.; et al. Basophil activation test using recombinant allergens: Highly specific diagnostic method complementing routine tests in wasp venom allergy. PLoS ONE 2014, 9, e108619. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Tomsitz, D.; Brockow, K. Component resolved diagnosis in Hymenoptera anaphylaxis. Curr. Allergy Asthma Rep. 2017, 17, 38–46. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Perez-Riverol, A.; Musacchio-Lasa, A.; Fernandes, L.G.R.; dos Santos-Pinto, J.R.A.; Esteves, F.G.; Bazon, M.L.; de Lima Zollner, R.; Palma, M.S.; Brochetto-Braga, M.R. Improved production of the recombinant phospholipase A1 from Polybia paulista wasp venom expressed in bacterial cells for use in routine diagnostics. 3 Biotech 2020, 10, 217–228. [Google Scholar] [CrossRef] [Scilit]
- Kołaczek, A.; Skorupa, D.; Antczak-Marczak, M.; Kuna, P.; Kupczyk, M. Safety and efficacy of venom immunotherapy: A real life study. Postep. Dermatol. Alergol. 2017, 34, 159–167. [Google Scholar] [CrossRef] [Scilit]
- Köhli-Wiesner, A.; Stahlberger, L.; Bieli, C.; Stricker, T.; Lauener, R. Induction of specific immunotherapy with hymenoptera venoms using ultrarush regimen in children: Safety and tolerance. J. Allergy 2011, 2012, 1–5. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Perez-Riverol, A.; Fernandes, L.G.R.; Musacchio Lasa, A.; dos Santos-Pinto, J.R.A.; Moitinho Abram, D.; Izuka Moraes, G.H.; Jabs, F.; Miehe, M.; Seismman, H.; Palma, M.S.; et al. Phospholipase A1-based cross-reactivity among venoms of clinically relevant Hymenoptera from Neotropical and temperate regions. Mol. Immunol. 2018, 93, 87–93. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jappe, U.; Raulf-Heimsoth, M.; Hoffmann, M.; Burow, G.; Hübsch-Müller, C.; Enk, A. In vitro hymenoptera venom allergy diagnosis: Improved by screening for cross-reactive carbohydrate determinants and reciprocal inhibition. Allergy 2006, 61, 1220–1229. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Schiener, M.; Eberlein, B.; Moreno-Aguilar, C.; Pietsch, G.; Serrano, P.; McIntyre, M.; Schwarze, L.; Russkamp, D.; Biedermann, T.; Spillner, E.; et al. Application of recombinant antigen 5 allergens from seven allergy-relevant Hymenoptera species in diagnostics. Allergy Eur. J. Allergy Clin. Immunol. 2017, 72, 98–108. [Google Scholar] [CrossRef] [Scilit]
- Holt, P.G.; Macaubas, C.; Stumbles, P.A.; Sly, P.D. The role of allergy in the development of asthma. Nature 1999, 402, 12–17. [Google Scholar] [CrossRef] [Scilit]
- Seyfarth, F.; Schliemann, S. Diagnostic precision of component-resolved vs. extract-based in vitro diagnosis of Hymenoptera venom allergy: Effects on clinical management. J. Ger. Soc. Dermatol. 2017, 15, 507–515. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yoshida, N.; Hirata, H.; Watanabe, M.; Sugiyama, K.; Arima, M.; Fukushima, Y.; Ishii, Y. Improved sensitivity to venom specific-immunoglobulin E by spiking with the allergen component in Japanese patients suspected of Hymenoptera venom allergy. Allergol. Int. 2015, 64, 248–252. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mosbech, H.; Malling, H.; Biering, I.; Böwadt, H.; Søborg, M.; Weeke, B.; Løwenstein, H. Immunotherapy with yellow jacket venom: A comparative study including three different extracts, one adsorbed to aluminium hydroxide and two unmodified. Allergy 1986, 41, 95–103. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bilò, M.B.; Antonicelli, L.; Bonifazi, F. Purified vs. nonpurified venom immunotherapy. Curr. Opin. Allergy Clin. Immunol. 2010, 10, 330–336. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11029 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11028 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11030 (accessed on 19 January 2021).
- Drug Bank. Available online: https://go.drugbank.com/drugs/DB10959 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11033 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10957 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10958 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11031 (accessed on 19 January 2021).
- Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10956 (accessed on 19 January 2021).


