Next Article in Journal
Saccharomyces cerevisiae Cell Wall-Based Adsorbent Reduces Aflatoxin B1 Absorption in Rats
Previous Article in Journal
Curcumin Alleviates LPS-Induced Oxidative Stress, Inflammation and Apoptosis in Bovine Mammary Epithelial Cells via the NFE2L2 Signaling Pathway
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions

by
Aida Abd El-Wahed
1,2,
Nermeen Yosri
2,3,
Hanem H. Sakr
4,
Ming Du
5,
Ahmed F. M. Algethami
6,
Chao Zhao
7,8,
Ahmed H. Abdelazeem
9,10,
Haroon Elrasheid Tahir
3,
Saad H. D. Masry
11,12,
Mohamed M. Abdel-Daim
13,
Syed Ghulam Musharraf
14,
Islam El-Garawani
4,
Guoyin Kai
15,
Yahya Al Naggar
16,17,
Shaden A. M. Khalifa
18,* and
Hesham R. El-Seedi
2,18,19,20,*
1
Agricultural Research Centre, Department of Bee Research, Plant Protection Research Institute, Giza 12627, Egypt
2
Department of Chemistry, Faculty of Science, Menoufia University, Shebin El-Kom 32512, Egypt
3
School of Food and Biological Engineering, Jiangsu University, Zhenjiang 212013, China
4
Department of Zoology, Faculty of Science, Menoufia University, Shebin El-Kom 32512, Egypt
5
National Engineering Research Center of Seafood, School of Food Science and Technology, Dalian Polytechnic University, Dalian 116034, China
6
Alnahalaljwal Foundation Saudi Arabia, P.O. Box 617, Al Jumum 21926, Makkah, Saudi Arabia
7
College of Food Science, Fujian Agriculture and Forestry University, Fuzhou 350002, China
8
State Key Laboratory of Quality Control in Chinese Medicine, Institute of Chinese Medical Sciences, University of Macau, Taipa, Macau, China
9
Department of Medicinal Chemistry, Faculty of Pharmacy, Beni-Suef University, Beni-Suef 62514, Egypt
10
Department of Pharmaceutical Sciences, College of Pharmacy, Riyadh Elm University, Riyadh 11681, Saudi Arabia
11
Abu Dhabi Food Control Authority, Al Ain 52150, United Arab Emirates
12
Department of Plant Protection and Biomolecular Diagnosis, Arid Lands Cultivation Research Institute (ALCRI), City of Scientific Research and Technological Applications, New Borg El-Arab City, Alexandria 21934, Egypt
13
Pharmacology Department, Faculty of Veterinary Medicine, Suez Canal University, Ismailia 41522, Egypt
14
International Center for Chemical and Biological Sciences, H.E.J. Research Institute of Chemistry, University of Karachi, Karachi 75270, Pakistan
15
Laboratory of Medicinal Plant Biotechnology, College of Pharmacy, Zhejiang Chinese Medical University, Hangzhou 310053, China
16
General Zoology, Institute for Biology, Martin Luther University Halle-Wittenberg, Hoher Weg 8, 06120 Halle (Saale), Germany
17
Zoology Department, Faculty of Science, Tanta University, Tanta 31527, Egypt
18
Department of Molecular Biosciences, Stockholm University, the Wenner-Gren Institute, SE-106 91 Stockholm, Sweden
19
International Research Center for Food Nutrition and Safety, Jiangsu University, Zhenjiang 212013, China
20
Division of Pharmacognosy, Department of Pharmaceutical Biosciences, Uppsala University, Biomedical Centre, P.O. Box 574, 751 23 Uppsala, Sweden
*
Authors to whom correspondence should be addressed.
Toxins 2021, 13(3), 206; https://doi.org/10.3390/toxins13030206
Submission received: 6 February 2021 / Revised: 26 February 2021 / Accepted: 8 March 2021 / Published: 12 March 2021
(This article belongs to the Special Issue Drug Discovery from Animal Venoms)

Abstract

Wasps, members of the order Hymenoptera, are distributed in different parts of the world, including Brazil, Thailand, Japan, Korea, and Argentina. The lifestyles of the wasps are solitary and social. Social wasps use venom as a defensive measure to protect their colonies, whereas solitary wasps use their venom to capture prey. Chemically, wasp venom possesses a wide variety of enzymes, proteins, peptides, volatile compounds, and bioactive constituents, which include phospholipase A2, antigen 5, mastoparan, and decoralin. The bioactive constituents have anticancer, antimicrobial, and anti-inflammatory effects. However, the limited quantities of wasp venom and the scarcity of advanced strategies for the synthesis of wasp venom’s bioactive compounds remain a challenge facing the effective usage of wasp venom. Solid-phase peptide synthesis is currently used to prepare wasp venom peptides and their analogs such as mastoparan, anoplin, decoralin, polybia-CP, and polydim-I. The goal of the current review is to highlight the medicinal value of the wasp venom compounds, as well as limitations and possibilities. Wasp venom could be a potential and novel natural source to develop innovative pharmaceuticals and new agents for drug discovery.
Key Contribution: Here, we critically review the biological properties of wasp venom and its components and their application in nanotechnology.

Graphical Abstract

1. Introduction

Vespid wasps (Family: Vespidae) are distributed worldwide and comprise more than 5000 species. Wasp venom has a wide variety of chemical constituents, which includes proteins, peptides (e.g., mastoparan, eumenitin, eumenitin-R, rumenitin-F, EpVP, decoralin, and anoplin), enzymes (hyaluronidase, α-glucosidase, phosphatase phospholipase A2, and phospholipase B), and small molecules [1,2,3]. The isolated compounds from wasp venom have shown several beneficial activities such as antimicrobial [4,5], anticancer [6], and anti-inflammatory effects [7]. However, their peptides have been presented in trace quantities. Solid phase peptides synthesis (SPPS) was attributed to the design and development of these molecules [8]. Successfully, several peptides and their analogues were synthesized via SPPS technology such as mastoparan [9], anoplin [10], decoralin [11], polybia-MP-I [12], polybia-CP [13,14], polydim-I [15], and agelaia-MP [16]. The synthetic peptides have antimicrobal, and anticancer properties [17,18].
The nests and venoms of wasps have been their role in the synthesis of nanoparticles of gold and silver tested. These nanoparticles were proven effective as antimicrobial and anticancer entities against a variety of microorganisms and cancer cells [19,20,21].
Despite preliminary medicinal outcomes, the interaction between wasp venom and human organs is still under debate. Wasp venom impacts the physiological aspects of the human body and could also lead to an allergic reaction [22].
Allergic reaction to wasp venom is a devastating problem due to the progressing immune responses of different systems. For instance, Vespa velutina venom administration lead to the failure of multi-organisms and even death among the Chinese population; and that was mostly due to toxins that are usually known to cause pain, inflammation, kidney and liver failure, cardiac arrhythmia, and sometimes neurotoxicity. Thus, many efforts are being invested into combating the allergic reactions and improving life quality using venom immunotherapy (VIT) [23]. VIT is the most effective method known so far for the avoidance of the systemic sting reactions even after discontinuation of the therapy [24].
This review attempts to shed light on the biochemical properties and potential applications of wasp venom. Previous studies have suggested that venom peptides could contribute to biological activities, such as anticancer, antimicrobial, neuroprotective, anti-inflammatory, and antioxidant effects. It is important to investigate the components of venom to learn how the underlying defensive mechanisms have evolved since evidence suggests that the wasp venom can differ internally and interspecifically from other types of venom. Isolation and characterization of the venom components are essential steps in understanding the envenoming process [25].

2. Biological Properties of Wasp Venom, and Their Isolated and Synthesized Bioactive Peptides

2.1. Biological Properties

Studies have been conducted on venomous wasp structures, and their mode of action dating back to over 50 years ago. However, the therapeutic value of these toxins remains relatively unexplored. Further experiments are needed to fill the gap, and implementat quality control to elucidate wasp venom biological properties. As shown below, wasp venom exhibits biological properties, including antimicrobial, anticoagulant, genotoxic, and anti-inflammatory properties (Figure 1) [26,27,28,29].

2.1.1. Antimicrobial Activities

Today, microbial infections are a significant human concern globally. The emergence of infectious diseases and the scarcity of vaccines pose a significant danger to human health; thus, there is an immediate need to develop new antimicrobial agents [30]. Vespa orientalis’s crude venom contains peptides and proteins. The venom has antimicrobial activity against Gram-positive and Gram-negative bacteria at very low concentrations relative to tetracycline (positive control). The inhibition zones were 10.2, 12.6, 22.4, and 22.7 mm for Klebsiella pneumonia, Staphylococcus aureus, Escherichia coli, and Bacillus subtilis, respectively, while MIC values were 128, 64, 64, and 8 μg/mL, respectively. The MIC50 and MIC90 values were 74.4 and 119.2 μg/mL for K. pneumonia, 63.6 and 107 μg/mL for S. aureus, 45.3 and 65.7 μg/mL for E. coli, and 4.3 and 7.0 μg/mL for B. subtilis, respectively [31]. Previous studies have determined that the venom from Parischnogaster, Liostenogaster, Eustenogaster, and Metischnogaster wasps inhibited the development of Gram-positive B. subtilis, Gram-negative E. coli, and Saccharomyces cerevisiae yeast [32]. The peptide mastoparan-c, derived from Vespa crabro venom, triggered antimicrobial action toward resistant strains of S. aureus (Gram-positive) bacteria [26].

2.1.2. Anti-Inflammatory Activities

Inflammation is an underlying cause of several destructive disorders such as arthritis, cancer, and asthma. Anti-inflammatory medications are currently used to suppress short- and long-term body responses, and thus, it is vital to recognize new molecules with similar properties [33]. Vespa tropica venom effectively reduced oxidative stress and stimulated microglia via lipopolysaccharides (LPS) release. Wasp venom treatment (5 and 10 μg/mL) greatly attenuated LPS induced activation of NF-kB phosphorylation [34]. Bracon hebetor venom (BHV) affected LPS-induced nitric oxide (NO) in RAW 264.7 cells and septic shock in mouse models. BHV strongly mediated LPS-induced inflammation without any cytotoxicity at a concentration of 0.1–0.4 μg/mL [35]. Moreover, Nasonia vitripennis venom contains at least 80 proteins, and it exerts anti-inflammatory impacts via down-regulation of the proinflammatory cytokine IL-1β [27].

2.1.3. Genotoxicity

Polybia paulista wasp venom concentrations below 0.01–10 μg/mL did not cause cytotoxicity and showed genotoxic and mutagenic potential in HepG2 cells. The genotoxic and mutagenic behavior of P. paulista venom could be explained by the action of phospholipase, mastoparan, and hyaluronidase, leading to cell membrane disruption and genetic material alterations or even DNA mutations [29].

2.1.4. Anticoagulant

The venom of Polybia occidentalis, a social wasp, has anticoagulant, and fibrinogen-degrading pharmacological properties. Anticoagulation occurs at different stages of the clotting process (intrinsic, extrinsic, and specific pathway). Venom can inhibit platelet aggregation and destroy plasma fibrinogens [28].

2.2. Isolated and Synthesized Bioactive Peptides from Wasp Venoms

Wasp venoms are cocktails of peptides, proteins, and small organic molecules like volatiles compounds (Figure 1 and Figure 2), where peptides are the most abundant compounds, as mentioned in Table 1 [36,37]. The minute quantity of extracted venom stands as a hindrance to the analysis and understanding of the pharmacological, biological, and ecological aspects of the venom constituents. Here, we discuss the isolated peptides from wasp venom and their chemical design via SPPS [8].

2.2.1. Mastoparans

The mastoparans are comprised of a class of peptides isolated from Vespula lewisii [38], V. crabro [26], Vespula vulgaris [4], and Polistes jadwigae [39]. Mastoparans are characterized by their antitumor activity against melanoma cells (B16F10-Nex2) [38].
Mastoparan (MP)
Mastoparan (MP), a major component of P. jadwigae wasp venom, is a basic amphiphilic α-helical peptide that consists of 14 amino acid residues, hydrophobic and essential amino acids, and an amino acid C-terminus, as shown in Table 1 [39]. These characters are specific for the cationic amphiphilic peptide (CAP) class and favour the α-helix conformation while in contact with bilayer phospholipids [40]. MP has several biological effects and has shown antimicrobial properties [41], increased histamine release from mast cells [42], and cytotoxicity effect on tumor cells [18]. MP-induced mitochondrial permeability and powerful transition of mitochondrial permeability (PT) in a range of 25 μM in a homogeneous K562 cell are reported [43]. Moreover, MP exerts anticancer activities toward leukemia, myeloma, and breast cancer cells. In a mouse model of mammary carcinoma, MP and gemcitabine (drug) worked synergistically [18]. MP was active on a dose-dependent basis with doses ranging from 77.9 to 432.5 μM against human cancer cells (A2058 (melanoma), SiHa (cervical carcinoma), Jurkat (T cell leukemia), MCF-7, MDA-MB-231, and SK-BR-3 (breast cancer). The IC50 of B16F10 murine melanoma was 165 μM. MP-induced apoptosis involves activation of caspase −9, −12, and −3, PARP cleavage, upregulation of pro-apoptotic Bax, and Bim, down-regulation of anti-apoptotic Bcl-XL; furthermore, cell apoptosis induced mitochondrial membrane disruption [38].
MP inhibited bradykinin-induced phosphoinositide hydrolysis within 5 min of administration at a concentration of 30 μM and induced the release of prostaglandin E2 (PGE 2) in rabbit astrocytes within 10 min [44].
The synthetic peptide derived from MP is called mastoparan ([I5, R8] MP) and has a wide range of antimicrobial activities against bacteria and fungi at MIC values of 3–25 µM with no hemolytic or cytotoxic properties to the human embryonic kidney cell line (HEK-293 cells). The synthesis does not appear to change the α-helical conformation but enhances the biological activity [45]. Ten MP derivatives have been synthesized via SPPS strategies and evolved against Acinetobacter baumannii. MP analogs (H-INIKALAALAKKII-NH2, H-INLKALAALAKKIL-CH2CH2NH2, and Gu-INLKALAALAKKIL-NH2) demonstrated the same behavior against A. baumannii as the original peptide (2.7 µM) and retained its consistency in the presence of human serum for more than 24 h [9]. Three MP analogs, MK4589 (INWKKIAKKVAGML-NH2), MK45789 (INWKKIKKKVAGM), and MK4578911 (INWKKIKKKVKGML-NH2), were synthesized, and exhibited strong antibacterial properties against Gram-negative bacteria compared to the reference antibiotic, chloramphenicol [46]. Mastoparan-V1 (MP-V1), a de novo type of V. vulgaris venom mastoparan, has higher anti-Salmonella activity than other mastoparans [4]. MP analog peptides showed activity against Candida albicans, with low cytotoxicity and non-teratogenicity using cell cultures and zebrafish models [47]. Synthetic MP-V1 has antimicrobial properties at MICsvalues of 106.95, 56.86, and 123 µg/mL against Salmonella Gallinarum, S. typhimurium, and S. enteritidis, respectively [48].
Mastoparan-B (MP-B)
Mastoparan-B (MP-B), the mastoparan homolog of Vespa basalis venom, has a less hydrophobic amino acid sequence with four lysines (LKLKSIVSWAKKVL-NH2) [49] and is approved as a cardiovascular depressor [50] and antibacterial agent [51]. MP-B shows powerful hemolytic activity secondary to the stimulation of histamine release from rat peritoneal mast cells [49]. A synthetic MP-B analog (LDLKSIVSWAKKVL-NH2), in which lysine was replaced by asparagine at position 2, showed a remarkable decline of cardiovascular depressors; in contrast, the analog with leucine replacing lysine at position 4, 11, or 12 (LKLLSIVSWALLVL-NH2) did not display the same effect [50].
Mastoparan-M
Mastoparan-M is an amphipathic tetradecapeptide toxin and a vespid venom mastoparan counterpart isolated from the Vespa mandarinia hornet in Japan. Mastoparan-M has the (INLKAIAALAKKLL) sequence. At a minimum concentration (MIC) of 0.5 nmol/mL, the peptide degranulated rat peritoneal mast cells [52]. Mast cell degranulation induced the release of inflammatory mediators, such as TNF-α, IL-1β, and nitrite, from cultured mouse spleen macrophages [53].
SPPS was used to synthesize D-mastoparan M (INLKAIALAKKLL) and L-mastoparan M (INLKAIAALAKKLL). D-mastoparan M showed MIC of 6.25 mg/L against E. coli and Pseudomonas aeruginosa and 3.12 mg/L against S. aureus. The antibacterial impact of D-mastoparan was twice as effective as L-mastoparan M. After the supplementation of D-mastoparan M, bacterial lysis was observed at 1 h and was completed after 4 h [54].