| Wasp-Scientific Name | Isolated Compounds | Biological Activity | Reference |
|---|---|---|---|
| Peptides | |||
| Vespa xanthoptera Vespula lewisii | Mastoparan (MPX) (INWKGIAAMAKKLL-NH2) | Cytotoxic against Glioblastoma multiforme (T98G) cell, 60% inhibition at 20 μmol/L (in vitro) Anti-Escherichia coli and anti-Lactococcus lactis at MIC 8, and 2.5 µM, respectively (in vitro). | [40,79,80] |
| Anterhynchium flavomarginatum micado | Mastoparan-AF (EMP-AF) (INLLKIAKGIIKSL-NH2) | Blocked lobster neuromuscular transmission. Mediated depolarization of the muscle membrane, often leading to a weak contraction of the muscle at 0.1 ± 1 mM (in vitro). | [1,81] |
| V. lewisii, Vespa tropica and Polybia paulista | Mastoparan (INLKALAALAKKIL) | Induces apoptosis in B16F10-Nex2 melanoma cells treated with 165 µM. Potent anti-inflammatory. Shows activity against colistin-susceptible Acinetobacter baumannii and colistin-resistant Acinetobacter baumannii at MIC50 value of 4, and 8 mg/l, respectively. Antimicrobial activity on the epimastigote, trypomastigote and amastigote forms of Trypanosoma cruzi Y strain via dose-dependent growth inhibition (in vitro). | [38,41,82] |
| Vespa basalis | Mastoparan B (LKLKSIVSWAKKVL) | Anti-Enterococcus faecalis and anti-Bucillus subtilis at MIC of 3.13 mg/mL (in vitro). | [51] |
| V. basalis | Mastoparan-I1 (INLKAIAALVKKVL) | ND | [51] |
| V. basalis | Mastoparan-A (IKWKAILDAVKKVI) | ND | [51] |
| V. basalis | Mastoparan-T (INLKAIAAFAKKLL) | ND | [51] |
| Vespula vulgaris | Mastoparan V1 (INWKKIKSIIKAAMN) | Potent antimicrobial activity against Streptococcus mutans and Salmonella enterica at 50 µM (in vitro). | [4] |
| Vespa orientalis L. | Mastoparan (HRI) (INLKAIAALVKKVL-NH2) | Cytotoxic towards T98G cells and give 80% inhibition at 20 μmol/L (in vitro). | [40] |
| Vespa crabro | Mastoparan-C (MP-C) (LNLKALLAVAKKIL-NH2) | Inhibition of the biofilm formation by Staphylococcus Aureus and Pseudomonas aeruginosa at 32 μM MBIC (in vitro). | [26] |
| V. tropica | Mastoparan-VT1 (INLKAIAALAKKLL) | Anti-E. faecalis at 2.5 µg/mL (in vitro). | [30] |
| V. tropica | Mastoparan-VT2 (NLKAIAALAKKLL) | Anti-E. faecalis, anti-E.coli and anti-S.aureus at 5 µg/mL (in vitro). | [30] |
| V. tropica | Mastoparan-VT3 (INLKAITALAKKLL) | Anti-S. aureus and anti-Candida parapsilosis at 2.5 µg/mL (in vitro). | [30] |
| V. tropica | Mastoparan-VT4 (INLKAIAPLAKKLL) | Anti-Bacillus pyocyaneus, anti-P. aeruginosa, and anti-Bacillus dysenteriae at 10 µg/mL (in vitro). | [30] |
| V. tropica | Mastoparan-VT5 (VIVKAIATLASKLL) | Anti-Candida albicans at 40 µg/mL (in vitro). | [30] |
| V.tropica | Mastoparan-VT6 (INLKAIAALVKKLL) | Anti-S. aureus and anti-B. dysenteriae at 20 µg/mL (in vitro). | [30] |
| V. tropica | Mastoparan-VT7 (INLKAIAALARNY) | Anti-E. faecalis at 5 µg/mL (in vitro). | [30] |
| Polistes rothneyi iwatai | Polistes-mastoparan-R1 (Pm-R1) (INWLKLGKKILGAI-NH2) | Has histamine-releasing activities from rat mast cells (EC50 = 0.09 µM) (in vitro). | [80] |
| P. rothneyi iwatai. | Polistes-mastoparan-R3 (Pm-R3) (INWLKLGKQILGAL-NH2) | Has histamine-releasing activities from rat mast cells (EC50 = 0.19 mM) (in vitro). | [80] |
| Vespa magnifica | Peptide 5e (FLPIIAKLLGLL) | Anti-S. aureus, MIC = 5 µg/mL (in vitro). | [83] |
| V. magnifica | Peptide 5f (FLPIPRPILLGLL) | Anti-S. aureus, MIC = 10 µg/mL (in vitro). | [83] |