2.2.2. Anoplin

Anoplin (ANP) is the smallest antimicrobial, naturally occurring peptide isolated from the solitary spider wasp Anoplius samariensis (Hymenoptera: Pompillidae) and contains ten amino acids (Table 1), making it an ideal research template [55]. The peptide causes mast cell degranulation and has antimicrobial activity [55]. The presence of four-polar residues makes ANP water-soluble. Its interaction with amphipathic environments, such as trifluoroacetic acid (TFE)/water mixtures, or with anisotropic media, such as sodium dodecyl sulfate (SDS) micelles or anionic vesicles, induces α-helical conformations and amphiphilic properties as indicated by the circular dichroism (CD) spectra [55]. ANP inhibited the proliferation of murine erythroleukemia (MEL) cells in a time- and dose-dependent manner. The IC50 values were 161.49, 121.03, and 114.88 μM at 24, 48, and 72 h, respectively. Disrupting the cell membrane integrity was the primary mechanism behind anoplin’s cytotoxicity [56].
Synthetic ANP peptides have a broad spectrum of antimicrobial activity against Gram-positive and Gram-negative bacteria. ANP antimicrobial activity is susceptible to salt. Gram-negative bacteria were entirely immune to ANP in high-salt media (150 mM NaCl); however, Gram-positive bacteria’s efficacy was greatly diminished [55]. Equally interesting, it stimulates rat peritoneal mast cell degranulation, and ANP’s hemolytic activity was relatively low or virtually inactive on human erythrocytes [55].
ANP’s activity is highly sensitive to minor changes of the primary structure, such as single amino acid mutations in certain positions. For example, 37 anoplin analogs have been synthesized by replacing single and multiple residues leading to a change in amphipathicity and charge. Accordingly, the effects against S. aureus and E. coli varied considerably depending on the hydrophobicity and position of the various replaced amines. Residue replacement at positions 5, and 8 with phenylalanine or tryptophan caused by an increase in antibacterial, and hemolytic activity owed to the role of these aromatic residues in the membrane anchoring. Lysine placement in position 8 improved peptide selectivity for prokaryotic cells due to the higher charge [57], whereas C-and N-terminal truncation and C-terminus deamidation drastically decreased peptide antibacterial properties [58]. Antimicrobial activities were measured against E. coli and B. subtilis for all three derivatives of ANP (ANP-NH2, D-ANP-NH2, and ANP-OH). Both amidated ANP derivatives display 50 μg/mL, MIC values for B. subtilis, and 100 μg/mL for E. coli. Alternatively, the deamidated form showed significantly lower bactericidal activity with MIC values of 200 μg/mL. The LD50 values for both amidated ANP forms were identical and approximately 10- to 30-fold lower than those of ANP-OH. ANP loses its biological activity after deamidation. Both amidated and carboxylated forms have secondary structures similar to those of the lytic ANP [59]. The natural cationic ANP was modified by substituting residues Gly1 for Lys or Arg, Arg5 for Phe, and Thr8 for Lys. The antimicrobial properties change dramatically, and high activity against Gram-negative bacterium Zymomonas mobilis at MIC 7 μg/mL was observed, compared to native peptide MIC 200 μg/mL; additionally, it was non-toxic to erythrocytes and resistant to proteolysis [10]. Interestingly, the antimicrobial activities of ANP and analogs ANP-2 (WLLKRWKLL-NH2), and ANP-4 (KLLKWKKLL-NH2) were significantly higher than ANP-1 (WLLKRWKKLL-NH2) and ANP-3 (KLLKWWKKLL-NH2). The highest antimicrobial activity against B. subtili was shown by ANP-2 and ANP-4 (MIC value: 4 μM) compared to the parent peptide (MIC value: 32 µM). ANP-4 treatment significantly reduced the mortality rate of mice infected with E. coli compared to ANP. ANP-4 is a novel analog of ANP with high antimicrobial activity and enzyme stability that represent it as a successful agent for infections treatment [60].

2.2.3. Decoralin

Decoralin (Dec-NH2) is a peptide derived from the solitary Eumenine wasp (Oreumenes decoratus) [61] and was synthesized by solid-phase synthesis [62]. Equally important, a natural antimicrobial peptide, Dec-NH2, was isolated from wasp venom, and its synthetic derivatives were manufactured using peptide design. Dec-NH2 exhibits potent activity toward cancer cells at doses of 12.5 μmol/L and specific inhibition of MCF-7 breast cancer cells [62]. In a biological assessment, synthetic Dec-NH2 demonstrated strong broad-spectrum antimicrobial activity, slight mast cell degranulation, and leishmanicidal activity. The peptide displayed low hemolytic function against mouse erythrocytes, EC50 lower 300 µM [61]. A synthetic Dec-NH2 analog with C-terminal amidation demonstrated much more efficient activity against Gram-positive and Gram-negative bacteria and yeast. When isoleucine was substituted by phenylalanine residue at position 6, the peptide increased its resistance to degradation in bovine fetal serum. Besides that, lower hemolytic activity was obtained for [Pro]4-decoralin-NH2 and [Phe]6-Des[Thr]11-decoralin-NH2. The antimicrobial effect was increased in the case of [Phe]9-[Phe]10-Dec-NH2 (MIC = 0.39 vs. native peptide of 0.78 µmol/L) against Micrococcus luteus A 270 [63]. Torres et al. synthesized two leucine-substituted Dec-NH2 analogs; [Leu]8-Dec-NH2, and [Leu]10-Dec-NH2 using SPPS. [Leu]10-Dec-NH2 analog showed similar activity against E. coli, and P. aeruginosa (MIC 1.6 μmol/L), and higher activities against M. luteus and C. albicans. The same helical structure of the [Leu]8-Dec-NH2 analog exhibited evidential low activities against M. luteus, E. coli, Salmonella arizonae, B. subtilis, P. aeruginosa, and C. albicans [11]. The natural sequence of amidated Dec-NH2 and eight synthesized analogs, along with their biological activity toward Plasmodium, were reviewed. The Dec-NH2 template compound did not display antiplasmodial properties; on the other hand, it’s designed analogs showed significant antiplasmodial activity (>95%). The highest antiplasmodial behavior was achieved by mutations made to the N-terminus of Dec [64].

2.2.4. Polybia-MP-I

Polybia-MP-I is one of the 14 amino acid residues (Table 1) of mastoparan peptides [65]. The peptide was derived from the venom of the social wasp P. paulista. It causes moderate mast cell degranulation, demonstrates chemotactic action for polymorphonuclear leukocytes, exhibits active antimicrobial activity, and is non-hemolytic to rat erythrocytes [66]. Polybia-MP-I is cytotoxic to leukemic T lymphocytes and strongly selective to these individual cells [67]. Polybia-MP-I has demonstrated antitumor action against bladder and prostate cancer [12]; however, this antitumor activity drastically decreased with the synthesized analogs (replacement of the amino acids at position 7, 8, or 9 with Pro residue). These substitutions influence the original helical structure and electrostatic equilibrium and increase the degree of peptide hydrophilic behavior (Pro7 and Pro9). Polybia-MP-I exerts pore formation and thus alters the intact cellular structure leading to a cytotoxic and antiproliferative outcome. It can selectively inhibit the proliferation of prostate cancer cell lines (PC-3), human bladder cancer cell lines (Biu87 and EJ), and human umbilical vein endothelial cell lines (HUVEC) at IC50 of 20.8, 25.32, and 36.97 μM, respectively [12].
The peptides polybia-MP-I (IDWKKLLDAAKQIL-NH2) and Asn-2-polybia-MP-I (INWKKLLDAAKQIL-NH2) were manually synthesized in the solid phase. Polybia-MP-I and N-2-polybia-MP-I exhibited a significant reduction in the pain threshold at 30, and 50 μg/50 μL as detected at 2, and 8 h after peptide injection into the hind paw of mice [68,69]. The polybia-MP-I analogs (proline replacement) showed reduced antibacterial activity compared to the parent. MIC values of polybia-MP-I were 4, 16, 16, and 32 μM for B. subtilis, E. coli, S. epidermidis, and S. aureus, respectively. The MIC value was 8 µM for C. glabrata versus 16 µM against C. albicans. The fungicidal activity of polybia-MP-I versus both Candida glabrata and C. albicans was measured as an minimum fungicidal concentration (MFC) of 32 μM [70,71].

2.2.5. Polybia-CP

Polybia-CP has been isolated from P. paulista, and gradually synthesized by SPPS, and its effects on bacteria have been recorded [14]. Polybia-CP’s MICs for E. coli, P. aeruginosa, S. aureus, S. epidemic, and B. subtilis were 16, 128, 4, 16, and 4 μM, respectively, while the MBCs were 8, 16, 128, and 16 μM, for B. subtilis, S. aureus, and E. coli, respectively. The peptide was stable at different temperature ranges of 20–100 °C, and the temperature changes did not affect the MIC values [72]. Polybia-CP showed antimicrobial activities with MIC values of 4–64 μM in eight fungal strains, where the highest activity was noted against C. tropicalis at a MIC of 4 μM [13].
Synthetic Polybia-CP has potent antitumor activity against Biu87 and PC-3 cell lines. Cell proliferation inhibition was observed at IC50 of 17.84 and 11.01 μM, respectively. The cytotoxicity of polybia-CP was explained by the disruption of cell membrane integrity [14].

2.2.6. Polydim-I

Polydim-I is a peptide derived from the venom of a neotropical wasp (Polybia dimorpha). The peptide contains 22 amino acid residues and is known for its amphipathic properties due to the presence of hydrophobic amino acid residues (e.g., methionine, leucine, valine, and proline) [15].
Polydim-I was synthesized with high quality (>99%), and the relevant peptide sequence was tested and validated by MS analysis. The synthetic peptide is active against Mycobacterium abscessus subsp. massiliense infections as described in in vitro and in vivo studies. In vitro study, the inhibition was 55 to 68% of M. abscessus subsp massiliense strains growth at a concentration of 15.2 μg/mL in which the cell shape was expressively damaged. The peptide prevents bacterial growth through the inhibition of protein synthesis, did not result in visible morphological changes. Polydim-I treatment at 2 mg/kg/mLW showed significant reduction of the bacterial load in in the lungs, spleen, and liver [15], and the antimicrobial properties against S. aureus, E. coli, Enterococcus faecalis, Acinetobacter calcoaceticus-baumannii were displayed with MIC50 values of 4.1, 50.7, 73.2, and 84.0 μg/mL, respectively [73].

2.2.7. Protonectarina-MP and Agelaia-MP

Protonectarina-MP was isolated from Protonectarina syleirae venom and is a member of the 14 amino residue class of mastoparans [74]. The peptide protonectarina-MP-NH2 (INWKALLDAAKKVL-NH2) and its analogue protonectarina-MP-OH (INWKALLDAAKKVL-OH) were produced by step-by-step manual SPPS. Protonectarin-MP-NH2 is a powerful mast cell degranulating peptide with slightly higher degranulating activity (ED50 = 8 ×10−5 M) than the standard peptide (ED50 = 20 × 10−5 M). Protonectarina-MP-OH, and even at high concentrations, has reduced degranulation activity. Protonectarina-MP-NH2 has effective antimicrobial activity against both Gram-positive and Gram-negative bacteria, while protonectarina-MP-OH has much poorer antimicrobial activity [17].
Agelaia-MP is a mastoparan peptide that contains 14 residues (INWLKLGKAIIDAL-NH2) and is isolated from the venom of the social wasp Agelaia pallipes. It was characterized by its poor antimicrobial action and the lack of chemotaxis toward mast cells [74]. Using the Fmoc strategy, agelaia-MP has been chemically and manually synthesized. At a concentration of 10 μM, the peptide enhances the insulin secretion from the mice pancreatic islets using different glucose doses (2.8, 11.1, and 22.2 mM). In mouse models, agelaia-MP-I has a dose-dependent anti-nociceptive effect. For example, nociception significantly declined when the highest dosage (6.4 nmol) was administered, while the maximal effect was observed 4 h after the peptide injection [16].
Protonectin is derived from the venom of the neotropical social wasp (Agelaia pallipes), with a sequence of ILGTILGLLKGL-NH2. The peptide exhibits poor hemolysis to rat erythrocytes [74]. Protonectin has some mast cell degranulating activity and potent antimicrobial action with E. coli, P. aeruginosa, B. subtilis, and S. aureus at MICs of 25, 1.7, 3.1, and 12.5 µg/mL, respectively [74].
Protonectin and its three analogues were synthesized through a stepwise solid-phase assay by replacing L-proline. Proline is a unique amino acid among the 20 protein-forming amino acids because its amine nitrogen is linked to two groups of alkyls, making it a secondary amine. The insertion of proline inside the peptide considerably changes the secondary structure. Protonectin has demonstrated potent antibacterial action toward multidrug-resistant S. aureus, and E. coli at MICs of 8, and 32 μM, respectively. MBC values were 8, 8, 16, and 64 µM for B. subtilis, S. epidermidis, S. aureus, and E. coli, respectively, indicating potent bactericidal effect [75].

2.2.8. Philanthotoxin-433 (PhTX-433)

Philanthotoxin-433 (PhTX-433) is a polyamine-based toxin isolated from Egyptian digger wasp (Philanthus triangulum) venom. The venom induces prey paralysis by suppressing nicotinic acetylcholine receptors (nAChRs) and ionotropic glutamate receptors (iGluRs). PhTX-433 is an important lead compound in neuropharmacology [76,77]. The action of 17 analogs of PhTX-343 against ganglionic (α3β4) and brain (α4β2) nAChRs has been expressed in Xenopus oocytes. IC50 values for PhTX-343 inhibition of α3β4 and α4β2 receptors were 7.7 and 80 nM, respectively [78]. Their total synthesis achieved good yield (77%) and purity (80%) using a mild borane reduction protocol of polyamide precursors to access the polyamine chains. The synthesis of PhTX-433 isomers proved this strategy’s potential for the generation of branched analogs [76].

3. Application of Wasp Venom and Their Nests in Nanotechnology

There is an increasing awareness of the use of metabolites of arthropods including insect for the green synthesis of nanoparticles [141]. In this context, Jalaei and colleagues published the first study on the green synthesis of gold nanoparticles (AuNPs) using V. orientalis wasp venom peptides. The AuNPs had been fabricated by adding 25 mL of stabilized SDS-NPs suspension (AuNP and SDS surfactant) to 750 μL of purified peptides (20 μM). The crystalline gold nanoparticles have been characterized ((TEM; average size 23.2 ± 2.7 nm), (XRD; average size 35 nm), (UV where the peak of AuNPs confirmed at 555 nm)), and FTIR data demonstrated that amide, amine, peptide, and protein compounds were involved in AuNP biosynthesis. Furthermore, wasp venom-mediated AuNPs depicted good antibacterial activity using microdilution assay against E. coli, K. pneumonia, S. typhimurium, S. aureus, S. mutans, and B. cereus with MIC values of 5.11, 10.08, 11.66, 28.04, 18.78, and 28.12 μg/mL, respectively, in comparison with the positive control (tetracycline, MIC = 0.98–2.21 μg/mL) and peptides (MIC = 11.77–59.66 μg/mL) [19].
Not only can wasp venom be utilized for the green synthesis of nanoparticles, but wasp nests can also be used for this application. In this context, Lateef and colleagues utilized paper wasp (Polistes sp.) nests to biofabricate silver nanoparticles by interacting 1 mL of nest extract to 40 mL of 1 mM of silver nitrate (AgNO3) solution. UV, FTIR, EDX, and TEM were used for the characterization of fabricated-AgNPs. These particles show wide applications like antimicrobial activity against P. aeruginosa and K. granulomatis (at concentrations of 60, 80, and 100 µg/mL), the particles 100 µg/mL show 100% inhibition for Aspergillus flavus and Aspergillus niger. Furthermore, at 20 and 40 µg/mL, malachite green degradation was reported to be 64.3%–93.1% within 24 h of application; they also exhibited excellent blood anticoagulation and blood clot dissolution [142]. Additionally, the mud dauber wasp-associated fungus, Talaromyces sp. (CMB-W045), could be used to recover Fe2O3 nanoparticles from natural extracts [20].
Since two decades ago, some peptides (CPPs; cell-penetrating peptides) have been used in drug delivery applications as nano-carriers for macromolecule delivery systems as they can penetrate living cells. Among CPPs, there is a chimeric peptide called transportan (TP), which consists of 27 amino acids derived from a fusion of the first 12 residues of N-terminus of neuropeptide galanin and lysine residues, thus binding the remaining 14 C-terminal residues of mastoparan, a wasp venom peptide [143]. Subsequently, TP with d-arginine was used to synthesize a 36 amino acid peptide called T9 (dR). T9 (dR) can condense siRNA into nanoparticles sized between 350 and 550 nm and is also used for siRNA delivery into different cells; and to inhibit the replication of the influenza virus [144]. A similar study showed that TP nanoparticles could be used to improve cutaneous paclitaxel delivery and three-dimensional (3D)-bioengineered skin against tumor cancer cell lines [21]. Regarding the application of peptides in fields like agriculture nanobiotechnology, many CPPs can translocate macromolecular cargo complexes of drugs, proteins, or nucleic acids that are much larger than the pores of plasma membranes inside plant cells, which can lead to a potential revolution in the field of cell biotechnology [143].

4. Wasp Venom, Allergies, and Sensitization: A Double-Edged Sword

Wasp venom may result in anaphylaxis, anaphylactic shock, or even death [145,146]. Compared to airborne allergens such as mites and pollen [147], wasp venom is injected into the skin, reaching the blood directly, and initiating a general immune response [145]. The most frequent clinical picture starts with swelling at the sting site, expands over a 10-cm-diameter, and lasts for longer than 24 h in approximately 15–20% of the general population [148]. Venom allergy can cause various reactions, categorized as common local, wide local, systemic anaphylactic, systemic toxic, and rare reactions [149]. Up to 3% of the population suffers from potentially either systematic, anaphylactic, or toxic reactions after wasp stings [150], which could be life-threatening and lead to sudden death. Approximately fifty fatalities from wasp stings are reported every year [151]. Phospholipase A1 (Ves v 1), hyaluronidase (Ves v 2), protease vitellogenin (Ves v 6), and antigen 5 (Ves v 5) are the most allergenic components of the genera Dolichovespula, Polistes, Vespula, and Vespa [152,153,154]. Phospholipase A1, hyaluronidase, and antigen 5 are the three main allergens described for P. paulista venom and cause a high number of allergic reactions and dozens of fatal anaphylaxis cases annually in Brazil [155,156,157].
Accurate diagnosis of venom allergy is largely based on history, skin testing, radioallergosorbent test (RAST), the identification of particular IgE (sIgE) antibodies and basophilic activation testing (BAT), and is thus contingent on the choice of allergen-directed immunotherapy (AIT) [158,159,160]. The skin test is considered the golden standard diagnostic test due to its sensitivity to different types of venom, its ability to give results within a few minutes and to simulate a sting’s real-life effects better than in vitro tests. Recombinant allergen-based BAT testing is a highly specific but sometimes less sensitive tool. The severity of sting reactions was inversely correlated with total IgE levels [161,162,163], negative skin test results and non-detectable IgE despite BAT positivity were seen in 73% of patients following an insect sting and were associated with a systemic allergic reaction. Component-resolved assessments are a beneficial addition to the diagnostic continuum as long as they are used in accordance with existing procedures. Commercially available recombinant allergens have modern processes operating, such as spiking yellow jacket venom (YJV) extract with Ves v 5, providing increased exposure to the initial allergen detectors [164]. Recently, rPoly p 1 (recombinant of phospholipase A1 (PLA1)) was known as marker of P. paulista allergy with high sensitivity of 95% [165].
Emergency medicines and venom immunotherapy (VIT) are two main therapeutic options to treat wasp venom allergy [145]. Emergency medicine refers to administering antihistamines, epinephrine (adrenaline), and corticosteroids to patients with wasp venom allergies. First-line treatment of VIT is recommended. VIT is extremely effective in enhancing patients’ quality of life and greatly decreasing the risk of systemic responses before and after therapy [145]. VIT includes venom injections with an up-dosing period over several weeks and a 3–5 year maintenance period. VIT is considered safe as most adverse events are mild and local during the induction and maintenance period [166]. However, a significant medication period (3–5 years) results in high costs and low adherence to the therapy. In order to overcome this hindrance, a clinical routine has been introduced with ultra-rush protocols for up-dosing in just a few hours. Ultra-rush therapy is safe, quick, and compliant, and therefore cost-effective [23,166,167].
Another major challenge facing VIT is cross-reactivity. Cross-reactivity can occur due to similarities in the content and composition of Vespula species of single allergen venom. Vespinae (Vespula, Vespa, and Dolichovespula) have high cross-reactivity with each other but are less cross-reactive than Polistes. Compared to American species, cross-reactivity between European Polistes species is generally very high [153]. Cross-reactivity among venoms of different species may be a testing challenge [168]. False or positive cross-reaction outcomes can occur when IgE is directed toward antigenic carbohydrate determinants [169]. Seven recombinant antigens 5 of the Vespoidea groups were engineered and tested to resolve immunological IgE cross-reactivity at the molecular level [170].
Therefore, the measurement of specific IgE (sIgE) antibodies plays a major role. Immunoglobulin E (IgE) antibodies are the main actors, causing histamine release, lipid mediators, enzymes, cytokines, and chemokines responsible for the acute allergic response [171]. Component-resolved diagnosis (CRD) has been established recently, allowing the measurement of sIgE antibodies against Ves v1, Ves v5, and Pol d5, as well as cross-reactive carbohydrate determinants (CCDs). Estimations of IgE antibodies to Ves v 1, in addition to Ves v 5, should be included in diagnostic work [172]. Ves v 5 and Pol d 5 are 23-kDa proteins present in the Vespidae family of venom hornet (Vespula spp.) and wasp (Polistes dominulus) venom. Both proteins are known as antigen 5 and are recognized as the largest and most active allergens [173]. These tests were designed to help evaluate the therapeutic validity of any given sensitization, especially in patients with dual sensitization.
Several studies have been conducted to compare the immunoprotective efficacy and safety of different wasp venom preparations. In 1986, and for the first time, Mosbech and colleagues investigated the allergen immunotherapy effectiveness of yellow jacket wasp venom with three different preparations using thirty-two yellow jacket venom-allergic patients. The preparations were YJ Pharmalgen (YJ venom reconstituted in albumin containing saline diluent), YJ venom extract adsorbed to aluminum hydroxide, and YJ venom extract non-adsorbed. The results demonstrated that the three extracts showed the same immunological effectiveness (the amount of specific IgG was 44.2 ± 3.8 µg/mL) except for some minor varieties representation in IgG response induction for a longer period treatment with aluminum hydroxide-adsorbed extract [174,175].

5. Concluding Remarks

A limited number of ingredients in venom have been defined despite the wide diversity of wasp species. Wasps can synthesize toxic compounds as a part of their prey control mechanism to capture prey and defend their colonies. The venomous components of predator wasps are a complex mixture of high molecular weight proteins (e.g., enzymes and allergens), small peptides, and low molecular weight compounds (e.g., bioactive amino acids and amines). The accessibility of extremely delicate techniques, such as mass spectrometry, enables a more effective assessment of proteomics and transcriptomics of a restricted number of venoms to understand their impacts. For use in the medical sector, these compounds are promising as each compound was described by its effects, such as antimicrobial, anticancer, histamine release, and anti-inflammatory ability. Accumulating functional information on venom component bioactivity would promote the use of wasp venoms for pharmacological and medical purposes. Moreover, synthesis protocols should be developed to provide a higher quantity of active compounds for further evaluation in order to be applied in the industry. Some issues hinder its effective application, such as allergies to wasp venom, and restricted extraction amount. Many attempts have been made to reduce venomous side effects using VIT, which acts as a basic treatment for patients allergic to hymenopteran venom. VIT improved patient quality of life by reducing the risk of systemic reactions during, and after treatment.
Considering the numerous studies that have been conducted on wasp venom little has been reported on the practical application of these compounds. Among the wasp components, the antimicrobial properties of mastoparan are the most tested and confirmed [41]. Moreover, several wasp venom proteins have been registered in drug banks for use in allergenic testing, including proteins from Polistes metrics [176], Polistes exclamans [177], Vespula germanica [178], Polistes fuscatu [179], V. vulgaris [180], Dolichovespula arenaria [181], Dolichovespula maculate [182], Vespula pensylvanica [183], and Vespula maculifrons [184].
Although wasp venom remains mostly unexplored, recent findings have shown that venom is also abundant in peptides, and these peptides are similar to other venomous species. Up to 134 venom peptides have been entirely sequenced to date (Table 1). The pharmacological properties of insect venom peptides are identified as antimicrobial.

Author Contributions

Conceptualization, H.R.E.-S.; validation, H.R.E.-S. and S.A.M.K.; writing—original draft preparation, H.H.S., A.A.E.-W. and N.Y.; writing—review and editing, M.D., A.F.M.A., C.Z., A.H.A., H.E.T., S.H.D.M., M.M.A.-D., S.G.M., I.E.-G., G.K., Y.A.N., S.A.M.K. and H.R.E.-S.; supervision, H.R.E.-S.; funding acquisition, H.R.E.-S. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by Swedish Research links Grant VR 2016–05885.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

No new data were created or analyzed in this study. Data sharing is not applicable to this article.