| V. magnifica | Peptide 5g (FLIIRRPIVLGLL) | Anti-S. aureus MIC = 10 µg/mL (in vitro). | [83] |
| V. magnifica | Peptide 12a (INWKGIAAMAKKLL) | Anti-S. Aureus, and anti-C. albicans at MIC = 3.7 µg/mL (in vitro). | [83] |
| V. magnifica | Peptide 12b (INWKGIAAMKKLL) | Anti-S. aureus MIC = 3.7 µg/mL (in vitro). | [83] |
| P. dimorpha | Polydim-I (AVAGEKLWLLPHLLKMLLTPTP) | Antimycobacterial activity at 7.6 μg/mL (in vitro). Anti-S. aureus at MIC50 4.1 µg/mL (in vitro). | [15,73] |
| Anoplus samariensis | As-126 (EDPPVVKMK-NH2) | ND | [84] |
| Batozonellus maculifrons | Bm-10 (ETAPVPKAISK-NH2) | ND | [84] |
| A. samariensis | Anoplin (GLLKRIKTLL-NH2) | Cytotoxic for T98G cells, gives 10% inhibition at 20 μmol/L (in vitro). | [40,55] |
| P. hypochondriaca | Pimplin (KRKPPRPNPKPKPIP) | Effective against Musca domestica at dose of 40 ng (in vitro). | [85] |
| A. flavomarginatum micado | Af-113 (INLLKIAKGIIKSLNH2) | ND | [86] |
| Agelaia vicina | Agelaiatoxin-8 (AVTx8) (INWKLGKALNALLNH2) | Inhibits gamma-aminobutyric acid (GABA) neurotransmission uptake at EC50 value of 0.09 ± 0.04 µM and maximum inhibition of 97 ± 5% (in vitro). | [87] |
| Agelaia pallipes pallipes | AgelaiaMP-I (INWLKLGKAIIDAL-NH2) | Has hemolytic activity at ED50 = 60 µM. | [28] |
| A. pallipes pallipes | AgelaiaMP-II (INWKAILQRIKKML-NH2) | Has hemolytic activity at ED50 = 240 µM (in vitro). | [88] |
| Anoplius samariensis, and Batozonellus maculifrons | Pompilidotoxins (α-PMTXs) (RIKIGLFDQLSKL-NH2) | Facilitates synaptic transfer in the motor neuron of the lobster and delays downregulation of the sodium channel (in vitro). | [89] |
| A. samariensis, and B. maculifrons | β-PMTXs (RIKIGLFDQRSKL-NH2) | Facilitates synaptic transfer in the neuromuscular junction of the lobster, and slows the sodium channel inactivation (in vitro). | [89] |
| A. flavomarginatum micado | Eumenine mastoparan-AF (EMP-AF) (INLLKIAKGIIKSL-NH2) | Effective hemolytic response in human erythrocytes. Enhancing degranulation of rat peritoneal mast cells and RBL-2H3 cells (in vitro). | [81] |
| Agelaia pallipes pallipes, and Protonectarina sylveirae | Protonectin (ILGTILGLLKGL-NH2) | Antibacterial activity towards Gram-positive and Gram-negative bacteria. Releasing Lactate dehydrogenase (LDH) from mast cells. Chemotaxis against polymorphonuclear leukocytes (PMNL) (in vitro). | ([90] |
| A. pallipes pallipes, and P. sylveirae | Protonectin (1–6) (ILGTIL-NH2) | ND | [90] |
| A. pallipes pallipes | Protonectin (1–4)-OH (ILGT-OH) | Has poor hemolytic activity at ED50 = 1 mM (in vitro). | [88] |
| A. pallipes pallipes | Protonectin (7–12) (GLLKGL-NH2) | ND | [88] |
| A. pallipes pallipes | Protonectin (1–5)-OH (ILGTI-OH) | Has weak hemolytic activity at ED50 = 1 mM (in vitro). | [88] |
| A. pallipes pallipes | Protonectin (1–6)-OH (ILGTIL-OH) | Has poor hemolytic activity at ED50 = 1 mM (in vitro). | [88] |
| Orancistrocerus drewseni | Orancis-protonectin (ILGIITSLLKSL-NH2) | Has hemolytic activity of the sheep blood cells at 50 µM (in vitro). | [91] |
| A. pallipes pallipes | Pallipine-I (GIIDDQQCKKKPGQSSPVCS-OH) | ND | [88] |
| A. pallipes pallipes | Pallipine-II (SIKHKICKLLERTLKLTT PFC-NH2) | ND | [88] |
| A. pallipes pallipes | Pallipine-III (SIKKHKCIALLERRGGSKLPFC-NH2) | ND | [88] |