Acknowledgments

Authors are very grateful to the Swedish Research links Grant VR 2016–05885 and the Department of Molecular Biosciences, Wenner-Grens Institute, Stockholm University, Sweden, for the financial support.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Konno, K.; Kazuma, K.; Nihei, K. Peptide toxins in solitary wasp venoms. Toxins 2016, 8, 114. [Google Scholar] [CrossRef] [Scilit]
  2. Lin, Z.; Cheng, Y.; Wang, R.J.; Du, J.; Volovych, O.; Li, J.C.; Hu, Y.; Lu, Z.Y.; Lu, Z.; Zou, Z. A metalloprotease homolog venom protein from a parasitoid wasp suppresses the toll pathway in host hemocytes. Front. Immunol. 2018, 9, 2301–2315. [Google Scholar] [CrossRef] [Scilit]
  3. Gong, J.; Yuan, H.; Gao, Z.; Hu, F. Wasp venom and acute kidney injury: The mechanisms and therapeutic role of renal replacement therapy. Toxicon 2019, 163, 1–7. [Google Scholar] [CrossRef] [Scilit]
  4. Kim, Y.; Son, M.; Noh, E.Y.; Kim, S.; Kim, C.; Yeo, J.H.; Park, C.; Lee, K.W.; Bang, W.Y. MP-V1 from the venom of social wasp Vespula vulgaris is a de novo type of mastoparan that displays superior antimicrobial activities. Molecules 2016, 21, 512. [Google Scholar] [CrossRef] [Scilit]
  5. Chen, W.; Yang, X.; Yang, X.; Zhai, L.; Lu, Z.; Liu, J.; Yu, H. Antimicrobial peptides from the venoms of Vespa bicolor Fabricius. Peptides 2008, 29, 1887–1892. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Wu, R.; Li, D.; Tang, Q.; Wang, W.; Xie, G.; Dou, P. A novel peptide from Vespa ducalis induces apoptosis in osteosarcoma cells by activating the p38 mapk and jnk signaling pathways. Biol. Pharm. Bull. 2018, 41, 458–464. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Danneels, E.L.; Gerlo, S.; Heyninck, K.; Van Craenenbroeck, K.; De Bosscher, K.; Haegeman, G.; De Graaf, D.C. How the venom from the ectoparasitoid wasp Nasonia vitripennis exhibits anti-inflammatory properties on mammalian cell lines. PLoS ONE 2014, 9, e96825. [Google Scholar] [CrossRef] [Scilit]
  8. Torres, M.D.T.; Silva, A.F.; Andrade, G.P.; Pedron, C.N.; Cerchiaro, G.; Ribeiro, A.O.; Oliveira, V.X.; de la Fuente-Nunez, C. The wasp venom antimicrobial peptide polybia-CP and its synthetic derivatives display antiplasmodial and anticancer properties. Bioeng. Transl. Med. 2020, 5, e10167. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Vila-Farrés, X.; López-Rojas, R.; Pachón-Ibáñez, M.E.; Teixidó, M.; Pachón, J.; Vila, J.; Giralt, E. Sequence-activity relationship, and mechanism of action of mastoparan analogues against extended-drug resistant Acinetobacter baumannii. Eur. J. Med. Chem. 2015, 101, 34–40. [Google Scholar] [CrossRef] [Scilit]
  10. Chionis, K.; Krikorian, D.; Koukkou, A.; Sakarellos-daitsiotis, M.; Panou-pomonis, E. Synthesis and biological activity of lipophilic analogs of the cationic antimicrobial active peptide anoplin. Pept. Sci. 2016, 22, 731–736. [Google Scholar] [CrossRef] [Scilit]
  11. Torres, M.D.T.; Pedron, C.N.; da Silva Lima, J.A.; da Silva, P.I.; da Silva, F.D.; Oliveira, V.X. Antimicrobial activity of leucine-substituted decoralin analogs with lower hemolytic activity. J. Pept. Sci. 2017, 23, 818–823. [Google Scholar] [CrossRef] [Scilit]
  12. Wang, K.; Zhang, B.; Zhang, W.; Yan, J.; Li, J.; Wang, R. Antitumor effects, cell selectivity and structure-activity relationship of a novel antimicrobial peptide polybia-MPI. Peptides 2008, 29, 963–968. [Google Scholar] [CrossRef] [Scilit]
  13. Wang, K.; Jia, F.; Dang, W.; Zhao, Y.; Zhu, R. Antifungal effect and action mechanism of antimicrobial peptide polybia-CP. Pept. Sci. 2016, 22, 28–35. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Wang, K.; Yan, J.; Liu, X.; Zhang, J.; Chen, R.; Zhang, B.; Dang, W.; Zhang, W.; Kai, M.; Song, J.; et al. Novel cytotoxity exhibition mode of polybia-CP, a novel antimicrobial peptide from the venom of the social wasp Polybia paulista. Toxicology 2011, 288, 27–33. [Google Scholar] [CrossRef] [Scilit]
  15. Coutinho, R.; Trentini, M.M.; De Castro, J.; Simon, K.S.; Bocca, A.L.; Silva, L.P.; Mortari, R.; Kipnis, A.; Junqueira-Kipnis, A.P. Antimycobacterial activity of a new peptide polydim-I isolated from Neotropical social wasp Polybia dimorpha. PLoS ONE 2016, 11, e0149729. [Google Scholar]
  16. Gonçalves, J.; Rangel, M.; Biolchi, A.; Alves, E.; Moreira, K.; Silva, L.; Mortari, M. Antinociceptive properties of the mastoparan peptide Agelaia-MPI isolated from social wasps. Toxicon 2016, 120, 15–21. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Da Silva, A.V.R.; De Souza, B.M.; Dos Santos Cabrera, M.P.; Dias, N.B.; Gomes, P.C.; Neto, J.R.; Stabeli, R.G.; Palma, M.S. The effects of the C-terminal amidation of mastoparans on their biological actions and interactions with membrane-mimetic systems. Biochim. Biophys. Acta—Biomembr. 2014, 1838, 2357–2368. [Google Scholar] [CrossRef] [Scilit]
  18. Hilchie, A.L.; Sharon, A.J.; Haney, E.F.; Hoskin, D.W.; Bally, M.B.; Franco, O.L.; Corcoran, J.A.; Hancock, R.E.W. Mastoparan is a membranolytic anti-cancer peptide that works synergistically with gemcitabine in a mouse model of mammary carcinoma. Biochim. Biophys. Acta—Biomembr. 2016, 1858, 3195–3204. [Google Scholar] [CrossRef] [Scilit]
  19. Jalaei, J.; Layeghi-Ghalehsoukhteh, S.; Hosseini, A.; Fazeli, M. Antibacterial effects of gold nanoparticles functionalized with the extracted peptide from Vespa orientalis wasp venom. J. Pept. Sci. 2018, 24, e3124–e3133. [Google Scholar] [CrossRef] [Scilit]
  20. Kalansuriya, P.; Quezada, M.; Espósito, B.P.; Capon, R.J. Talarazines A–E: Noncytotoxic iron (III) chelators from an Australian mud dauber wasp-associated fungus, talaromyces sp. (CMB-W045). J. Nat. Prod. 2017, 80, 609–615. [Google Scholar] [CrossRef] [Scilit]
  21. Pepe, D.; Carvalho, V.F.M.; McCall, M.; de Lemos, D.P.; Lopes, L.B. Transportan in nanocarriers improves skin localization and antitumor activity of paclitaxel. Int. J. Nanomed. 2016, 11, 2009–2019. [Google Scholar]
  22. Perkins, J.B.; Yates, A.B. Allergy to stinging insects: Diagnosis and management. EMJ Allergy Immunol. 2018, 3, 99–105. [Google Scholar]
  23. Pospischil, I.M.; Kagerer, M.; Cozzio, A.; Angelova-Fischer, I.; Guenova, E.; Ballmer-Weber, B.; Hoetzenecker, W. Comparison of the safety profiles of 3 different Hymenoptera venom immunotherapy protocols: A retrospective 2-center study of 143 patients. Int. Arch. Allergy Immunol. 2020, 181, 783–789. [Google Scholar] [CrossRef] [Scilit]
  24. Sahiner, U.M.; Durham, S.R. Hymenoptera venom allergy: How does venom immunotherapy prevent anaphylaxis from bee and wasp stings? Front. Immunol. 2019, 10, 1959–1966. [Google Scholar] [CrossRef] [Scilit]
  25. Baracchi, D.; Tragust, S. Venom as a component of external immune defense. In Evolution of Venomous Animals and Their Toxins; Gopalakrishnakone, P., Malhotra, A., Eds.; Springer Nature Switzerland AG: Cham, Switzerland, 2017; Volume 11, pp. 213–233. ISBN 9789400764583. [Google Scholar]
  26. Chen, X.; Zhang, L.; Wu, Y.; Wang, L.; Ma, C.; Xi, X.; Bininda-Emonds, O.R.P.; Shaw, C.; Chen, T.; Zhou, M. Evaluation of the bioactivity of a mastoparan peptide from wasp venom and of its analogues designed through targeted engineering. Int. J. Biol. Sci. 2018, 14, 599–607. [Google Scholar] [CrossRef] [Scilit]
  27. Danneels, E.L.; Formesyn, E.M.; de Graaf, D.C. Exploring the potential of venom from Nasonia vitripennis as therapeutic agent with high-throughput screening tools. Toxins 2015, 7, 2051–2070. [Google Scholar] [CrossRef] [Scilit]
  28. Czaikoski, P.G.; Menaldo, D.L.; Marcussi, S.; Baseggio, A.L.; Fuly, A.L.; Paula, R.C.; Quadros, A.U.; Romao, P.R.; Buschini, M.L.; Cunha, F.Q.; et al. Anticoagulant and fibrinogenolytic properties of the venom of Polybia occidentalis social wasp. Blood Coagul. Fibrinolysis 2010, 21, 653–659. [Google Scholar] [CrossRef] [Scilit]
  29. Hoshina, M.M.; Santos, L.D.; Palma, M.S.; Marin-morales, M.A. Cytotoxic, genotoxic/antigenotoxic and mutagenic/antimutagenic effects of the venom of the wasp Polybia paulista. Toxicon 2013, 72, 64–70. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Yang, X.; Wang, Y.; Lee, W.H.; Zhang, Y. Antimicrobial peptides from the venom gland of the social wasp Vespa tropica. Toxicon 2013, 74, 151–157. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  31. Jalaei, J.; Fazeli, M.; Rajaian, H.; Shekarforoush, S.S. In vitro antibacterial effect of wasp (Vespa orientalis) venom. J. Venom. Anim. Toxins Incl. Trop. Dis. 2014, 20, 22–27. [Google Scholar] [CrossRef] [Scilit]
  32. Baracchi, D.; Mazza, G.; Turillazzi, S. From individual to collective immunity: The role of the venom as antimicrobial agent in the Stenogastrinae wasp societies. J. Insect Physiol. 2011, 58, 188–193. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Pålsson-McDermott, E.M.; O’Neill, L.A.J. Targeting immunometabolism as an anti-inflammatory strategy. Cell Res. 2020, 30, 300–314. [Google Scholar] [CrossRef] [Scilit]
  34. Kaushik, D.K.; Thounaojam, M.C.; Mitra, A.; Basu, A. Vespa tropica venom suppresses lipopolysaccharide-mediated secretion of pro-inflammatory cyto-chemokines by abrogating nuclear factor-κ B activation in microglia. Inflamm. Res. 2014, 63, 657–665. [Google Scholar] [CrossRef] [Scilit]
  35. Saba, E.; Shafeeq, T.; Irfan, M.; Lee, Y.Y.; Kwon, H.W.; Seo, M.G.; Park, S.J.; Lee, K.Y.; Rhee, M.H. Anti-inflammatory activity of crude venom isolated from parasitoid wasp, Bracon hebetor Say. Mediat. Inflamm. 2017, 2017, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Danneels, E.L.; Rivers, D.B.; de Graaf, D.C. Venom proteins of the parasitoid wasp Nasonia vitripennis: Recent discovery of an untapped pharmacopee. Toxins 2010, 2, 494–516. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. De Castro e Silva, J.; Lopes do Couto, L.; de Oliveira Amaral, H.; Maria Medeiros Gomes, F.; Avohay Alves Campos, G.; Paulino Silva, L.; Renata Mortari, M. Neuropolybin: A new antiseizure peptide obtained from wasp venom. Biochem. Pharmacol. 2020, 181, 114119. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. De Azevedo, R.A.; Figueiredo, C.R.; Ferreira, A.K.; Matsuo, A.L.; Massaoka, M.H.; Girola, N.; Auada, A.V.; Farias, C.F.; Pasqualoto, K.F.; Rodrigues, C.P.; et al. Mastoparan induces apoptosis in B16F10-Nex2 melanoma cells via the intrinsic mitochondrial pathway and displays antitumor activity in vivo. Peptides 2015, 68, 113–119. [Google Scholar] [CrossRef] [Scilit]
  39. Hirai, Y.; Ueno, Y.; Yasuhara, T.; Yoshida, H.; Nakajima, T. A new mast cell degranulating peptide, polistes mastoparan, in the venom of Polistes jadwigae. Biomed. Res. 1980, 1, 185–187. [Google Scholar] [CrossRef] [Scilit]
  40. Da Silva, A.M.B.; Silva-Gonçalves, L.C.; Oliveira, F.A.; Arcisio-Miranda, M. Pronecrotic activity of cationic mastoparan peptides in human glioblastoma multiforme cells via membranolytic action. Mol. Neurobiol. 2018, 55, 5490–5504. [Google Scholar] [CrossRef] [Scilit]
  41. Vila-Farres, X.; Garcia de la Maria, C.; López-Rojas, R.; Pachón, J.; Giralt, E.; Vila, J. In vitro activity of several antimicrobial peptides against colistin-susceptible and colistin-resistant Acinetobacter baumannii. Clin. Microbiol. Infect. 2012, 18, 383–387. [Google Scholar] [CrossRef] [Scilit]
  42. Mizuno, K.; Nakahata, N.; Ohizumi, Y. Characterization of mastoparan-induced histamine release from RBL-2H3 cells. Toxicon 1998, 36, 447–456. [Google Scholar] [CrossRef] [Scilit]
  43. Yamada, Y.; Shinohara, Y.; Kakudo, T.; Chaki, S.; Futaki, S.; Kamiya, H.; Harashima, H. Mitochondrial delivery of mastoparan with transferrin liposomes equipped with a pH-sensitive fusogenic peptide for selective cancer therapy. Int. J. Pharm. 2005, 303, 1–7. [Google Scholar] [CrossRef] [Scilit]
  44. Nakahata, N.; Imata, K.; Okawa, T.; Watanabe, Y.; Ishimoto, H.; Ono, T.; Ohizumi, Y.; Nakanishi, H. Mastoparan elicits prostaglandin E 2 generation and inhibits inositol phosphate accumulation via different mechanisms in rabbit astrocytes Norimichi. Biochim. Biophys. Acta (BBA)—Molecular Cell Res. 1996, 1310, 60–66. [Google Scholar] [CrossRef] [Scilit]
  45. Irazazabal, L.N.; Porto, W.F.; Ribeiro, S.M.; Casale, S.; Humblot, V.; Ladram, A.; Franco, O.L. Selective amino acid substitution reduces cytotoxicity of the antimicrobial peptide mastoparan. Biochim. Biophys. Acta—Biomembr. 2016, 1858, 2699–2708. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. De Souza, B.M.; Cabrera, M.P.D.S.; Gomes, P.C.; Dias, N.B.; Stabeli, R.G.; Leite, N.B.; Neto, J.R.; Palma, M.S. Structure-activity relationship of mastoparan analogs: Effects of the number and positioning of Lys residues on secondary structure, interaction with membrane-mimetic systems and biological activity. Peptides 2015, 72, 164–174. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Galeane, M.C.; Gomes, P.C.; De L Singulani, J.; De Souza, B.M.; Palma, M.S.; Mendes-Giannini, M.J.S.; Almeida, A.M.F. Study of mastoparan analog peptides against Candida albicans and safety in zebrafish embryos (Danio rerio). Future Microbiol. 2019, 14, 1087–1097. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Ha, Y.J.; Kim, S.W.; Lee, C.W.; Bae, C.H.; Yeo, J.H.; Kim, I.S.; Gal, S.W.; Hur, J.; Jung, H.K.; Kim, M.J.; et al. Anti-Salmonella activity modulation of mastoparan V1—A wasp venom toxin—Using protease inhibitors, and its efficient production via an Escherichia coli secretion system. Toxins 2017, 9, 321. [Google Scholar] [CrossRef] [Scilit]
  49. Ho, C.L.; Hwang, L.L. Structure and biological activities of a new mastoparan isolated from the venom of the hornet Vespa basalis. Biochem. J. 1991, 274, 453–456. [Google Scholar] [CrossRef] [Scilit]
  50. Ho, C.L.; Hwang, L.L.; Lin, Y.L.; Chen, C.T.; Yu, H.M.; Wang, K.T. Cardiovascular effects of mastoparan B and its structural requirements. Eur. J. Pharmacol. 1994, 259, 259–264. [Google Scholar] [PubMed]
  51. Park, N.G.; Yamato, Y.; Lee, S.; Sugihara, G. Interaction of mastoparan-B from venom of a hornet in taiwan with phospholipid bilayers and its antimicrobial activity. Biopolymers 1995, 36, 793–801. [Google Scholar] [CrossRef] [Scilit]
  52. Hirai, Y.; Yasuhara, T.; Yoshida, H.; Nakajima, T. A new mast cell degranulating peptide, mastoparan-M, in the venom of the hornet Vespa mandarinia. Biomed. Res. 1981, 2, 447–449. [Google Scholar] [CrossRef] [Scilit]
  53. Wu, T.M.; Chou, T.C.; Ding, Y.A.; Li, M.L. Stimulation of TNF-α, IL-1β and nitrite release from mouse cultured spleen cells and lavaged peritoneal cells by mastoparan M. Immunol. Cell Biol. 1999, 77, 476–482. [Google Scholar] [CrossRef] [Scilit]
  54. Li, M.; Liao, R.; Qiu, J.; Wang, Z.; Wu, T. Antimicrobial activity of synthetic all- D mastoparan M. Int. J. Antimicrob. Agents 2000, 13, 203–208. [Google Scholar] [CrossRef] [Scilit]
  55. Konno, K.; Hisada, M.; Fontana, R.; Lorenzi, C.C.B.; Naoki, H.; Itagaki, Y.; Miwa, A.; Kawai, N.; Nakata, Y.; Yasuhara, T.; et al. Anoplin, a novel antimicrobial peptide from the venom of the solitary wasp Anoplius samariensis. Biochim. Biophys. Acta—Protein Struct. Mol. Enzymol. 2001, 1550, 70–80. [Google Scholar] [CrossRef] [Scilit]
  56. Zhu, L.; Fu, C.; Zhang, S.; Chen, W.; Jin, Y. Novel cytotoxic exhibition mode of antimicrobial peptide anoplin in MEL cells, the cell line of murine Friend leukemia virus-induced leukemic cells. Pept. Sci. 2013, 19, 566–574. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Ifrah, D.; Doisy, X.; Ryge, T.S.; Hansen, P.R. Structure-activity relationship study of anoplin. J. Pept. Sci. 2005, 11, 113–121. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Perez, M.; Santos, D.O.S.; Arcisio-miranda, M.; Broggio, T.; Ruggiero, R.; Ao, J.O. Study of the mechanism of action of anoplin, a helical antimicrobial decapeptide with ion channel-like activity, and the role of the amidated C -terminus. J. Pept. Sci. 2008, 661–669. [Google Scholar]
  59. Won, A.; Khan, M.; Gustin, S.; Akpawu, A.; Seebun, D.; Avis, T.J.; Leung, B.O.; Hitchcock, A.P.; Ianoul, A. Investigating the effects of L- to D-amino acid substitution and deamidation on the activity and membrane interactions of antimicrobial peptide anoplin. Biochim. Biophys. Acta—Biomembr. 2011, 1808, 1592–1600. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Wang, Y.; Chen, J.; Zheng, X.; Yang, X.; Ma, P.; Cai, Y.; Zhang, B.; Chen, Y. Design of novel analogues of short antimicrobial peptide anoplin with improved antimicrobial activity. J. Pept. Sci. 2014, 20, 945–951. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Konno, K.; Rangel, M.; Oliveira, J.S.; dos Santos Cabrera, M.P.; Fontana, R.; Hirata, I.Y.; Hide, I.; Nakata, Y.; Mori, K.; Kawano, M.; et al. Decoralin, a novel linear cationic α-helical peptide from the venom of the solitary eumenine wasp Oreumenes decoratus. Peptides 2007, 28, 2320–2327. [Google Scholar] [CrossRef] [Scilit]
  62. Torres, M.D.T.; Andrade, G.P.; Sato, R.H.; Pedron, C.N.; Manieri, T.M.; Cerchiaro, G.; Ribeiro, A.O.; de la Fuente-Nunez, C.; Oliveira, V.X. Natural and redesigned wasp venom peptides with selective antitumoral activity. Beilstein J. Org. Chem. 2018, 14, 1693–1703. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Torres, M.D.T.; Pedron, C.N.; Araújo, I.; Silva, P.I.; Silva, F.D.; Oliveira, V.X. Decoralin analogs with increased resistance to degradation and lower hemolytic activity. ChemistrySelect 2017, 2, 18–23. [Google Scholar] [CrossRef] [Scilit]
  64. Torres, M.D.T.; Silva, A.F.; Pedron, C.N.; Capurro, M.L. Peptide design enables reengineering of an inactive wasp venom peptide into synthetic antiplasmodial agents. ChemistrySelect 2018, 3, 5859–5863. [Google Scholar] [CrossRef] [Scilit]
  65. Ribeiro, S.P.; Mendes, M.A.; Dos Santos, L.D.; De Souza, B.M.; Marques, M.R.; De Azevedo, W.F.; Palma, M.S. Structural and functional characterization of N-terminally blocked peptides isolated from the venom of the social wasp Polybia paulista. Peptides 2004, 25, 2069–2078. [Google Scholar] [CrossRef] [Scilit]
  66. Luong, H.X.; Kim, D.H.; Lee, B.J.; Kim, Y.W. Antimicrobial activity and stability of stapled helices of polybia-MP1. Arch. Pharm. Res. 2017, 40, 1414–1419. [Google Scholar] [CrossRef] [Scilit]
  67. Dos Santos Cabrera, M.P.; Arcisio-Miranda, M.; Gorjão, R.; Leite, N.B.; De Souza, B.M.; Curi, R.; Procopio, J.; Ruggiero Neto, J.; Palma, M.S. Influence of the bilayer composition on the binding and membrane disrupting effect of polybia-MP1, an antimicrobial mastoparan peptide with leukemic T-lymphocyte cell selectivity. Biochemistry 2012, 51, 4898–4908. [Google Scholar] [CrossRef] [Scilit]
  68. Brigatte, P.; Cury, Y.; De Souza, B.M.; Baptista-Saidemberg, N.B.; Saidemberg, D.M.; Gutierrez, V.P.; Palma, M.S. Hyperalgesic and edematogenic effects of peptides isolated from the venoms of honeybee (Apis mellifera) and neotropical social wasps (Polybia paulista and Protonectarina sylveirae). Amino Acids 2011, 40, 101–111. [Google Scholar] [CrossRef] [Scilit]
  69. De Souza, B.M.; Dos Santos Cabrera, M.P.; Neto, J.R.; Palma, M.S. Investigating the effect of different positioning of lysine residues along the peptide chain of mastoparans for their secondary structures and biological activities. Amino Acids 2011, 40, 77–90. [Google Scholar] [CrossRef] [Scilit]
  70. Wang, K.; Yan, J.; Dang, W.; Liu, X.; Chen, R.; Zhang, J.; Zhang, B.; Zhang, W.; Kai, M.; Yan, W.; et al. Membrane active antimicrobial activity and molecular dynamics study of a novel cationic antimicrobial peptide polybia-MPI, from the venom of Polybia paulista. Peptides 2013, 39, 80–88. [Google Scholar] [CrossRef] [Scilit]
  71. Wang, K.; Yan, J.; Dang, W.; Xie, J.; Yan, B.; Yan, W.; Sun, M.; Zhang, B.; Ma, M.; Zhao, Y.; et al. Dual antifungal properties of cationic antimicrobial peptides polybia-MPI: Membrane integrity disruption and inhibition of biofilm formation. Peptides 2014, 56, 22–29. [Google Scholar] [CrossRef] [Scilit]
  72. Wang, K.; Yan, J.; Chen, R.; Dang, W.; Zhang, B.; Zhang, W.; Song, J.; Wang, R. Membrane-active action mode of polybia-CP, a novel antimicrobial peptide isolated from the venom of Polybia paulista. Antimicrob. Agents Chemother. 2012, 56, 3318–3323. [Google Scholar] [CrossRef] [Scilit]
  73. Rangel, M.; Dos Santos Castro, F.F.; Mota-Lima, L.D.; Clissa, P.B.; Martins, D.B.; Dos Santos Cabrera, M.P.; Mortari, M.R. Polydim-I antimicrobial activity against MDR bacteria and its model membrane interaction. PLoS ONE 2017, 12, e0178785. [Google Scholar] [CrossRef] [Scilit]
  74. Mendes, M.A.; De Souza, B.M.; Marques, M.R.; Palma, M.S. Structural and biological characterization of two novel peptides from the venom of the neotropical social wasp Agelaia pallipes pallipes. Toxicon 2004, 44, 67–74. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Wang, K.; Yan, J.; Chen, R.; Dang, W.; Zhang, B.; Zhang, W.; Song, J.; Wang, R.; Yan, J.; Chen, R.; et al. Membrane perturbation action mode and structure-activity relationships of protonectin, a novel antimicrobial peptide from the venom of the neotropical social wasp Agelaia pallipes pallipes. Antimicrob. Agents Chemother. 2013, 56, 4632–4639. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  76. Wang, F.; Manku, S.; Hall, D.G. Solid phase syntheses of polyamine toxins HO-416b and PhTX-433. Use of an efficient polyamide reduction strategy that facilitates access to branched analogues. Org. Lett. 2000, 2, 1581–1583. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  77. Choi, S.K.; Kalivretenos, A.G.; Usherwood, P.N.R.; Nakanishi, K. Labeling studies of photolabile philanthotoxins with nicotinic acetylcholine receptors: Mode of interaction between toxin and receptor. Chem. Biol. 1995, 2, 23–32. [Google Scholar] [CrossRef] [Scilit]
  78. Kachel, H.S.; Franzyk, H.; Mellor, I.R. Philanthotoxin analogues that selectively inhibit ganglionic nicotinic acetylcholine receptors with exceptional potency. J. Med. Chem. 2019, 62, 6214–6222. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  79. Crandall, Y.M.; Bruch, M.D. Characterization of the structure and dynamics of mastoparan-X during folding in a TFE by CD and NMR spectroscopy. Biopolymers 2007, 89, 197–209. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  80. Henriksen, J.R.; Etzerodt, T.; Gjetting, T.; Andresen, T.L. Side chain hydrophobicity modulates therapeutic activity and membrane selectivity of antimicrobial peptide mastoparan-X. PLoS ONE 2014, 9, e91007. [Google Scholar] [CrossRef] [Scilit]
  81. Konno, K.; Hisada, M.; Naoki, H.; Itagaki, Y.; Kawai, N.; Miwa, A.; Yasuhara, T.; Morimoto, Y.; Nakata, Y. Structure and biological activities of eumenine mastoparan-AF (EMP-AF), a new mast cell degranulating peptide in the venom of the solitary wasp (Anterhynchium flavomarginatum micado). Toxicon 2000, 38, 1505–1515. [Google Scholar] [CrossRef] [Scilit]
  82. Ramon, R.; De Souza, B.M.; Havt, A.; Mario, S.; Pires, R.; Lins, E.; Albuquerque, D.; Nogueira, V.; Maria, A.; Martins, C. Trypanocidal activity of mastoparan from Polybia paulista wasp venom by interaction with TcGAPDH. Toxicon 2017, 137, 168–172. [Google Scholar]
  83. Xu, X.; Li, J.; Lu, Q.; Yang, H.; Zhang, Y.; Lai, R. Two families of antimicrobial peptides from wasp (Vespa magnifica) venom. Toxicon 2006, 47, 249–253. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Hisada, M.; Konno, K.; Itagaki, Y.; Naoki, H.; Nakajima, T. Sequencing wasp venom peptides by endopeptidase digestion and nested collision-induced dissociation/post-source decay methods. Rapid Commun. Mass Spectrom. 2002, 16, 1040–1048. [Google Scholar] [CrossRef] [Scilit]
  85. Parkinson, N.; Smith, I.; Audsley, N.; Edwards, J. Purification of pimplin, a paralytic heterodimeric polypeptide from venom of the parasitoid wasp Pimpla hypochondriaca, and cloning of the cDNA encoding one of the subunits. Insect Biochem. Mol. Biol. 2002, 32, 1769–1773. [Google Scholar] [CrossRef] [Scilit]
  86. Hisada, M.; Konno, K.; Itagaki, Y.; Naoki, H.; Nakajima, T. Advantages of using nested collision induced dissociation/post-source decay with matrix-assisted laser desorption/ionization time-of-flight mass spectrometry: Sequencing of novel peptides from wasp venom. Rapid Commun. Mass Spectrom. 2000, 14, 1828–1834. [Google Scholar] [CrossRef] [Scilit]
  87. Pizzo, A.B.; Beleboni, R.O.; Gomes Carolino, R.O.; de Oliveira, L.; Miranda, A.; Coutinho-Netto, J.; Fontana, A.C.K.; dos Santos, W.F. Isolation and chemical characterization of agelaiatoxin8 (AvTx8) from Agelaia vicina wasp venom and its biological effects on GABA neurotransmission. J. Biochem. Mol. Toxicol. 2017, 31, e21941. [Google Scholar] [CrossRef] [Scilit]
  88. Baptista-Saidemberg, N.B.; Saidemberg, D.M.; Palma, M.S. Profiling the peptidome of the venom from the social wasp Agelaia pallipes pallipes. J. Proteom. 2011, 74, 2123–2137. [Google Scholar] [CrossRef] [Scilit]
  89. Konno, K.; Hisada, M.; Itagaki, Y.; Naoki, H.; Kawai, N.; Miwa, A.; Yasuhara, T.; Takayama, H. Isolation and structure of pompilidotoxins, novel peptide neurotoxins in solitary wasp venoms. Biochem. Biophys. Res. Commun. 1998, 250, 612–616. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  90. Baptista-Saidemberg, N.B.; Saidemberg, D.M.; de Souza, B.M.; César-Tognoli, L.M.; Ferreira, V.M.; Mendes, M.A.; dos Santos Cabrera, M.P.; Neto, J.R.; Palma, M.S. Protonectin (1–6): A novel chemotactic peptide from the venom of the social wasp Agelaia pallipes pallipes. Toxicon 2010, 56, 880–889. [Google Scholar] [CrossRef] [Scilit]
  91. Murata, K.; Shinada, T.; Ohfune, Y.; Hisada, M.; Yasuda, A.; Naoki, H.; Nakajima, T. Novel mastoparan and protonectin analogs isolated from a solitary wasp, Orancistrocerus drewseni drewseni. Amino Acids 2009, 37, 389–394. [Google Scholar] [CrossRef] [Scilit]
  92. Gomes, P.C.; de Souza, B.M.; Dias, N.B.; Brigatte, P.; Mourelle, D.; Arcuri, H.A.; dos Santos Cabrera, M.P.; Stabeli, R.G.; Neto, J.R.; Palma, M.S. Structure–function relationships of the peptide paulistine: A novel toxin from the venom of the social wasp Polybia paulista. Biochim. Biophys. Acta (BBA)—Gen. Subj. 2014, 1840, 170–183. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  93. Argiolas, A.; Pisano, J.J. Isolation and characterization of two new peptides, mastoparan C and crabrolin, from the venom of the European hornet, Vespa crabro. J. Biol. Chem. 1984, 259, 10106–10111. [Google Scholar] [CrossRef] [Scilit]
  94. Aschi, M.; Bozzi, A.; Luzi, C.; Bouchemal, N.; Sette, M. Crabrolin, a natural antimicrobial peptide: Structural properties. J. Pept. Sci. 2017, 23, 693–700. [Google Scholar] [CrossRef] [Scilit]
  95. Konno, K.; Hisada, M.; Naoki, H.; Itagaki, Y.; Fontana, R.; Rangel, M.; Oliveira, J.S.; dos Santos Cabrera, M.P.; Neto, J.R.; Hide, I.; et al. Eumenitin, a novel antimicrobial peptide from the venom of the solitary eumenine wasp Eumenes rubronotatus. Peptides 2006, 27, 2624–2631. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Rangel, M.; dos Santos Cabrera, M.P.; Kazuma, K.; Ando, K.; Wang, X.; Kato, M.; Nihei, K.; Hirata, I.Y.; Cross, T.J.; Garcia, A.N.; et al. Chemical and biological characterization of four new linear cationic α-helical peptides from the venoms of two solitary eumenine wasps. Toxicon 2011, 57, 1081–1092. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  97. Konno, K.; Kazuma, K.; Rangel, M.; Stolarz-de-Oliveira, J.; Fontana, R.; Kawano, M.; Fuchino, H.; Hide, I.; Yasuhara, T.; Nakata, Y. New mastoparan peptides in the venom of the solitary eumenine wasp Eumenes micado. Toxins 2019, 11, 155. [Google Scholar] [CrossRef] [Scilit]
  98. Dias, N.B.; De Souza, B.M.; Gomes, P.C.; Brigatte, P.; Palma, M.S. Peptidome profiling of venom from the social wasp Polybia paulista. Toxicon 2015, 107, 290–303. [Google Scholar] [CrossRef] [Scilit]
  99. Klochkov, S.G.; Pikhtelev, A.R.; Kozlovskii, V.I. A new peptide from venom of the East-European hornet Vespa orientalis. Mass spectrometric de novo sequence. Chem. Nat. Compd. 2008, 44, 63–66. [Google Scholar] [CrossRef] [Scilit]
  100. Dos Anjos, L.C.; Gomes, F.M.M.; Do Couto, L.L.; Mourão, C.A.; Moreira, K.G.; Silva, L.P.; Mortari, M.R. Anxiolytic activity and evaluation of potentially adverse effects of a bradykinin-related peptide isolated from a social wasp venom. Life Sci. 2016, 149, 153–159. [Google Scholar] [CrossRef] [Scilit]
  101. Andrew, K.; Kim, K.; Kim, A.; Han, Y.; Young, W. Selective anti-tumor activities of venom peptides from the lesser paper wasp Parapolybia varia. J. Asia. Pac. Entomol. 2016, 19, 821–828. [Google Scholar]
  102. Yu, H.; Yang, H.; Ma, D.; Lv, Y.; Liu, T.; Zhang, K.; Lai, R.; Liu, J. Vespid chemotactic peptide precursor from the wasp, Vespa magnifica (Smith). Toxicon 2007, 50, 377–382. [Google Scholar] [CrossRef] [Scilit]
  103. Zhou, Z. The first report of kininogen from invertebrates. Biochem. Biophys. Res. Commun. 2006, 347, 1099–1102. [Google Scholar] [CrossRef] [Scilit]
  104. Baek, J.H.; Lee, S.H. Isolation and molecular cloning of venom peptides from Orancistrocerus drewseni (Hymenoptera: Eumenidae). Toxicon 2010, 55, 711–718. [Google Scholar] [CrossRef] [Scilit]
  105. Baek, J.H.; Ji, Y.; Shin, J.S.; Lee, S.; Lee, S.H. Venom peptides from solitary hunting wasps induce feeding disorder in lepidopteran larvae. Peptides 2011, 32, 568–572. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  106. Ye, J.; Zhao, H.; Wang, H.; Bian, J.; Zheng, R. A defensin antimicrobial peptide from the venoms of Nasonia vitripennis. Toxicon 2010, 56, 101–106. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  107. Lopes, K.S.; Campos, G.A.A.; Camargo, L.C.; de Souza, A.C.B.; Ibituruna, B.V.; Magalhães, A.C.M.; da Rocha, L.F.; Garcia, A.B.; Rodrigues, M.C.; Ribeiro, D.M.; et al. Characterization of two peptides isolated from the venom of social wasp Chartergellus communis (Hymenoptera: Vespidae): Influence of multiple alanine residues and C-terminal amidation on biological effects. Peptides 2017, 95, 84–93. [Google Scholar] [CrossRef] [Scilit]
  108. Montana, V.; Sontheimer, H. Bradykinin promotes the chemotactic invasion of primary brain tumors. J. Neurosci. 2011, 31, 4858–4867. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  109. Yasuhara, T.; Mantel, P.; Nakajima, T.; Piek, T. Two kinins isolated from an extract of the venom reservoirs of the solitary wasp Megascolia flavifrons. Toxicon 1987, 25, 527–535. [Google Scholar] [CrossRef] [Scilit]
  110. Mortari, M.R.; Cunha, A.O.S.; Carolino, R.O.G.; Coutinho-Netto, J.; Tomaz, J.C.; Lopes, N.P.; Coimbra, N.C.; Dos Santos, W.F. Inhibition of acute nociceptive responses in rats after i.c.v. injection of Thr 6-bradykinin, isolated from the venom of the social wasp, Polybia occidentalis. Br. J. Pharmacol. 2007, 151, 860–869. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  111. Picolo, G.; Hisada, M.; Moura, A.B.; Machado, M.F.M.; Sciani, J.M.; Conceição, I.M.; Melo, R.L.; Oliveira, V.; Lima-Landman, M.T.R.; Cury, Y.; et al. Bradykinin-related peptides in the venom of the solitary wasp Cyphononyx fulvognathus. Biochem. Pharmacol. 2010, 79, 478–486. [Google Scholar] [CrossRef] [Scilit]
  112. Silva, J.C.; Neto, L.M.; Neves, R.C.; Gonçalves, J.C.; Trentini, M.M.; Mucury-filho, R.; Smidt, K.S.; Fensterseifer, I.C.; Silva, O.N.; Lima, L.D.; et al. Evaluation of the antimicrobial activity of the mastoparan Polybia-MPII isolated from venom of the social wasp Pseudopolybia vespiceps testacea (Vespidae, Hymenoptera). Int. J. Antimicrob. Agents 2017, 49, 167–175. [Google Scholar] [CrossRef] [Scilit]
  113. Tuichibaev, M.U.; Tashmukhamedov, B.A. Lysophospholipase activity of orientotoxin from the venom of the hornet Vespa orientalis. Chem. Nat. Compd. 1996, 20, 765–766. [Google Scholar] [CrossRef] [Scilit]
  114. Tuĭchibaev, M.U.; Tashmukhamedov, B.A.; Gotgil’f, I.G.; Mazannik, L.G. Orientotoxin--a new presynaptic neurotoxin from the venom of the giant hornet Vespa orientalis. Bioorg. Khim. 1984, 10, 318–322. [Google Scholar] [PubMed]
  115. L’vov, V.M.; Kolmakova, A.A.; Akhunov, A.A.; Mukhamedov, I.F. Vasoactive peptides from venom of the hornet Vespa orientalis physiochemical and functional characterization. Chem. Nat. Compd. 1988, 24, 218–221. [Google Scholar] [CrossRef] [Scilit]
  116. Moore, E.L.; Arvidson, R.; Banks, C.; Urenda, J.P.; Duong, E.; Mohammed, H.; Adams, M.E. Ampulexins: A new family of peptides in venom of the emerald jewel wasp, Ampulex compressa. Biochemistry 2018, 57, 1907–1916. [Google Scholar] [CrossRef] [Scilit]
  117. Turillazzi, S.; Mastrobuoni, G.; Dani, F.R.; Moneti, G.; Pieraccini, G.; La Marca, G.; Bartolucci, G.; Perito, B.; Lambardi, D.; Cavallini, V.; et al. Dominulin A and B: Two new antibacterial peptides identified on the cuticle and in the venom of the social paper wasp Polistes dominulus using MALDI-TOF, MALDI-TOF/TOF, and ESI-ion trap. J. Am. Soc. Mass Spectrom. 2006, 17, 376–383. [Google Scholar] [CrossRef] [Scilit]
  118. Mendes, M.A.; Palma, M.S. Two new bradykinin-related peptides from the venom of the social wasp Protopolybia exigua (Saussure). Peptides 2006, 27, 2632–2639. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  119. Ombati, R.; Wang, Y.; Du, C.; Lu, X.; Li, B.; Nyachieo, A.; Li, Y.; Yang, S.; Lai, R. A membrane disrupting toxin from wasp venom underlies the molecular mechanism of tissue damage. Toxicon 2018, 148, 56–63. [Google Scholar] [CrossRef] [Scilit]
  120. Yshii, L.M.; Souza, G.H.M.F.; Camargo, E.A.; Eberlin, M.N.; Ribela, M.T.C.P.; Muscará, M.N.; Hyslop, S.; Costa, S.K.P. Characterization of the mechanisms underlying the inflammatory response to Polistes lanio lanio (paper wasp) venom in mouse dorsal skin. Toxicon 2009, 53, 42–52. [Google Scholar] [CrossRef] [Scilit]
  121. Zhou, S.T.; Luan, K.; Ni, L.L.; Wang, Y.; Yuan, S.M.; Che, Y.H.; Yang, Z.Z.; Zhang, C.G.; Yang, Z. Bin A strategy for quality control of vespa magnifica (Smith) venom based on HPLC fingerprint analysis and multi-component separation combined with quantitative analysis. Molecules 2019, 24, 2920. [Google Scholar] [CrossRef] [Scilit]
  122. Hernández, C.; Konno, K.; Salceda, E.; Vega, R.; Zaharenko, A.J.; Soto, E. Sa12b peptide from solitary wasp inhibits ASIC currents in rat dorsal root ganglion neurons. Toxins 2019, 11, 585. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  123. Freire, D.O.; da Cunha, N.B.; Leite, M.L.; Kostopoulos, A.G.C.; da Silva, S.N.B.; de Souza, A.C.B.; Nolasco, D.O.; Franco, O.L.; Mortari, M.R.; Dias, S.C. Wasp venom peptide, synoeca-MP, from Synoeca surinama shows antimicrobial activity against human and animal pathogenic microorganisms. Pept. Sci. 2020, 112, e24141. [Google Scholar] [CrossRef] [Scilit]
  124. Yang, H.; Xu, X.; Ma, D.; Zhang, K.; Lai, R. A phospholipase A1 platelet activator from the wasp venom of Vespa magnifica (Smith). Toxicon 2008, 51, 289–296. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  125. Santos, L.D.; Santos, K.S.; de Souza, B.M.; Arcuri, H.A.; Cunha-Neto, E.; Castro, F.M.; Kalil, J.E.; Palma, M.S. Purification, sequencing and structural characterization of the phospholipase A1 from the venom of the social wasp Polybia paulista (Hymenoptera, Vespidae). Toxicon 2007, 50, 923–937. [Google Scholar] [CrossRef] [Scilit]