| P. paulista | Paulistine (SIKDKICKIIQCGKKLPFT-NH2) (oxidized form) | Causes mast cells degranulation or hemolysis (in vitro). | [92] |
| Vespa mandarinia | Ves-CP-M (FLPILGKLLSGL-NH2) | ND | [65] |
| V. xanthoptera | Ves-CP-X (FLPIIAKLLGGLL) | ND | [65] |
| Paravespula lewisi | Ves-CP-P (FLPIIAKLVSGLL) | ND | [65] |
| V. tropica | Ves-CP-T (FLPILGKILGGLL) | ND | [65] |
| V. crabro | Crabrolin (FLPLILRKIVTAL-NH2) | Releases histamine from rat peritoneal mast cells at ED50 of 11.8 µg/mL (in vitro). | [93,94] |
| Eumenes rubronotatus | Eumenitin (LNLKGIFKKVASLLT) | Shows antimicrobial activity against S. aureus, Staphylococcus saprophytius, E. coli at MIC = 6 µM (in vitro). | [95] |
| E. rubrofemoratus | Eumenine mastoparan-ER (EMP-ER) (FDIMGLIKKVAGAL-NH2) | Anti-C. albicans at MIC 7.5 µM. Has Leishmanicidal activity at IC50 20 µM (in vitro). | [96] |
| Eumenes micado | Eumenine mastoparan-EM1 (LKLMGIVKKVLGAL-NH2) | Anti-S. aureus and anti-E. coli at MIC 7 µM (in vitro). Has Leishmanicidal activity with an IC50 of 36 µM (in vitro). | [97] |
| E. micado | Eumenine mastoparan-EM2 (LKLLGIVKKVLGAI-NH2) | Anti-S. aureus and anti-E. coli at MIC of 3 µM (in vitro). Has Leishmanicidal activity with an IC50 of 36 µM (in vitro). | [97] |
| Eumenes fraterculus | Eumenine mastoparan-EF (EMP-EF) (FDVMGIIKKIASALNH2 | Anti-C. albicans at MIC of 7.5 µM. Has Leishmanicidal behavior at IC50 of 40 µM (in vitro). | [96] |
| O. drewseni | Eumenine mastoparan-OD (EMP-OD) (GRILSFIKGLAEHL-NH2) | Induces hemolysis of the sheep blood cells at 50 µM (in vitro). | [91] |
| E. rubrofemoratus | Eumenitin-R (LNLKGLIKKVASLLN) | Anti-Sreptococcus pyogenes, anti-Micrococcus luteus, and anti-Stenotrophomonas maltophilia at MIC of 15 µM. Anti-B. subtilis at MIC 7.5 µM (in vitro). | [96] |
| E. fraterculus | Eumenitin-F (LNLKGLFKKVASLLT) | Anti-C. albicans at MIC of 7.5 µM. Has Leishmanicidal activity at IC50 of 52 µM (in vitro). Anti-S. maltophilia at MIC of 15 µM (in vitro). | [96] |
| P. paulista. | Polybia-CP (ILGTILGLLKSL-NH2) | Anti-microbial against S. aureus and B. subtilis at 15 µg/mL compared with 0.5 and 18 µg/mL of tetracycline (in vitro). | [14,65] |
| P. paulista | Polybia-CP 2 (ILGTILGKIL-OH) | Has chemotaxis, mast cell degranulation, and hemolytic activities (in vivo). | [98] |
| Polybia-CP 3 (ILGTILGTFKSL-NH2) | Has chemotaxis, mast cell degranulation, and hemolytic activities (in vivo). Antiplasmodial and anticancer properties (in vitro). | [8,98] | |
| P. paulista | Polybia-MP1 (IDWKKLLDAAKQIL-NH2) | Antitumor against bladder and prostate cancer cells. Exhibits potent activity against S. aureus, MIC of 9 µΜ (in vitro). Anti-C. albicans (EC50 = 12.9 μM) and C. neoformans (EC50 = 11 μM) (in vitro). Fungicidal activity against Candida glabrata (EC50 = 8 μM) and C. albicans (EC50 = 16 μM) (in vitro). Anti-E. coli, P. aeruginosa, B. subtilis, and S. aureus at MIC of 8, 8, 4, and 15 μg/mL compared to 2, 18, 18, and 0.5 of tetracycline (in vitro). | [64,85] |
| V. orientalis L. | HR-1 (INLKAIAALVKKVL-NH2 | ND | [99] |
| V. orientalis L. | HR-2 (FLPLILGKLVKGLL-NH2) | ND | [99] |
| Polistes jadwigae | Polisteskinin-J (RRRPPGFSPFR-OH) | ND | [98] |
| Pollistes chiensis | Polisteskinin-C (SKRPPGFSPFR-OH) | ND | [98] |
| P. rothney | Polisteskinin-R (ARRPPGFTPFR-OH) | Exerts potent anxiolytic effects at 6, 3, and 1.5 ηmol compared to positive control Diazepam (in vivo) | [98,100] |