  126. Aoki, J.; Inoue, A.; Makide, K.; Saiki, N.; Arai, H. Structure and function of extracellular phospholipase A1 belonging to the pancreatic lipase gene family. Biochimie 2007, 89, 197–204. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  127. Liu, N.-Y.; Xu, Z.-W.; Yan, W.; Ren, X.-M.; Zhang, Z.-Q.; Zhu, J.-Y. Venomics reveals novel ion transport peptide-likes (ITPLs) from the parasitoid wasp Tetrastichus brontispae. Toxicon 2018, 141, 88–93. [Google Scholar] [CrossRef] [Scilit]
  128. De Oliveira, M.R.; Palma, M.S. Polybitoxins: A group of phospholipases A2 from the venom of the neotropical social wasp paulistinha (Polybia paulista). Toxicon 1998, 36, 189–199. [Google Scholar] [CrossRef] [Scilit]
  129. Mueller, U.; Elliott, W.; Reisman, R.; Ishay, J.; Walsh, S.; Steger, R.; Wypych, J.; Arbesman, C. Comparison of biochemical and immunologic properties of venoms from four hornet species. J. Allergy Clin. Immunol. 1981, 67, 290–298. [Google Scholar] [CrossRef] [Scilit]
  130. Allalouf, D.; Ber, A.; Ishay, J. Hyaluronidase activity of extracts of venom sacs of a number of vespinae (Hymenoptera). Comp. Biochem. Physiol.—Part B Biochem. 1972, 43, 119–123. [Google Scholar] [CrossRef] [Scilit]
  131. Rungsa, P.; Incamnoi, P.; Sukprasert, S.; Uawonggul, N.; Klaynongsruang, S.; Daduang, J.; Patramanon, R.; Roytrakul, S.; Daduang, S. Cloning, structural modelling and characterization of VesT2s, a wasp venom hyaluronidase (HAase) from Vespa tropica. J. Venom. Anim. Toxins Incl. Trop. Dis. 2016, 22, 1–11. [Google Scholar] [CrossRef] [Scilit]
  132. Bernheimer, A.W.; Avigad, L.S.; Schmidt, J.O.; Ishay, J.S. Proteins in venoms of two wasps, Polistes comanchus navajoe and Vespa orientalis. Comp. Biochem. Physiol. Part C Comp. Pharmacol. 1982, 71, 203–207. [Google Scholar] [CrossRef] [Scilit]
  133. Arcuri, H.A.; Kalil, J.E.; Palma, M.S. Using proteomic strategies for sequencing and post-translational modifications assignment of antigen-5, a major allergen from the venom of the social wasp Polybia paulista. J. Proteome Res. 2013, 13, 855–865. [Google Scholar]
  134. Yamamoto, T.; Arimoto, H.; Kinumi, T.; Oba, Y.; Uemura, D. Identification of proteins from venom of the paralytic spider wasp, Cyphononyx dorsalis. Insect Biochem. Mol. Biol. 2007, 37, 278–286. [Google Scholar] [CrossRef] [Scilit]
  135. Wu, M.; Ye, G.; Zhu, J.; Chen, X.; Hu, C. Isolation and characterization of an immunosuppressive protein from venom of the pupa-specific endoparasitoid Pteromalus puparum. J. Invertebr. Pathol. 2008, 99, 186–191. [Google Scholar] [CrossRef] [Scilit]
  136. Asgari, S.; Zareie, R.; Zhang, G.; Schmidt, O. Isolation and characterization of a novel venom protein from an endoparasitoid, Cotesia rubecula (Hym: Braconidae). Arch. Insect Biochem. Physiol. 2003, 53, 92–100. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  137. Han, J.; You, D.; Xu, X.; Han, W.; Lu, Y.; Lai, R.; Meng, Q. An anticoagulant serine protease from the wasp venom of Vespa magnifica. Toxicon 2008, 51, 914–922. [Google Scholar] [CrossRef] [Scilit]
  138. Thiéry, D.; Bonnard, O.; Riquier, L.; De Revel, G.; Monceau, K. An alarm pheromone in the venom gland of Vespa velutina: Evidence revisited from the European invasive population. Entomol. Gen. 2018, 38, 145–156. [Google Scholar] [CrossRef] [Scilit]
  139. Elmquist, D.C.; Landolt, P.J.; Cooper, W.R.; Reed, H.; Foutz, J.; Clepper, T.; Kacprzyk, B.; Teig, D.; Zack, R.S. The venom compound N-(3-methylbutyl) acetamide attracts several Polistes (Fuscopolistes) Species (Hymenoptera: Vespidae). J. Econ. Entomol. 2020, 113, 1073–1079. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  140. Dani, F.R.; Jeanne, R.L.; Clarke, S.R.; Jones, G.R.; Morgan, E.D.; Francke, W.; Turillazzi, S. Chemical characterization of the alarm pheromone in the venom of Polybia occidentalis and of volatiles from the venom of P. sericea. Physiol. Entomol. 2000, 25, 363–369. [Google Scholar] [CrossRef] [Scilit]
  141. Lateef, A.; Ojo, S.A.; Elegbede, J.A. The emerging roles of arthropods and their metabolites in the green synthesis of metallic nanoparticles. Nanotechnol. Rev. 2016, 5, 601–622. [Google Scholar] [CrossRef] [Scilit]
  142. Lateef, A.; Akande, M.A.; Ojo, S.A.; Folarin, B.I.; Gueguim-Kana, E.B.; Beukes, L.S. Paper wasp nest-mediated biosynthesis of silver nanoparticles for antimicrobial, catalytic, anticoagulant, and thrombolytic applications. 3 Biotech 2016, 6, 140. [Google Scholar] [CrossRef] [Scilit]
  143. Chugh, A.; Eudes, F.; Shim, Y. Cell-penetrating peptides: Nanocarrier for macromolecule delivery in living cells. IUBMB Life 2010, 62, 183–193. [Google Scholar] [CrossRef] [Scilit]
  144. Zhang, C.; Ren, W.; Liu, Q.; Tan, Z.; Li, J.; Tong, C. Transportan-derived cell-penetrating peptide delivers siRNA to inhibit replication of influenza virus in vivo. Drug Des. Devel. Ther. 2019, 13, 1059. [Google Scholar] [CrossRef] [Scilit]
  145. Schiener, M.; Graessel, A.; Ollert, M.; Schmidt-Weber, C.B.; Blank, S. Allergen-specific immunotherapy of Hymenoptera venom allergy–also a matter of diagnosis. Hum. Vaccines Immunother. 2017, 13, 2467–2481. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  146. Chai, L.; Yang, X.; Liu, M.; Liu, C.; Han, L.; Guo, H.; Li, C.; Sun, Y.; Li, X.; Xiao, M.; et al. Biopanning of allergens from wasp sting patients. Biosci. Rep. 2018, 38, BSR20181113–BSR20181129. [Google Scholar] [CrossRef] [Scilit]
  147. Lâm, H.T.; Ekerljung, L.; Bjerg, A.; Vən Tuòng, N.; Lundbäck, B.; Rönmark, E. Sensitization to airborne allergens among adults and its impact on allergic symptoms: A population survey in northern Vietnam. Clin. Transl. Allergy 2014, 4, 6. [Google Scholar] [CrossRef] [Scilit]
  148. Charpin, D.; Birnbaum, J.; Vervloet, D. Epidemiology of Hymenoptera allergy. Clin. Exp. Allergy 1994, 24, 1010–1015. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  149. Boz, C.; Velioglu, S.; Ozmenoglu, M. Acute disseminated encephalomyelitis after bee sting. Neurol. Sci. 2003, 23, 313–315. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  150. Bonifazi, F.; Jutel, M.; Biló, B.M.; Birnbaum, J.; Muller, U. Prevention and treatment of hymenoptera venom allergy: Guidelines for clinical practice. Allergy 2005, 60, 1459–1470. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  151. Bilo, F.; Bonifazi, B.M. Epidemiology of insect venom anaphylaxis. Curr. Opin. Allergy Clin. Immunol. 2008, 8, 330–337. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  152. Hoffman, D.R. Allergens in Hymenoptera venom XV: The immunologic basis of vespid venom cross-reactivity. J. Allergy Clin. Immunol. 1985, 75, 611–613. [Google Scholar] [CrossRef] [Scilit]
  153. Bilo, B.M.; Rueff, F.; Mosbech, H.; Bonifazi, F.; Oude-Elberink, J.N.G.; Hypersensitivity, E.I.G. on I.V. Diagnosis of Hymenoptera venom allergy. Allergy 2005, 60, 1339–1349. [Google Scholar] [CrossRef] [Scilit]
  154. An, S.; Chen, L.; Wei, J.-F.; Yang, X.; Ma, D.; Xu, X.; Xu, X.; He, S.; Lu, J.; Lai, R. Purification and characterization of two new allergens from the venom of Vespa magnifica. PLoS ONE 2012, 7, e31920–e31926. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  155. Bazon, M.L.; Silveira, L.H.; Simioni, P.U.; Brochetto-Braga, M.R. Current advances in immunological studies on the vespidae venom antigen 5: Therapeutic and prophylaxis to hypersensitivity responses. Toxins 2018, 10, 305. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  156. Bazon, M.L.; Perez-Riverol, A.; Dos Santos-Pinto, J.R.A.; Fernandes, L.G.R.; Lasa, A.M.; Justo-Jacomini, D.L.; Palma, M.S.; De Lima Zollner, R.; Brochetto-Braga, M.R. Heterologous expression, purification and immunoreactivity of the antigen 5 from Polybia paulista wasp venom. Toxins 2017, 9, 259. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  157. Dos Santos, L.D.; Santos, K.S.; Pinto, J.R.A.; Dias, N.B.; De Souza, B.M.; Dos Santos, M.F.; Perales, J.; Domont, G.B.; Castro, F.M.; Kalil, J.E.; et al. Profiling the proteome of the venom from the social wasp Polybia paulista: A clue to understand the envenoming mechanism. J. Proteome Res. 2010, 9, 3867–3877. [Google Scholar] [CrossRef] [Scilit]
  158. Peternelj, A.; Silar, M.; Bajrovic, N.; Adamic, K.; Music, E.; Kosnik, M.; Korosec, P. Diagnosis of venom allergy by flow cytometry. Correction with clinical history, skin tests, specific IgE, histamine and leukotriene C4 release. Clin. Exp. Allergy 2000, 30, 1166–1171. [Google Scholar]
  159. Eberlein, B.; Krischan, L.; Darsow, U.; Ollert, M.; Ring, J. Double positivity to bee and wasp venom: Improved diagnostic procedure by recombinant allergen-based IgE testing and basophil activation test including data about cross-reactive carbohydrate determinants. J. Allergy Clin. Immunol. 2012, 130, 155–161. [Google Scholar] [CrossRef] [Scilit]
  160. Gattinger, P.; Lupinek, C.; Kalogiros, L.; Silar, M.; Zidarn, M.; Korosec, P.; Koessler, C.; Novak, N.; Valenta, R.; Mittermann, I. The culprit insect but not severity of allergic reactions to bee and wasp venom can be determined by molecular diagnosis. PLoS ONE 2018, 13, e0199250. [Google Scholar] [CrossRef] [Scilit]
  161. Peternelj, A.; Silar, M.; Bajrovic, N.; Adamic, K.; Music, E.; Kosnik, M.; Korosec, P. Diagnostic value of the basophil activation test in evaluating Hymenoptera venom sensitization. Wien. Klin. Wochenschr. 2009, 12, 334–348. [Google Scholar] [CrossRef] [Scilit]
  162. Sturm, G.J.; Heinemann, A.; Schuster, C.; Wiednig, M.; Groselj-Strele, A.; Sturm, E.M.; Aberer, W. Ifluence of total IgE levels on severity on sting reactions in hymenoptera venom allergy. Allergy 2007, 62, 884–889. [Google Scholar] [CrossRef] [Scilit]
  163. Balzer, L.; Pennino, D.; Blank, S.; Seismann, H.; Darsow, U.; Schnedler, M.; McIntyre, M.; Ollert, M.W.; Durham, S.R.; Spillner, E.; et al. Basophil activation test using recombinant allergens: Highly specific diagnostic method complementing routine tests in wasp venom allergy. PLoS ONE 2014, 9, e108619. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  164. Tomsitz, D.; Brockow, K. Component resolved diagnosis in Hymenoptera anaphylaxis. Curr. Allergy Asthma Rep. 2017, 17, 38–46. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  165. Perez-Riverol, A.; Musacchio-Lasa, A.; Fernandes, L.G.R.; dos Santos-Pinto, J.R.A.; Esteves, F.G.; Bazon, M.L.; de Lima Zollner, R.; Palma, M.S.; Brochetto-Braga, M.R. Improved production of the recombinant phospholipase A1 from Polybia paulista wasp venom expressed in bacterial cells for use in routine diagnostics. 3 Biotech 2020, 10, 217–228. [Google Scholar] [CrossRef] [Scilit]
  166. Kołaczek, A.; Skorupa, D.; Antczak-Marczak, M.; Kuna, P.; Kupczyk, M. Safety and efficacy of venom immunotherapy: A real life study. Postep. Dermatol. Alergol. 2017, 34, 159–167. [Google Scholar] [CrossRef] [Scilit]
  167. Köhli-Wiesner, A.; Stahlberger, L.; Bieli, C.; Stricker, T.; Lauener, R. Induction of specific immunotherapy with hymenoptera venoms using ultrarush regimen in children: Safety and tolerance. J. Allergy 2011, 2012, 1–5. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  168. Perez-Riverol, A.; Fernandes, L.G.R.; Musacchio Lasa, A.; dos Santos-Pinto, J.R.A.; Moitinho Abram, D.; Izuka Moraes, G.H.; Jabs, F.; Miehe, M.; Seismman, H.; Palma, M.S.; et al. Phospholipase A1-based cross-reactivity among venoms of clinically relevant Hymenoptera from Neotropical and temperate regions. Mol. Immunol. 2018, 93, 87–93. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  169. Jappe, U.; Raulf-Heimsoth, M.; Hoffmann, M.; Burow, G.; Hübsch-Müller, C.; Enk, A. In vitro hymenoptera venom allergy diagnosis: Improved by screening for cross-reactive carbohydrate determinants and reciprocal inhibition. Allergy 2006, 61, 1220–1229. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  170. Schiener, M.; Eberlein, B.; Moreno-Aguilar, C.; Pietsch, G.; Serrano, P.; McIntyre, M.; Schwarze, L.; Russkamp, D.; Biedermann, T.; Spillner, E.; et al. Application of recombinant antigen 5 allergens from seven allergy-relevant Hymenoptera species in diagnostics. Allergy Eur. J. Allergy Clin. Immunol. 2017, 72, 98–108. [Google Scholar] [CrossRef] [Scilit]
  171. Holt, P.G.; Macaubas, C.; Stumbles, P.A.; Sly, P.D. The role of allergy in the development of asthma. Nature 1999, 402, 12–17. [Google Scholar] [CrossRef] [Scilit]
  172. Seyfarth, F.; Schliemann, S. Diagnostic precision of component-resolved vs. extract-based in vitro diagnosis of Hymenoptera venom allergy: Effects on clinical management. J. Ger. Soc. Dermatol. 2017, 15, 507–515. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  173. Yoshida, N.; Hirata, H.; Watanabe, M.; Sugiyama, K.; Arima, M.; Fukushima, Y.; Ishii, Y. Improved sensitivity to venom specific-immunoglobulin E by spiking with the allergen component in Japanese patients suspected of Hymenoptera venom allergy. Allergol. Int. 2015, 64, 248–252. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  174. Mosbech, H.; Malling, H.; Biering, I.; Böwadt, H.; Søborg, M.; Weeke, B.; Løwenstein, H. Immunotherapy with yellow jacket venom: A comparative study including three different extracts, one adsorbed to aluminium hydroxide and two unmodified. Allergy 1986, 41, 95–103. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  175. Bilò, M.B.; Antonicelli, L.; Bonifazi, F. Purified vs. nonpurified venom immunotherapy. Curr. Opin. Allergy Clin. Immunol. 2010, 10, 330–336. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  176. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11029 (accessed on 19 January 2021).
  177. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11028 (accessed on 19 January 2021).
  178. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11030 (accessed on 19 January 2021).
  179. Drug Bank. Available online: https://go.drugbank.com/drugs/DB10959 (accessed on 19 January 2021).
  180. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11033 (accessed on 19 January 2021).
  181. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10957 (accessed on 19 January 2021).
  182. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10958 (accessed on 19 January 2021).
  183. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB11031 (accessed on 19 January 2021).
  184. Drug Bank. Available online: https://www.drugbank.ca/drugs/DB10956 (accessed on 19 January 2021).
Figure 1. Wasp venom as a source of bioactive compounds and its biological activities and application.
Figure 1. Wasp venom as a source of bioactive compounds and its biological activities and application.
Toxins 13 00206 g001
Figure 2. Some of the volatile compounds identified from wasp venom.
Figure 2. Some of the volatile compounds identified from wasp venom.
Toxins 13 00206 g002
Table 1. Isolated constitutes from Wasp-Venom and their biological activity.
Table 1. Isolated constitutes from Wasp-Venom and their biological activity.
Wasp-Scientific NameIsolated Compounds Biological ActivityReference
Peptides
Vespa xanthoptera
Vespula lewisii
Mastoparan (MPX) (INWKGIAAMAKKLL-NH2)Cytotoxic against Glioblastoma multiforme (T98G) cell, 60% inhibition at 20 μmol/L (in vitro)
Anti-Escherichia coli and anti-Lactococcus lactis at MIC 8, and 2.5 µM, respectively (in vitro).
[40,79,80]
Anterhynchium flavomarginatum micadoMastoparan-AF (EMP-AF)
(INLLKIAKGIIKSL-NH2)
Blocked lobster neuromuscular transmission.
Mediated depolarization of the muscle membrane, often leading to a weak contraction of the muscle at 0.1 ± 1 mM (in vitro).
[1,81]
V. lewisii, Vespa tropica and Polybia paulistaMastoparan (INLKALAALAKKIL)Induces apoptosis in B16F10-Nex2 melanoma cells treated with 165 µM.
Potent anti-inflammatory.
Shows activity against colistin-susceptible Acinetobacter baumannii and colistin-resistant Acinetobacter baumannii at MIC50 value of 4, and 8 mg/l, respectively.
Antimicrobial activity on the epimastigote, trypomastigote and amastigote forms of Trypanosoma cruzi Y strain via dose-dependent growth inhibition (in vitro).
[38,41,82]
Vespa basalisMastoparan B (LKLKSIVSWAKKVL)Anti-Enterococcus faecalis and anti-Bucillus subtilis at MIC of 3.13 mg/mL (in vitro).[51]
V. basalisMastoparan-I1 (INLKAIAALVKKVL)ND[51]
V. basalisMastoparan-A (IKWKAILDAVKKVI)ND[51]
V. basalisMastoparan-T (INLKAIAAFAKKLL)ND[51]
Vespula vulgarisMastoparan V1 (INWKKIKSIIKAAMN)Potent antimicrobial activity against Streptococcus mutans and Salmonella enterica at 50 µM (in vitro).[4]
Vespa orientalis L.Mastoparan (HRI)
(INLKAIAALVKKVL-NH2)
Cytotoxic towards T98G cells and give 80% inhibition at 20 μmol/L (in vitro). [40]
Vespa crabroMastoparan-C (MP-C) (LNLKALLAVAKKIL-NH2)Inhibition of the biofilm formation by Staphylococcus Aureus and Pseudomonas aeruginosa at 32 μM MBIC (in vitro).[26]
V. tropicaMastoparan-VT1 (INLKAIAALAKKLL)Anti-E. faecalis at 2.5 µg/mL (in vitro).[30]
V. tropicaMastoparan-VT2 (NLKAIAALAKKLL)Anti-E. faecalis, anti-E.coli and anti-S.aureus at 5 µg/mL (in vitro).[30]
V. tropicaMastoparan-VT3 (INLKAITALAKKLL)Anti-S. aureus and anti-Candida parapsilosis at 2.5 µg/mL (in vitro).[30]
V. tropicaMastoparan-VT4 (INLKAIAPLAKKLL)Anti-Bacillus pyocyaneus, anti-P. aeruginosa, and anti-Bacillus dysenteriae at 10 µg/mL (in vitro). [30]
V. tropicaMastoparan-VT5 (VIVKAIATLASKLL)Anti-Candida albicans at 40 µg/mL (in vitro).[30]
V.tropicaMastoparan-VT6 (INLKAIAALVKKLL)Anti-S. aureus and anti-B. dysenteriae at 20 µg/mL (in vitro).[30]
V. tropicaMastoparan-VT7 (INLKAIAALARNY)Anti-E. faecalis at 5 µg/mL (in vitro).[30]
Polistes rothneyi iwataiPolistes-mastoparan-R1 (Pm-R1) (INWLKLGKKILGAI-NH2)Has histamine-releasing activities from rat mast cells (EC50 = 0.09 µM) (in vitro).[80]
P. rothneyi iwatai.Polistes-mastoparan-R3 (Pm-R3)
(INWLKLGKQILGAL-NH2)
Has histamine-releasing activities from rat mast cells (EC50 = 0.19 mM) (in vitro).[80]
Vespa magnificaPeptide 5e (FLPIIAKLLGLL) Anti-S. aureus, MIC = 5 µg/mL (in vitro).[83]
V. magnificaPeptide 5f (FLPIPRPILLGLL)Anti-S. aureus, MIC = 10 µg/mL (in vitro).[83]
V. magnificaPeptide 5g (FLIIRRPIVLGLL)Anti-S. aureus MIC = 10 µg/mL (in vitro).[83]
V. magnificaPeptide 12a (INWKGIAAMAKKLL)Anti-S. Aureus, and anti-C. albicans at MIC = 3.7 µg/mL (in vitro).[83]
V. magnificaPeptide 12b (INWKGIAAMKKLL)Anti-S. aureus MIC = 3.7 µg/mL (in vitro).[83]
P. dimorphaPolydim-I (AVAGEKLWLLPHLLKMLLTPTP)Antimycobacterial activity at 7.6 μg/mL (in vitro).
Anti-S. aureus at MIC50 4.1 µg/mL (in vitro).
[15,73]
Anoplus samariensisAs-126 (EDPPVVKMK-NH2)ND[84]
Batozonellus maculifronsBm-10 (ETAPVPKAISK-NH2)ND[84]
A. samariensisAnoplin
(GLLKRIKTLL-NH2)
Cytotoxic for T98G cells, gives 10% inhibition at 20 μmol/L (in vitro).[40,55]
P. hypochondriacaPimplin (KRKPPRPNPKPKPIP)Effective against Musca domestica at dose of 40 ng (in vitro). [85]
A. flavomarginatum micado Af-113 (INLLKIAKGIIKSLNH2)ND[86]
Agelaia vicinaAgelaiatoxin-8 (AVTx8) (INWKLGKALNALLNH2)Inhibits gamma-aminobutyric acid (GABA) neurotransmission uptake at EC50 value of 0.09 ± 0.04 µM and maximum inhibition of 97 ± 5% (in vitro).[87]
Agelaia pallipes pallipes AgelaiaMP-I
(INWLKLGKAIIDAL-NH2)
Has hemolytic activity at ED50 = 60 µM. [28]
A. pallipes pallipes AgelaiaMP-II (INWKAILQRIKKML-NH2)Has hemolytic activity at ED50 = 240 µM (in vitro).[88]
Anoplius samariensis, and Batozonellus
maculifrons
Pompilidotoxins (α-PMTXs) (RIKIGLFDQLSKL-NH2)Facilitates synaptic transfer in the motor neuron of the lobster and delays downregulation of the sodium channel (in vitro). [89]
A. samariensis, and B.
maculifrons
β-PMTXs
(RIKIGLFDQRSKL-NH2)
Facilitates synaptic transfer in the neuromuscular junction of the lobster, and slows the sodium channel inactivation (in vitro).[89]
A. flavomarginatum micadoEumenine mastoparan-AF (EMP-AF)
(INLLKIAKGIIKSL-NH2)
Effective hemolytic response in human erythrocytes.
Enhancing degranulation of rat peritoneal mast cells and RBL-2H3 cells (in vitro).
[81]
Agelaia pallipes pallipes, and Protonectarina sylveiraeProtonectin
(ILGTILGLLKGL-NH2)
Antibacterial activity towards Gram-positive and Gram-negative bacteria.
Releasing Lactate dehydrogenase (LDH) from mast cells.
Chemotaxis against polymorphonuclear leukocytes (PMNL) (in vitro).
([90]
A. pallipes pallipes, and P. sylveiraeProtonectin (1–6)
(ILGTIL-NH2)
ND[90]
A. pallipes pallipesProtonectin (1–4)-OH
(ILGT-OH)
Has poor hemolytic activity at ED50 = 1 mM (in vitro).[88]
A. pallipes pallipesProtonectin (7–12)
(GLLKGL-NH2)
ND[88]
A. pallipes pallipesProtonectin (1–5)-OH
(ILGTI-OH)
Has weak hemolytic activity at ED50 = 1 mM (in vitro).[88]
A. pallipes pallipesProtonectin (1–6)-OH
(ILGTIL-OH)
Has poor hemolytic activity at ED50 = 1 mM (in vitro).[88]
Orancistrocerus drewseniOrancis-protonectin (ILGIITSLLKSL-NH2)Has hemolytic activity of the sheep blood cells at 50 µM (in vitro).[91]
A. pallipes pallipesPallipine-I (GIIDDQQCKKKPGQSSPVCS-OH)ND[88]
A. pallipes pallipesPallipine-II (SIKHKICKLLERTLKLTT PFC-NH2)ND[88]
A. pallipes pallipesPallipine-III
(SIKKHKCIALLERRGGSKLPFC-NH2)
ND[88]
P. paulistaPaulistine (SIKDKICKIIQCGKKLPFT-NH2)
(oxidized form)
Causes mast cells degranulation or hemolysis (in vitro).[92]
Vespa mandariniaVes-CP-M (FLPILGKLLSGL-NH2)ND[65]
V. xanthopteraVes-CP-X (FLPIIAKLLGGLL)ND[65]
Paravespula lewisiVes-CP-P (FLPIIAKLVSGLL)ND[65]
V. tropicaVes-CP-T (FLPILGKILGGLL)ND[65]
V. crabroCrabrolin (FLPLILRKIVTAL-NH2)Releases histamine from rat peritoneal mast cells at ED50 of 11.8 µg/mL (in vitro).[93,94]
Eumenes rubronotatusEumenitin (LNLKGIFKKVASLLT)Shows antimicrobial activity against S. aureus, Staphylococcus saprophytius, E. coli at MIC = 6 µM (in vitro).[95]
E. rubrofemoratusEumenine mastoparan-ER (EMP-ER) (FDIMGLIKKVAGAL-NH2)Anti-C. albicans at MIC 7.5 µM.
Has Leishmanicidal activity at IC50 20 µM (in vitro).
[96]
Eumenes micadoEumenine mastoparan-EM1 (LKLMGIVKKVLGAL-NH2)Anti-S. aureus and anti-E. coli at MIC 7 µM (in vitro).
Has Leishmanicidal activity with an IC50 of 36 µM (in vitro).
[97]
E. micadoEumenine mastoparan-EM2 (LKLLGIVKKVLGAI-NH2)Anti-S. aureus and anti-E. coli at MIC of 3 µM (in vitro).
Has Leishmanicidal activity with an IC50 of 36 µM (in vitro).
[97]
Eumenes fraterculusEumenine mastoparan-EF (EMP-EF) (FDVMGIIKKIASALNH2Anti-C. albicans at MIC of 7.5 µM.
Has Leishmanicidal behavior at IC50 of 40 µM (in vitro).
[96]
O. drewseniEumenine mastoparan-OD
(EMP-OD)
(GRILSFIKGLAEHL-NH2)
Induces hemolysis of the sheep blood cells at 50 µM (in vitro).[91]
E. rubrofemoratusEumenitin-R (LNLKGLIKKVASLLN)Anti-Sreptococcus pyogenes, anti-Micrococcus luteus, and anti-Stenotrophomonas maltophilia at MIC of 15 µM.
Anti-B. subtilis at MIC 7.5 µM (in vitro).
[96]
E. fraterculusEumenitin-F (LNLKGLFKKVASLLT)Anti-C. albicans at MIC of 7.5 µM.
Has Leishmanicidal activity at IC50 of 52 µM (in vitro).
Anti-S. maltophilia at MIC of 15 µM (in vitro).
[96]
P. paulista.
Polybia-CP
(ILGTILGLLKSL-NH2)
Anti-microbial against S. aureus and B. subtilis at 15 µg/mL compared with 0.5 and 18 µg/mL of tetracycline (in vitro).[14,65]
P. paulistaPolybia-CP 2 (ILGTILGKIL-OH)Has chemotaxis, mast cell degranulation, and hemolytic activities (in vivo).[98]
Polybia-CP 3 (ILGTILGTFKSL-NH2)Has chemotaxis, mast cell degranulation, and hemolytic activities (in vivo).
Antiplasmodial and anticancer properties (in vitro).
[8,98]
P. paulistaPolybia-MP1
(IDWKKLLDAAKQIL-NH2)
Antitumor against bladder and prostate cancer cells.
Exhibits potent activity against S. aureus, MIC of 9 µΜ (in vitro).
Anti-C. albicans (EC50 = 12.9 μM) and C. neoformans (EC50 = 11 μM) (in vitro).
Fungicidal activity against Candida glabrata (EC50 = 8 μM) and C. albicans (EC50 = 16 μM) (in vitro).
Anti-E. coli, P. aeruginosa, B. subtilis, and S. aureus at MIC of 8, 8, 4, and 15 μg/mL compared to 2, 18, 18, and 0.5 of tetracycline (in vitro).
[64,85]
V. orientalis L.HR-1 (INLKAIAALVKKVL-NH2ND[99]
V. orientalis L.HR-2 (FLPLILGKLVKGLL-NH2)ND[99]
Polistes jadwigaePolisteskinin-J (RRRPPGFSPFR-OH)ND[98]
Pollistes chiensisPolisteskinin-C (SKRPPGFSPFR-OH)ND[98]
P. rothneyPolisteskinin-R (ARRPPGFTPFR-OH)Exerts potent anxiolytic effects at 6, 3, and 1.5 ηmol compared to positive control Diazepam (in vivo) [98,100]
Vespa analisVespakinin-A (GRPPGFSPFRVI-OH)ND[98]
Vespa mandaríniaVespakinin-X (ARPPGFSPFR-OH)ND[98]
V. magnifica, Parapolybia varia, V. tropicaVespid Chemotactic Peptides (VCP)Anti-tumor activities towards NIH-OVCAR-3 and SK-OV-3 ovarian cancer cell lines at concentrations higher than 10 μM (in vitro).[34,101]
V. magnifica (Smith)VCP-5h (FLPIIGKLLSGLL-NH2)MICs of 5, 25, and 30, µg/mL for S. aureus, C. albicans and E. coli, respectively (in vitro).[102]
Parapolybia variaVespakinin (Vespk)Antitumor activity to SK-OV-3 at 24 h post-treatment (in vitro).[101]
V. magnifica
Vespakinin-M GRPPGFSPFRIDND[103]
Batozonellus maculifronsPompilidotoxins (β-PMTXs) (RIKIGLFDQLSRL-NH2)Inactivation of the Na+ channel, and the Nav1.6 channel was more selective (in vitro).[1]
O. drewseniOdVP1 (GRILSFIKGLAEHL-NH2)
Anti-E. coli, and anti-C. albicans at MIC of 6 µM (in vitro).[104,105]
O. drewseniOdVP2 (ILGIITSLLKSL-NH2)Anti-S. aureus at MIC of 25 µg/mL.
Anti-gray mold Botrytis cinerea at MIC of 0.4 µM (in vitro).
[104,105]
O. drewseniOdVP3 (KDLHTVVSAILQAL-NH2)
Anti-gray mold B. cinerea at MIC of 5 µM (in vitro).
[104,105]
O. drewseniOdVP4
(LDPKVVQSLL-NH2)
ND[104]
Nasonia vitripennisDefensin-NV (VTCELLMFGGVVGDSACAANCLSMGKAGGSCNGGLCDCRKTTFKELWDKRFG)Anti-S. aureus, and Anti-B. cereus at MIC of 0.93 µM (in vitro).
Anti-B. dysenteriae at MIC of 0.46 µM (in vitro).
Anti-E. coli, and anti-C. albicans at MIC of 1.86 µM (in vitro).
Anti-P. aeruginosa at MIC of 9.3 µM (in vitro).
[106]
Chartergellus communisCommunis
(INWKAILGKIGK-COOH)
ND[107]
C. communisCommunis-AAAA (INWKAILGKIGKAAAAVNH2)Hemolytic activity at EC50 = 142.6 μM (in vitro).
Hyperalgesic effect at 2 nmol/animal (in vivo).
[107]
Cyphononyx
Fulvognathus
Bradykinin
(RPPGFSPFR)
Acts as a chemoattractant directing glioma cells into blood vessels in the brain of rats (in vivo).[108]
Megascolia flavifrons,
and Colpa interrupta
Megascoliakinin = Thr6BK-Lys-Ala (BK = bradykinin) (RPPGFTPFRKA)Prevents the synaptic transmission of the nicotinic acetylcholine receptor (nAChR) in the central nervous system of insect (in vitro).[109]
C. fulvognathus and
P. paulista
RA-Thr6 -Bradykinin (RARPPGFTPFR-OH)ND[98]
Polybia occidentalis, M. flavifrons, C. interrupta, and P. paulistaThreonine6-bradykinin
(Thr6-BK)
RPPGFTPFR-OH
Anti-nociceptive effects with approximately two-fold higher than bradykinin and morphine (in vivo). [98,110]
P. paulistaRA-Thr6 -Bradykinin-DT (RARPPGFTPFRDT-OH)ND[98]
C. fulvognathusFulvonin
(SIVLRGKAPFR)
Displays hyperalgesic impact after intraplantar injection in the rat paw pressure test (in vivo).[111]
C. fulvognathus
(Japan)
Cyphokinin (DTRPPGFTPFR)
Demonstrates hyperalgesic impact after intraplantar injection in the rat paw pressure test (in vivo).[111]
C. fulvognathus
(Japan)
Cd-146 (SETGNTVTVKGFSPLR)Shows hyperalgesic effect in the rat paw pressure test after intraplantar injection (in vivo).[111]
C. fulvognathusCd-125 (DTARLKWH)ND[111]
P. paulistaMastoparan (MPI)
(IDWKKLLDAAKQIL-NH2)
Cytotoxic towards T98G cells, gives 30% inhibition at 20 μmol/L (in vitro). [40]
Pseudopolybia vespicepsMastoparan Polybia-MPII (INWLKLGKMVIDAL-NH2)Anti-staphylococcal activity with an EC50 of 1.83 μM and EC90 of 2.90 μM (in vitro).
Mice treated with 5 mg/kg showed a decline in bacterial load from 108 to ca. 106 CFUs (in vitro).
Potent hemolytic activity against mouse cells (EC50 = 24.18 Μm, EC90 = 58.12 μM) (in vitro).
Inhibits the growth of C. neoformans (EC50 = 11 μM) and C. albicans (EC50 = 12.9 μM) (in vitro).
Anti-A. baumannii AB 0 at MIC of 12.5 µM while MIC against A. baumannii AB 53 and AB 72 was 6.25 µM (in vitro).
Adhesion inhibition for A. baumannii AB 02 and AB 72 at 25 µM while A. baumannii AB 53 was inhibited at a concentration of 12.5 µM (in vitro).
[28,112]
P. paulistaPolybia-MPIII (INWLKLGKAVIDAL)Anti-S. aureus, MIC of 19 μM (in vitro).[65]
P. paulistaPolybia-MP IV (IDWLKLRVISVIDL-NH2)Shows strong mast cell degranulation.
Has weak haemolytic activity, hypernociception and edema formation (in vitro).
[98]
P. paulistaPolybia-MP V (INWHDIAIKNIDAL-NH2)Medium mast cell degranulation, haemolytic activity and hypernociception (in vitro). [98]
P. paulistaPolybia-MP VI (IDWLKLGKMVM-OH)Medium haemolytic activity and hypernociception (in vitro).[98]
P. paulistaunk-1 (IPAGWAIVKV-NH2)Shows weak mast cell degranulation and haemolytic activity (in vitro).[98]
P. paulistaunk-2 (TGDSPDVR-OH)Shows weak mast cell degranulation and haemolytic activity, weak chemotaxis for PMNLs, and a range of weak to strong hypernociception and oedema formation (in vitro).[98]
V. orientalis L.Orientotoxin
(Neurotoxin)
Has lysophospholipase activity and inhibits both mediated and spontaneous release of the neurotransmitter from the presynaptic nerve membrane (in vivo).[113,114]
V. orientalis L.Peptide I (AGVILFGR-NH2)Histamine release from mast cells ED50 = 5.10−7 (in vivo).[115]
V. orientalis L.Peptide II (AGVIFRSP-NH2)Histamine release from mast cells ED50 = 3.10−6 (in vivo).[115]
Oreumenes
decoratus
Decoralin (De-NH2)
(SLLSLIRKLIT-NH2)
Has hemolytic activity at EC50 of 80 µM (in vitro).
Anti-S. aureus, MIC = 4 µM (in vitro).
Anti-B. Subtilis, MIC = 8 µM (in vitro).
Anti-C. albicans, MIC = 20 µM (in vitro).
Has leishmanicidal activity, IC50 =11 µM (in vitro).
[61]
V. ducalisVACP1
(AQKWLKYWKADKVKGFGRKIKKIWFG)
Potently inhibits cell proliferation and promotes the cell apoptosis of osteosarcoma (OS) cells, and this was concomitant with the activation of the JNK and p38 MAPK signaling pathway (in vitro). [6]
Emerald Jewel, and Ampulex compressaAmpulexin-1 (axn1) (CKDDYVNPKEQLGYDILEKLRQKP)ND[116]
Ampulexin -2 (axn2) (CQNDYVNPKLQFACDLLQKAKERQ)ND[116]
Ampulexin -3 axn3 SFSMLLQKAKERQND[116]
V. orientalisAuNPs+ peptide (INLKAIAALVKKV)Antibacterial using AuNPs against K. pneumoniae, B. cereus, S. mutans, S. typhimuriu, E. coli, and S. aureus, and with the inhibition zones of 9.21, 14.32, 14.71,19.21, 15.24 and 15.33 mm, respectively (in vitro).[19]
Vespa bicolor FabriciusV. chemotatic peptide (VESP-VBs) (FMPIIGRLMSGSL)Anti-S. aureus, MIC = 1 µg/mL (in vitro).[5]
V. bicolor FabriciusV. mastoparan (MP-VBs) (INMKASAAVAKKLL)Anti-S. aureus, MIC = 1.9 µg/mL (in vitro).[5]
Polistes dominulusDominulin A (INWKKIAEVGGKILSSL)Anti-B. Subtilis, and E. coli at MIC = 2 and 8 µg/mL, respectively (in vitro).[117]
P. dominulusDominulin B (INWKKIAEIGKQVLSAL)Anti-B. Subtilis, and E. coli at MIC = 2 and 8 µg/mL, respectively (in vitro).[17]
Protonectarina sylveiraeProtonectarina-MP (INWKALLDAAKKVL)Anti-B. subtilis and anti-S. Aureus MIC = 3.9 µg/mL (in vitro). [69]
Parapolybia indicaParapolybia-MP (INWKKMAATALKMI-NH2)Anti-S. aureus, MIC = 3.9 µg/mL (in vitro).[69]
P. jadwigaePolistes mastoparan (VDWKKIGQHIKSVL)Degranulation of mast cells at 5 nM/mL. [39]
V. magnifica (Smith)Vespid chemotactic peptide (VCP)MICs for S. aureus, C. albicans, and E. coli were 5, 25, and 30, µg/mL, respectively (in vitro).[102]
V. bicolor FabriciusVESP-VB1 (FMPIIGRLMSGSL)Anti-E. coli, MIC = 7.5 µg/mL (in vitro).
Anti-S. aureus, MIC = 1.9 µg/mL (in vitro).
Anti-P. aeruginosa, MIC = 3.75 µg/mL (in vitro).
Anti-C. albicans, MIC = 30 µg/mL (in vitro).
[5]
V. bicolor FabriciusMP-VB1 (INMKASAAVAKKLL)Anti-E. coli, MIC = 15 µg/mL (in vitro).
Anti-S. aureus, MIC = 3.75 µg/mL (in vitro).
Anti-P. aeruginosa, MIC = 15 µg/mL (in vitro).
Anti-C. albicans, MIC = 15 µg/mL (in vitro).
[5]
V. tropicaVCP-VT1Anti-E. coli, Enterobacter cloacae, and C. parapsilosis at 2.5 µg/mL and Anti-S. aureus at 1.2 µg/mL (in vitro). [30]
V. tropicaVCP-VT2
FLPIIGKLLSG
Antimicrobial against S. aureus, E. cloacae at 2.5 µg/mL (in vitro).[30]
Protopolybia exigua (Kinins)Protopolybiakinin-I
(DKNKKPIRVGGRRPPGFTR-OH)
Caused degranulation of 35% of the mast cells (in vitro).[118]
P. exiguaProtopolybiakinin-II (Kinins) (DKNKKPIWMAGFPGFTPIR-OH)Caused degranulation of 52 % of the mast cells (in vitro).[118]
V. mandariniaVESCP-M2 (FLPILAKILGGLL)Induces pain and severe tissue injury, oedema, cutaneous necrosis, and blister.[119]
Polistes lanio lanioPllTkP-I (QPPTPPEHRFPGLM)ND[120]
P. lanio lanioPllTkP-II (ASEPTALGLPRIFPGLM)ND[120]
V. magnifica (Smith)5-HydroxytryptamineND[121]
V. magnifica (Smith)Vespakinin-M (GRPPGFSPFRID-NH2)ND[121]
V. magnifica (Smith)Mastoparan M (INLKAIAALAKKLL-NH2) ND[121]
V. magnifica (Smith)Vespid chemotactic peptide M (FLPIIGKLLSGLL-NH2)ND[121]
Sphex argentatus argentatusSa12b (EDVDHVFLRF)Inhibits acid-sensing ion channels (ASIC) of rat dorsal root ganglion (DRG) neurons at IC50 of 81 nM while inhibiting it completely at 1 μM (in vivo).[122]
Isodontia harmandiSh5b(DVDHVFLRF-NH2)ND [122]
P. paulistaNeuropolybin
Antiseizure[37]
Synoeca surinamaSynoeca-MP
I/LNWI/LKI/LGKKI/LI/LASL/NH2
Antimicrobial activity, MIC50 values were 1.9, 2, 8.3, 5.2, and 3.5 μM for methicillin-resistant S. aureus—MRSA, E. coli ESBL, vancomycin-resistant E. Faecalis, P. aeruginosa metallo-ß-lactamase, and Klebsiella pneumoniae KPC, respectively (in vitro).
Anti-Candida species, with MICs varying from 10–40 μM (in vitro).
[123]
Enzymes and proteins
V. magnificaMagnifin (PLA1)Activates platelet aggregation and induces thrombosis at 18 nM with causes 85% washed platelets aggregation in 60 s (in vivo).[124]
P. paulista
(southeast Brazil)
Phospholipase A1(Ves v 1)Catalyzes the ester bonds hydrolysis of 1,2-diacyl-3 snglycerophospholipids at the sn-1 and sn-2 positions, respectively.[125]
P.paulistaPhospholipase A1Hydrolyzes phospholipids and produces 2-acyl-lysophospholipids and fatty acids.[125,126]
P. Occidentalis and P. paulistaPhospholipase A2 (PLA2)Potent hemolytic actions in washed red cells (in vitro).
Hydrolyzes natural phospholipids, catalysing the deacylation of 1,2-diacyl-sn-3-phosphoglycerides at position 2 and thus releases free fatty acids and lysophospholipids (in vitro).
[127,128]
P. paulista, Vespula maculate, Vespula arenaria, V. crabro, V. orientalis,
Paravespula germanica,
Paravespula vulgaris, Dolichovespula saxonica, Dolichovespula media, and Polistes
Gallicus
Hyaluronidase (Polyp2)Hydrolyses hyaluronic acid which facilitates the diffusion of toxin into the tissue and blood circulation of the prey.[129,130,131]
Polistes comanchusPolistin (protein)Responsible for the cytotoxic effect of the whole venom.[132]
P. paulistaAntigen5 (Polyp5)Major allergen could be used for allergy diagnostics and treatment.[133]
Cyphononyx dorsalisArginine kinase-like proteinExhibits paralytic activity in spiders with the same characteristic symptoms as the crude venom.[134]
Pteromalus puparumVn.11
(protein)
ND[135]
Cotesia rubeculaVn 4.6ND[136]
V. magnificaMagnvesinExerts anti-coagulant properties via hydrolyzing coagulant factors VII, VIII, TF, IX and X.[137]
Some volatile compounds
Vespa velutinaUndecan-2-oneElicits the defense behavior [138]
V. velutinaNon-8-en-2-one
V. velutinaNonan-2-one
V. velutinaHeptan-2-one
V. velutina4,8-Dimethylnon-7-en-2-one
Polistes metricus Say, Polistes bellicosus Cresson, and Polistes dorsalis (F.), as well as workers of Polistes aurifer (Saussure), P. bellicosus, P. metricus, and P. dorsalisN-(3-Methylbutyl)acetamideND[139]
P. occidentalis(E,E)-2,8-Dimethyl1,7-dioxaspiro[5.5]undecaneElicit the defense behavior [140]
ND: Not detected.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Abd El-Wahed, A.; Yosri, N.; Sakr, H.H.; Du, M.; Algethami, A.F.M.; Zhao, C.; Abdelazeem, A.H.; Tahir, H.E.; Masry, S.H.D.; Abdel-Daim, M.M.; et al. Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins 2021, 13, 206. https://doi.org/10.3390/toxins13030206