| Vespa analis | Vespakinin-A (GRPPGFSPFRVI-OH) | ND | [98] |
| Vespa mandarínia | Vespakinin-X (ARPPGFSPFR-OH) | ND | [98] |
| V. magnifica, Parapolybia varia, V. tropica | Vespid Chemotactic Peptides (VCP) | Anti-tumor activities towards NIH-OVCAR-3 and SK-OV-3 ovarian cancer cell lines at concentrations higher than 10 μM (in vitro). | [34,101] |
| V. magnifica (Smith) | VCP-5h (FLPIIGKLLSGLL-NH2) | MICs of 5, 25, and 30, µg/mL for S. aureus, C. albicans and E. coli, respectively (in vitro). | [102] |
| Parapolybia varia | Vespakinin (Vespk) | Antitumor activity to SK-OV-3 at 24 h post-treatment (in vitro). | [101] |
| V. magnifica | Vespakinin-M GRPPGFSPFRID | ND | [103] |
| Batozonellus maculifrons | Pompilidotoxins (β-PMTXs) (RIKIGLFDQLSRL-NH2) | Inactivation of the Na+ channel, and the Nav1.6 channel was more selective (in vitro). | [1] |
| O. drewseni | OdVP1 (GRILSFIKGLAEHL-NH2) | Anti-E. coli, and anti-C. albicans at MIC of 6 µM (in vitro). | [104,105] |
| O. drewseni | OdVP2 (ILGIITSLLKSL-NH2) | Anti-S. aureus at MIC of 25 µg/mL. Anti-gray mold Botrytis cinerea at MIC of 0.4 µM (in vitro). | [104,105] |
| O. drewseni | OdVP3 (KDLHTVVSAILQAL-NH2) | Anti-gray mold B. cinerea at MIC of 5 µM (in vitro). | [104,105] |
| O. drewseni | OdVP4 (LDPKVVQSLL-NH2) | ND | [104] |
| Nasonia vitripennis | Defensin-NV (VTCELLMFGGVVGDSACAANCLSMGKAGGSCNGGLCDCRKTTFKELWDKRFG) | Anti-S. aureus, and Anti-B. cereus at MIC of 0.93 µM (in vitro). Anti-B. dysenteriae at MIC of 0.46 µM (in vitro). Anti-E. coli, and anti-C. albicans at MIC of 1.86 µM (in vitro). Anti-P. aeruginosa at MIC of 9.3 µM (in vitro). | [106] |
| Chartergellus communis | Communis (INWKAILGKIGK-COOH) | ND | [107] |
| C. communis | Communis-AAAA (INWKAILGKIGKAAAAVNH2) | Hemolytic activity at EC50 = 142.6 μM (in vitro). Hyperalgesic effect at 2 nmol/animal (in vivo). | [107] |
| Cyphononyx Fulvognathus | Bradykinin (RPPGFSPFR) | Acts as a chemoattractant directing glioma cells into blood vessels in the brain of rats (in vivo). | [108] |
| Megascolia flavifrons, and Colpa interrupta | Megascoliakinin = Thr6BK-Lys-Ala (BK = bradykinin) (RPPGFTPFRKA) | Prevents the synaptic transmission of the nicotinic acetylcholine receptor (nAChR) in the central nervous system of insect (in vitro). | [109] |
| C. fulvognathus and P. paulista | RA-Thr6 -Bradykinin (RARPPGFTPFR-OH) | ND | [98] |
| Polybia occidentalis, M. flavifrons, C. interrupta, and P. paulista | Threonine6-bradykinin (Thr6-BK) RPPGFTPFR-OH | Anti-nociceptive effects with approximately two-fold higher than bradykinin and morphine (in vivo). | [98,110] |
| P. paulista | RA-Thr6 -Bradykinin-DT (RARPPGFTPFRDT-OH) | ND | [98] |
| C. fulvognathus | Fulvonin (SIVLRGKAPFR) | Displays hyperalgesic impact after intraplantar injection in the rat paw pressure test (in vivo). | [111] |
| C. fulvognathus (Japan) | Cyphokinin (DTRPPGFTPFR) | Demonstrates hyperalgesic impact after intraplantar injection in the rat paw pressure test (in vivo). | [111] |
| C. fulvognathus (Japan) | Cd-146 (SETGNTVTVKGFSPLR) | Shows hyperalgesic effect in the rat paw pressure test after intraplantar injection (in vivo). | [111] |
| C. fulvognathus | Cd-125 (DTARLKWH) | ND | [111] |
| P. paulista | Mastoparan (MPI) (IDWKKLLDAAKQIL-NH2) | Cytotoxic towards T98G cells, gives 30% inhibition at 20 μmol/L (in vitro). | [40] |
| Pseudopolybia vespiceps | Mastoparan Polybia-MPII (INWLKLGKMVIDAL-NH2) | Anti-staphylococcal activity with an EC50 of 1.83 μM and EC90 of 2.90 μM (in vitro). Mice treated with 5 mg/kg showed a decline in bacterial load from 108 to ca. 106 CFUs (in vitro). Potent hemolytic activity against mouse cells (EC50 = 24.18 Μm, EC90 = 58.12 μM) (in vitro). Inhibits the growth of C. neoformans (EC50 = 11 μM) and C. albicans (EC50 = 12.9 μM) (in vitro). Anti-A. baumannii AB 0 at MIC of 12.5 µM while MIC against A. baumannii AB 53 and AB 72 was 6.25 µM (in vitro). Adhesion inhibition for A. baumannii AB 02 and AB 72 at 25 µM while A. baumannii AB 53 was inhibited at a concentration of 12.5 µM (in vitro). | [28,112] |
| P. paulista | Polybia-MPIII (INWLKLGKAVIDAL) | Anti-S. aureus, MIC of 19 μM (in vitro). | [65] |
| P. paulista | Polybia-MP IV (IDWLKLRVISVIDL-NH2) | Shows strong mast cell degranulation. Has weak haemolytic activity, hypernociception and edema formation (in vitro). | [98] |
| P. paulista | Polybia-MP V (INWHDIAIKNIDAL-NH2) | Medium mast cell degranulation, haemolytic activity and hypernociception (in vitro). | [98] |
| P. paulista | Polybia-MP VI (IDWLKLGKMVM-OH) | Medium haemolytic activity and hypernociception (in vitro). | [98] |
| P. paulista | unk-1 (IPAGWAIVKV-NH2) | Shows weak mast cell degranulation and haemolytic activity (in vitro). | [98] |
| P. paulista | unk-2 (TGDSPDVR-OH) | Shows weak mast cell degranulation and haemolytic activity, weak chemotaxis for PMNLs, and a range of weak to strong hypernociception and oedema formation (in vitro). | [98] |
| V. orientalis L. | Orientotoxin (Neurotoxin) | Has lysophospholipase activity and inhibits both mediated and spontaneous release of the neurotransmitter from the presynaptic nerve membrane (in vivo). | [113,114] |
| V. orientalis L. | Peptide I (AGVILFGR-NH2) | Histamine release from mast cells ED50 = 5.10−7 (in vivo). | [115] |
| V. orientalis L. | Peptide II (AGVIFRSP-NH2) | Histamine release from mast cells ED50 = 3.10−6 (in vivo). | [115] |
| Oreumenes decoratus | Decoralin (De-NH2) (SLLSLIRKLIT-NH2) | Has hemolytic activity at EC50 of 80 µM (in vitro). Anti-S. aureus, MIC = 4 µM (in vitro). Anti-B. Subtilis, MIC = 8 µM (in vitro). Anti-C. albicans, MIC = 20 µM (in vitro). Has leishmanicidal activity, IC50 =11 µM (in vitro). | [61] |
| V. ducalis | VACP1 (AQKWLKYWKADKVKGFGRKIKKIWFG) | Potently inhibits cell proliferation and promotes the cell apoptosis of osteosarcoma (OS) cells, and this was concomitant with the activation of the JNK and p38 MAPK signaling pathway (in vitro). | [6] |
| Emerald Jewel, and Ampulex compressa | Ampulexin-1 (axn1) (CKDDYVNPKEQLGYDILEKLRQKP) | ND | [116] |
| Ampulexin -2 (axn2) (CQNDYVNPKLQFACDLLQKAKERQ) | ND | [116] | |
| Ampulexin -3 axn3 SFSMLLQKAKERQ | ND | [116] | |
| V. orientalis | AuNPs+ peptide (INLKAIAALVKKV) | Antibacterial using AuNPs against K. pneumoniae, B. cereus, S. mutans, S. typhimuriu, E. coli, and S. aureus, and with the inhibition zones of 9.21, 14.32, 14.71,19.21, 15.24 and 15.33 mm, respectively (in vitro). | [19] |
| Vespa bicolor Fabricius | V. chemotatic peptide (VESP-VBs) (FMPIIGRLMSGSL) | Anti-S. aureus, MIC = 1 µg/mL (in vitro). | [5] |
| V. bicolor Fabricius | V. mastoparan (MP-VBs) (INMKASAAVAKKLL) | Anti-S. aureus, MIC = 1.9 µg/mL (in vitro). | [5] |
| Polistes dominulus | Dominulin A (INWKKIAEVGGKILSSL) | Anti-B. Subtilis, and E. coli at MIC = 2 and 8 µg/mL, respectively (in vitro). | [117] |
| P. dominulus | Dominulin B (INWKKIAEIGKQVLSAL) | Anti-B. Subtilis, and E. coli at MIC = 2 and 8 µg/mL, respectively (in vitro). | [17] |
| Protonectarina sylveirae | Protonectarina-MP (INWKALLDAAKKVL) | Anti-B. subtilis and anti-S. Aureus MIC = 3.9 µg/mL (in vitro). | [69] |
| Parapolybia indica | Parapolybia-MP (INWKKMAATALKMI-NH2) | Anti-S. aureus, MIC = 3.9 µg/mL (in vitro). | [69] |
| P. jadwigae | Polistes mastoparan (VDWKKIGQHIKSVL) | Degranulation of mast cells at 5 nM/mL. | [39] |
| V. magnifica (Smith) | Vespid chemotactic peptide (VCP) | MICs for S. aureus, C. albicans, and E. coli were 5, 25, and 30, µg/mL, respectively (in vitro). | [102] |
| V. bicolor Fabricius | VESP-VB1 (FMPIIGRLMSGSL) | Anti-E. coli, MIC = 7.5 µg/mL (in vitro). Anti-S. aureus, MIC = 1.9 µg/mL (in vitro). Anti-P. aeruginosa, MIC = 3.75 µg/mL (in vitro). Anti-C. albicans, MIC = 30 µg/mL (in vitro). | [5] |
| V. bicolor Fabricius | MP-VB1 (INMKASAAVAKKLL) | Anti-E. coli, MIC = 15 µg/mL (in vitro). Anti-S. aureus, MIC = 3.75 µg/mL (in vitro). Anti-P. aeruginosa, MIC = 15 µg/mL (in vitro). Anti-C. albicans, MIC = 15 µg/mL (in vitro). | [5] |
| V. tropica | VCP-VT1 | Anti-E. coli, Enterobacter cloacae, and C. parapsilosis at 2.5 µg/mL and Anti-S. aureus at 1.2 µg/mL (in vitro). | [30] |
| V. tropica | VCP-VT2 FLPIIGKLLSG | Antimicrobial against S. aureus, E. cloacae at 2.5 µg/mL (in vitro). | [30] |
| Protopolybia exigua (Kinins) | Protopolybiakinin-I (DKNKKPIRVGGRRPPGFTR-OH) | Caused degranulation of 35% of the mast cells (in vitro). | [118] |
| P. exigua | Protopolybiakinin-II (Kinins) (DKNKKPIWMAGFPGFTPIR-OH) | Caused degranulation of 52 % of the mast cells (in vitro). | [118] |
| V. mandarinia | VESCP-M2 (FLPILAKILGGLL) | Induces pain and severe tissue injury, oedema, cutaneous necrosis, and blister. | [119] |
| Polistes lanio lanio | PllTkP-I (QPPTPPEHRFPGLM) | ND | [120] |
| P. lanio lanio | PllTkP-II (ASEPTALGLPRIFPGLM) | ND | [120] |
| V. magnifica (Smith) | 5-Hydroxytryptamine | ND | [121] |
| V. magnifica (Smith) | Vespakinin-M (GRPPGFSPFRID-NH2) | ND | [121] |
| V. magnifica (Smith) | Mastoparan M (INLKAIAALAKKLL-NH2) | ND | [121] |
| V. magnifica (Smith) | Vespid chemotactic peptide M (FLPIIGKLLSGLL-NH2) | ND | [121] |
| Sphex argentatus argentatus | Sa12b (EDVDHVFLRF) | Inhibits acid-sensing ion channels (ASIC) of rat dorsal root ganglion (DRG) neurons at IC50 of 81 nM while inhibiting it completely at 1 μM (in vivo). | [122] |
| Isodontia harmandi | Sh5b(DVDHVFLRF-NH2) | ND | [122] |
| P. paulista | Neuropolybin | Antiseizure | [37] |
| Synoeca surinama | Synoeca-MP I/LNWI/LKI/LGKKI/LI/LASL/NH2 | Antimicrobial activity, MIC50 values were 1.9, 2, 8.3, 5.2, and 3.5 μM for methicillin-resistant S. aureus—MRSA, E. coli ESBL, vancomycin-resistant E. Faecalis, P. aeruginosa metallo-ß-lactamase, and Klebsiella pneumoniae KPC, respectively (in vitro). Anti-Candida species, with MICs varying from 10–40 μM (in vitro). | [123] |
| Enzymes and proteins | |||
| V. magnifica | Magnifin (PLA1) | Activates platelet aggregation and induces thrombosis at 18 nM with causes 85% washed platelets aggregation in 60 s (in vivo). | [124] |
| P. paulista (southeast Brazil) | Phospholipase A1(Ves v 1) | Catalyzes the ester bonds hydrolysis of 1,2-diacyl-3 snglycerophospholipids at the sn-1 and sn-2 positions, respectively. | [125] |
| P.paulista | Phospholipase A1 | Hydrolyzes phospholipids and produces 2-acyl-lysophospholipids and fatty acids. | [125,126] |
| P. Occidentalis and P. paulista | Phospholipase A2 (PLA2) | Potent hemolytic actions in washed red cells (in vitro). Hydrolyzes natural phospholipids, catalysing the deacylation of 1,2-diacyl-sn-3-phosphoglycerides at position 2 and thus releases free fatty acids and lysophospholipids (in vitro). | [127,128] |
| P. paulista, Vespula maculate, Vespula arenaria, V. crabro, V. orientalis, Paravespula germanica, Paravespula vulgaris, Dolichovespula saxonica, Dolichovespula media, and Polistes Gallicus | Hyaluronidase (Polyp2) | Hydrolyses hyaluronic acid which facilitates the diffusion of toxin into the tissue and blood circulation of the prey. | [129,130,131] |
| Polistes comanchus | Polistin (protein) | Responsible for the cytotoxic effect of the whole venom. | [132] |
| P. paulista | Antigen5 (Polyp5) | Major allergen could be used for allergy diagnostics and treatment. | [133] |
| Cyphononyx dorsalis | Arginine kinase-like protein | Exhibits paralytic activity in spiders with the same characteristic symptoms as the crude venom. | [134] |
| Pteromalus puparum | Vn.11 (protein) | ND | [135] |
| Cotesia rubecula | Vn 4.6 | ND | [136] |
| V. magnifica | Magnvesin | Exerts anti-coagulant properties via hydrolyzing coagulant factors VII, VIII, TF, IX and X. | [137] |
| Some volatile compounds | |||
| Vespa velutina | Undecan-2-one | Elicits the defense behavior | [138] |
| V. velutina | Non-8-en-2-one | ||
| V. velutina | Nonan-2-one | ||
| V. velutina | Heptan-2-one | ||
| V. velutina | 4,8-Dimethylnon-7-en-2-one | ||
| Polistes metricus Say, Polistes bellicosus Cresson, and Polistes dorsalis (F.), as well as workers of Polistes aurifer (Saussure), P. bellicosus, P. metricus, and P. dorsalis | N-(3-Methylbutyl)acetamide | ND | [139] |
| P. occidentalis | (E,E)-2,8-Dimethyl1,7-dioxaspiro[5.5]undecane | Elicit the defense behavior | [140] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Abd El-Wahed, A.; Yosri, N.; Sakr, H.H.; Du, M.; Algethami, A.F.M.; Zhao, C.; Abdelazeem, A.H.; Tahir, H.E.; Masry, S.H.D.; Abdel-Daim, M.M.; et al. Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins 2021, 13, 206. https://doi.org/10.3390/toxins13030206
Abd El-Wahed A, Yosri N, Sakr HH, Du M, Algethami AFM, Zhao C, Abdelazeem AH, Tahir HE, Masry SHD, Abdel-Daim MM, et al. Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins. 2021; 13(3):206. https://doi.org/10.3390/toxins13030206
Chicago/Turabian StyleAbd El-Wahed, Aida, Nermeen Yosri, Hanem H. Sakr, Ming Du, Ahmed F. M. Algethami, Chao Zhao, Ahmed H. Abdelazeem, Haroon Elrasheid Tahir, Saad H. D. Masry, Mohamed M. Abdel-Daim, and et al. 2021. "Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions" Toxins 13, no. 3: 206. https://doi.org/10.3390/toxins13030206
APA StyleAbd El-Wahed, A., Yosri, N., Sakr, H. H., Du, M., Algethami, A. F. M., Zhao, C., Abdelazeem, A. H., Tahir, H. E., Masry, S. H. D., Abdel-Daim, M. M., Musharraf, S. G., El-Garawani, I., Kai, G., Al Naggar, Y., Khalifa, S. A. M., & El-Seedi, H. R. (2021). Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins, 13(3), 206. https://doi.org/10.3390/toxins13030206