AMA Style

Abd El-Wahed A, Yosri N, Sakr HH, Du M, Algethami AFM, Zhao C, Abdelazeem AH, Tahir HE, Masry SHD, Abdel-Daim MM, et al. Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins. 2021; 13(3):206. https://doi.org/10.3390/toxins13030206

Chicago/Turabian Style

Abd El-Wahed, Aida, Nermeen Yosri, Hanem H. Sakr, Ming Du, Ahmed F. M. Algethami, Chao Zhao, Ahmed H. Abdelazeem, Haroon Elrasheid Tahir, Saad H. D. Masry, Mohamed M. Abdel-Daim, and et al. 2021. "Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions" Toxins 13, no. 3: 206. https://doi.org/10.3390/toxins13030206

APA Style

Abd El-Wahed, A., Yosri, N., Sakr, H. H., Du, M., Algethami, A. F. M., Zhao, C., Abdelazeem, A. H., Tahir, H. E., Masry, S. H. D., Abdel-Daim, M. M., Musharraf, S. G., El-Garawani, I., Kai, G., Al Naggar, Y., Khalifa, S. A. M., & El-Seedi, H. R. (2021). Wasp Venom Biochemical Components and Their Potential in Biological Applications and Nanotechnological Interventions. Toxins, 13(3), 206. https://doi.org/10.3390/toxins13030206

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop