The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells
Abstract
1. Introduction
2. Materials and Methods
2.1. Design of Synthesized Peptides
2.2. Generation of Rabbit Antisera and MAbs against the ORF3 Peptide (Residues 35–66))
2.3. Isotyping of MAbs
2.4. Epitope Mapping
2.5. Western Blot Analyses Determined the Molecular Weight of MAb 6D10
2.6. Immunofluorescence Assay of PCV2-Infected PBMCs
2.7. TUNEL Assay of PCV2-Infected PBMCs
2.8. Detection of the Capsid Protein and the ORF3 Protein in the Whole-Blood Samples from the PCV2-Infected Herd with a PCV2 Vaccine
2.9. Detection of the Specific Antibodies Against the Capsid Protein or the ORF3 Protein in Plasm Samples from the PCV2-Infected Herd with a PCV2 Vaccine
2.10. Statistical Analysis
3. Results
3.1. Rabbit Antisera Against the PCV2 Peptides
3.2. Hybridomas Screening and Isotyping of Anti-ORF3 (N1) MAbs
3.3. Mapping of Linear Epitopes for Anti-ORF3 MAbs Binding
3.4. The ORF3 Protein Colocalized with the Capsid Protein or the P53 Protein in Some PCV2-Infected PBMCs
3.5. The ORF3 Protein was Correlated with the Capsid Protein in the Whole-Blood Samples
3.6. The Anti-ORF3 Peptide IgG and Anti-Capsid IgG Response in the Pig Herd
4. Discussion
5. Conclusions
Supplementary Materials
Funding
Acknowledgments
Conflicts of Interest
Abbreviations
| ABTS | 2,2′-Azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt |
| ANOVA | Analysis of variance |
| CP | Capsid protein |
| Cterminus | Carboxyl-terminus |
| DAPI | 4′,6-diamidino-2-phenylindole |
| DMEM | Dulbecco’s modified Eagle medium |
| EDTA | Ethylenediaminetetraacetic acid |
| HRP | Horseradish peroxidase |
| iELISA | Indirect enzyme-linked immunosorbent assay |
| IFA | Immunofluorescence assay |
| Ig | Immunoglobulin |
| KLH | Keyhole limpet hemocyanin |
| mAb | Monoclonal antibody |
| OD | Optical density |
| ORF | Open reading frame |
| PBMCs | Peripheral blood mononuclear cells |
| PBS | Phosphate-buffered saline |
| PBST | PBS containing 0.05% Tween 20 |
| PCV | Porcine circovirus |
| PCV1 | Porcine circovirus type 1 |
| PCV2 | Porcine circovirus type 2 |
| PEG | Polyethylene glycol |
| pPirh2 | Porcine p53-induced RING-H2 |
| RING | Really interesting new gene |
| SCF | Suspending cells were fixed |
| SPF | Specific pathogen-free |
| TRITC | Tetramethyl rhodamine isothiocyanate |
| TUNEL | Terminal deoxynucleotidyl transferase dUTP nick end labeling |
| VLP | Virus-like particle |
References
- Tischer, I.; Gelderblom, H.; Vettermann, W.; Koch, M.A. A very small porcine virus with circular single-stranded DNA. Nature 1982, 295, 64. [Google Scholar] [CrossRef] [Scilit]
- Meehan, B.M.; McNeilly, F.; Todd, D.; Kennedy, S.; Jewhurst, V.A.; Ellis, J.A.; Hassard, L.E.; Clark, E.G.; Haines, D.M.; Allan, G.M. Characterization of novel circovirus DNAs associated with wasting syndromes in pigs. J. Gen. Virol. 1998, 79 (Pt 9), 2171–2179. [Google Scholar] [CrossRef] [Scilit]
- Tischer, I.; Mields, W.; Wolff, D.; Vagt, M.; Griem, W. Studies on epidemiology and pathogenicity of porcine circovirus. Arch. Virol. 1986, 91, 271–276. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Allan, G.M.; Kennedy, S.; McNeilly, F.; Foster, J.C.; Ellis, J.A.; Krakowka, S.J.; Meehan, B.M.; Adair, B.M. Experimental reproduction of severe wasting disease by co-infection of pigs with porcine circovirus and porcine parvovirus. J. Comp. Pathol. 1999, 121, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kennedy, S.; Moffett, D.; McNeilly, F.; Meehan, B.; Ellis, J.; Krakowka, S.; Allan, G.M. Reproduction of lesions of postweaning multisystemic wasting syndrome by infection of conventional pigs with porcine circovirus type 2 alone or in combination with porcine parvovirus. J. Comp. Pathol. 2000, 122, 9–24. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kim, J.; Ha, Y.; Jung, K.; Choi, C.; Chae, C. Enteritis associated with porcine circovirus 2 in pigs. Can. J. Vet. Res. 2004, 68, 218–221. [Google Scholar] [PubMed]
- Opriessnig, T.; Meng, X.-J.; Halbur, P.G. Porcine circovirus type 2 associated disease: Update on current terminology, clinical manifestations, pathogenesis, diagnosis, and intervention strategies. J. Vet. Diagn. Invest. 2007, 19, 591–615. [Google Scholar] [CrossRef] [Scilit]
- Segalés, J. Porcine circovirus type 2 (PCV2) infections: Clinical signs, pathology and laboratory diagnosis. Virus Research 2012, 164, 10–19. [Google Scholar] [CrossRef] [Scilit]
- Shibahara, T.; Sato, K.; Ishikawa, Y.; Kadota, K. Porcine circovirus induces B lymphocyte depletion in pigs with wasting disease syndrome. J. Vet. Med. Sci. 2000, 62, 1125–1131. [Google Scholar] [CrossRef] [Scilit]
- Segalés, J.; Domingo, M. Postweaning mulstisystemic wasting syndrome (PMWS) in pigs. A review. Vet. Q. 2002, 24, 109–124. [Google Scholar] [CrossRef] [Scilit]
- Segalés, J.; Alonso, F.; Rosell, C.; Pastor, J.; Chianini, F.; Campos, E.; López-Fuertes, L.; Quintana, J.; Rodríguez-Arrioja, G.; Calsamiglia, M.; et al. Changes in peripheral blood leukocyte populations in pigs with natural postweaning multisystemic wasting syndrome (PMWS). Vet. Immunol. Immunopathol. 2001, 81, 37–44. [Google Scholar] [CrossRef] [Scilit]
- Feng, H.; Blanco, G.; Segalés, J.; Sibila, M. Can Porcine circovirus type 2 (PCV2) infection be eradicated by mass vaccination? Vet. Microbiol. 2014, 172, 92–99. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lyoo, K.; Joo, H.; Caldwell, B.; Kim, H.; Davies, P.R.; Torrison, J. Comparative efficacy of three commercial PCV2 vaccines in conventionally reared pigs. Vet. J. 2011, 189, 58–62. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Czyżewska-Dors, E.B.; Dors, A.; Pomorska-Mól, M.; Podgórska, K.; Pejsak, Z. Efficacy of the Porcine circovirus 2 (PCV2) vaccination under field conditions. Vet. Ital. 2018, 54, 219–224. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Oliver-Ferrando, S.; Segalés, J.; López-Soria, S.; Callén, A.; Merdy, O.; Joisel, F.; Sibila, M. Evaluation of natural porcine circovirus type 2 (PCV2) subclinical infection and seroconversion dynamics in piglets vaccinated at different ages. Vet. Res. 2016, 47, 121. [Google Scholar] [CrossRef] [Scilit]
- Wiederkehr, D.D.; Sydler, T.; Buergi, E.; Haessig, M.; Zimmermann, D.; Pospischil, A.; Brugnera, E.; Sidler, X. A new emerging genotype subgroup within PCV-2b dominates the PMWS epizooty in Switzerland. Vet. Microbiol. 2009, 136, 27–35. [Google Scholar] [CrossRef] [Scilit]
- Patterson, A.R.; Opriessnig, T. Epidemiology and horizontal transmission of porcine circovirus type 2 (PCV2). Anim. Health Res. Rev. 2010, 11, 217–234. [Google Scholar] [CrossRef] [Scilit]
- Cortey, M.; Pileri, E.; Sibila, M.; Pujols, J.; Balasch, M.; Plana, J.; Segalés, J. Genotypic shift of porcine circovirus type 2 from PCV-2a to PCV-2b in Spain from 1985 to 2008. Vet. J. 2011, 187, 363–368. [Google Scholar] [CrossRef] [Scilit]
- Beach, N.M.; Meng, X.-J. Efficacy and future prospects of commercially available and experimental vaccines against porcine circovirus type 2 (PCV2). Virus Res. 2012, 164, 33–42. [Google Scholar] [CrossRef] [Scilit]
- Wang, F.; Guo, X.; Ge, X.; Wang, Z.; Chen, Y.; Cha, Z.; Yang, H. Genetic variation analysis of Chinese strains of porcine circovirus type 2. Virus Res. 2009, 145, 151–156. [Google Scholar] [CrossRef] [Scilit]
- Guo, L.J.; Lu, Y.H.; Wei, Y.W.; Huang, L.P.; Liu, C.M. Porcine circovirus type 2 (PCV2): Genetic variation and newly emerging genotypes in China. Virol. J. 2010, 7, 273. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Xiao, C.-T.; Harmon, K.M.; Halbur, P.G.; Opriessnig, T. PCV2d-2 is the predominant type of PCV2 DNA in pig samples collected in the U.S. during 2014–2016. Vet. Microbiol. 2016, 197, 72–77. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mone, N.K.; Clark, N.J.; Kyaw-Tanner, M.; Turni, C.; Barnes, T.S.; Parke, C.R.; Alawneh, J.A.; Blackall, P.J.; Meers, J. Genetic analysis of porcine circovirus type 2 (PCV2) in Queensland, Australia. Aust. Vet. J. 2020. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Saporiti, V.; Huerta, E.; Correa-Fiz, F.; Grosse Liesner, B.; Duran, O.; Segalés, J.; Sibila, M. Detection and genotyping of Porcine circovirus 2 (PCV-2) and detection of Porcine circovirus 3 (PCV-3) in sera from fattening pigs of different European countries. Transbound Emerg. Dis. 2020. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lv, Q.; Wang, T.; Deng, J.; Chen, Y.; Yan, Q.; Wang, D.; Zhu, Y. Genomic analysis of porcine circovirus type 2 from southern China. Vet. Med. Sci. 2020. [Google Scholar] [CrossRef] [Scilit]
- Wang, Y.; Noll, L.; Lu, N.; Porter, E.; Stoy, C.; Zheng, W.; Liu, X.; Peddireddi, L.; Niederwerder, M.; Bai, J. Genetic diversity and prevalence of porcine circovirus type 3 (PCV3) and type 2 (PCV2) in the Midwest of the USA during 2016-2018. Transbound Emerg. Dis. 2020, 67, 1284–1294. [Google Scholar] [CrossRef] [Scilit]
- Xiao, C.-T.; Halbur, P.G.; Opriessnig, T. Global molecular genetic analysis of porcine circovirus type 2 (PCV2) sequences confirms the presence of four main PCV2 genotypes and reveals a rapid increase of PCV2d. J. Gen. Virol. 2015, 96, 1830–1841. [Google Scholar] [CrossRef] [Scilit]
- Hamel, A.L.; Lin, L.L.; Nayar, G.P.S. Nucleotide Sequence of Porcine Circovirus Associated with Postweaning Multisystemic Wasting Syndrome in Pigs. J. Virol. 1998, 72, 5262–5267. [Google Scholar] [CrossRef] [Scilit]
- Cheung, A.K. The essential and nonessential transcription units for viral protein synthesis and DNA replication of porcine circovirus type 2. Virology 2003, 313, 452–459. [Google Scholar] [CrossRef] [Scilit]
- Mankertz, A.; Çaliskan, R.; Hattermann, K.; Hillenbrand, B.; Kurzendoerfer, P.; Mueller, B.; Schmitt, C.; Steinfeldt, T.; Finsterbusch, T. Molecular biology of Porcine circovirus: Analyses of gene expression and viral replication. Veterinary Microbiology 2004, 98, 81–88. [Google Scholar] [CrossRef] [Scilit]
- Beach, N.M.; Juhan, N.M.; Cordoba, L.; Meng, X.J. Replacement of the replication factors of porcine circovirus (PCV) type 2 with those of PCV type 1 greatly enhances viral replication in vitro. J. Virol. 2010, 84, 8986–8989. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Nawagitgul, P.; Morozov, I.; Bolin, S.R.; Harms, P.A.; Sorden, S.D.; Paul, P.S. Open reading frame 2 of porcine circovirus type 2 encodes a major capsid protein. J. Gen. Virol. 2000, 81, 2281–2287. [Google Scholar] [CrossRef] [Scilit]
- Guo, L.; Fu, Y.; Wang, Y.; Lu, Y.; Wei, Y.; Tang, Q.; Fan, P.; Liu, J.; Zhang, L.; Zhang, F.; et al. A porcine circovirus type 2 (PCV2) mutant with 234 amino acids in capsid protein showed more virulence in vivo, compared with classical PCV2a/b strain. PLoS ONE 2012, 7, e41463. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, J.; Chen, I.; Kwang, J. Characterization of a Previously Unidentified Viral Protein in Porcine Circovirus Type 2-Infected Cells and Its Role in Virus-Induced Apoptosis. J. Virol. 2005, 79, 8262–8274. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, J.; Chen, I.; Du, Q.; Chua, H.; Kwang, J. The ORF3 protein of porcine circovirus type 2 is involved in viral pathogenesis in vivo. J. Virol. 2006, 80, 5065–5073. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Karuppannan, A.K.; Jong, M.H.; Lee, S.-H.; Zhu, Y.; Selvaraj, M.; Lau, J.; Jia, Q.; Kwang, J. Attenuation of porcine circovirus 2 in SPF piglets by abrogation of ORF3 function. Virology 2009, 383, 338–347. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liu, J.; Zhu, Y.; Chen, I.; Lau, J.; He, F.; Lau, A.; Wang, Z.; Karuppannan, A.K.; Kwang, J. The ORF3 protein of porcine circovirus type 2 interacts with porcine ubiquitin E3 ligase Pirh2 and facilitates p53 expression in viral infection. J. Virol. 2007, 81, 9560–9567. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Leng, R.P.; Lin, Y.; Ma, W.; Wu, H.; Lemmers, B.; Chung, S.; Parant, J.M.; Lozano, G.; Hakem, R.; Benchimol, S. Pirh2, a p53-induced ubiquitin-protein ligase, promotes p53 degradation. Cell 2003, 112, 779–791. [Google Scholar] [CrossRef] [Scilit]
- Shi, D.; Murty, V.V.; Gu, W. PCDH10, a novel p53 transcriptional target in regulating cell migration. Cell Cycle 2015, 14, 857–866. [Google Scholar] [CrossRef] [Scilit]
- Hale, T.K.; Myers, C.; Maitra, R.; Kolzau, T.; Nishizawa, M.; Braithwaite, A.W. Maf transcriptionally activates the mouse p53 promoter and causes a p53-dependent cell death. J. Biol. Chem. 2000, 275, 17991–17999. [Google Scholar] [CrossRef] [Scilit]
- Manfredi, J.J. p53 and Apoptosis: It’s Not Just in the Nucleus Anymore. Mol. Cell 2003, 11, 552–554. [Google Scholar] [CrossRef] [Scilit]
- Karuppannan, A.K.; Liu, S.; Jia, Q.; Selvaraj, M.; Kwang, J. Porcine circovirus type 2 ORF3 protein competes with p53 in binding to Pirh2 and mediates the deregulation of p53 homeostasis. Virology 2010, 398, 1–11. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Choi, C.-Y.; Rho, S.B.; Kim, H.-S.; Han, J.; Bae, J.; Lee, S.J.; Jung, W.-W.; Chun, T. The ORF3 protein of porcine circovirus type 2 promotes secretion of IL-6 and IL-8 in porcine epithelial cells by facilitating proteasomal degradation of regulator of G protein signalling 16 through physical interaction. J. Gen. Virol. 2015, 96, 1098–1108. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Karuppannan, A.K.; Kwang, J. ORF3 of porcine circovirus 2 enhances the in vitro and in vivo spread of the of the virus. Virology 2011, 410, 248–256. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Stevenson, L.S.; Gilpin, D.F.; Douglas, A.; McNeilly, F.; McNair, I.; Adair, B.M.; Allan, G.M. T lymphocyte epitope mapping of porcine circovirus type 2. Viral Immunol. 2007, 20, 389–398. [Google Scholar] [CrossRef] [Scilit]
- Gu, J.; Wang, L.; Jin, Y.; Lin, C.; Wang, H.; Zhou, N.; Xing, G.; Liao, M.; Zhou, J. Characterization of specific antigenic epitopes and the nuclear export signal of the Porcine circovirus 2 ORF3 protein. Vet. Microbiol. 2016, 184, 40–50. [Google Scholar] [CrossRef] [Scilit]
- He, J.-L.; Dai, D.; Zhou, N.; Zhou, J.-Y. Analysis of Putative ORF3 Gene Within Porcine Circovirus Type 2. Hybridoma 2012, 31, 180–187. [Google Scholar] [CrossRef] [Scilit]
- Hung, L.-C.; Yang, C.-Y.; Cheng, I.-C. Peptides mimicking viral proteins of porcine circovirus type 2 were profiled by the spectrum of mouse anti-PCV2 antibodies. BMC Immunol. 2017, 18, 25. [Google Scholar] [CrossRef] [Scilit]
- Hung, L.-C.; Cheng, I.-C. Versatile carboxyl-terminus of capsid protein of porcine circovirus type 2 were recognized by monoclonal antibodies with pluripotency of binding. Mol. Immunol. 2017, 85, 100–110. [Google Scholar] [CrossRef] [Scilit]
- Lin, W.-L.; Chien, M.-S.; Wu, P.-C.; Lai, C.-L.; Huang, C. The Porcine Circovirus Type 2 Nonstructural Protein ORF3 Induces Apoptosis in Porcine Peripheral Blood Mononuclear Cells. Open Virol. J. 2011, 5, 148–153. [Google Scholar] [CrossRef] [Scilit]
- Zahari Sham, S.Y.; C Thambiah, S.; Samsudin, I.N.; Lim, S.M. Light chain multiple myeloma: An evaluation of its biochemical investigations. Malays. J. Pathol. 2017, 39, 311–315. [Google Scholar] [PubMed]
- Dispenzieri, A.; Kyle, R.; Merlini, G.; Miguel, J.S.; Ludwig, H.; Hajek, R.; Palumbo, A.; Jagannath, S.; Blade, J.; Lonial, S.; et al. International Myeloma Working Group guidelines for serum-free light chain analysis in multiple myeloma and related disorders. Leukemia 2009, 23, 215–224. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jaccard, A.; Bridoux, F. Treatment of AL amyloidosis. Nephrol. Ther. 2019, 15 (Suppl. 1), S115–S121. [Google Scholar] [CrossRef] [Scilit]
- Liu, G.; Wang, Y.; Jiang, S.; Sui, M.; Wang, C.; Kang, L.; Sun, Y.; Jiang, Y. Suppression of lymphocyte apoptosis in spleen by CXCL13 after porcine circovirus type 2 infection and regulatory mechanism of CXCL13 expression in pigs. Vet. Res. 2019, 50, 17. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Resendes, A.R.; Majó, N.; Segalés, J.; Mateu, E.; Calsamiglia, M.; Domingo, M. Apoptosis in lymphoid organs of pigs naturally infected by porcine circovirus type 2. J. Gen. Virol. 2004, 85, 2837–2844. [Google Scholar] [CrossRef] [Scilit]
- Segalés, J.; Domingo, M.; Chianini, F.; Majó, N.; Domínguez, J.; Darwich, L.; Mateu, E. Immunosuppression in postweaning multisystemic wasting syndrome affected pigs. Vet. Microbiol. 2004, 98, 151–158. [Google Scholar] [CrossRef] [Scilit]
- Gómez-Villamandos, J.C.; Bautista, M.J.; Sánchez-Cordón, P.J.; Carrasco, L. Pathology of African swine fever: The role of monocyte-macrophage. Virus Res. 2013, 173, 140–149. [Google Scholar] [CrossRef] [Scilit]
- Berthault, C.; Larcher, T.; Härtle, S.; Vautherot, J.-F.; Trapp-Fragnet, L.; Denesvre, C. Atrophy of primary lymphoid organs induced by Marek’s disease virus during early infection is associated with increased apoptosis, inhibition of cell proliferation and a severe B-lymphopenia. Vet. Res. 2018, 49, 31. [Google Scholar] [CrossRef] [Scilit]
- Xiong, Y.; Liu, Y.; Cao, L.; Wang, D.; Guo, M.; Jiang, A.; Guo, D.; Hu, W.; Yang, J.; Tang, Z.; et al. Transcriptomic characteristics of bronchoalveolar lavage fluid and peripheral blood mononuclear cells in COVID-19 patients. Emerg. Microbes. Infect. 2020, 9, 761–770. [Google Scholar] [CrossRef] [Scilit]
- Mandrioli, L.; Sarli, G.; Panarese, S.; Baldoni, S.; Marcato, P.S. Apoptosis and proliferative activity in lymph node reaction in postweaning multisystemic wasting syndrome (PMWS). Veterinary Immunology and Immunopathology 2004, 97, 25–37. [Google Scholar] [CrossRef] [Scilit]
- Kiupel, M.; Stevenson, G.W.; Galbreath, E.J.; North, A.; HogenEsch, H.; Mittal, S.K. Porcine circovirus type 2 (PCV2) causes apoptosis in experimentally inoculated BALB/c mice. BMC Vet. Res. 2005, 1, 7. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Safta, T.B.; Ziani, L.; Favre, L.; Lamendour, L.; Gros, G.; Mami-Chouaib, F.; Martinvalet, D.; Chouaib, S.; Thiery, J. Granzyme B–Activated p53 Interacts with Bcl-2 To Promote Cytotoxic Lymphocyte–Mediated Apoptosis. J. Immunol. 2015, 194, 418–428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kaiser, N.; Edelman, I.S. Calcium dependence of glucocorticoid-induced lymphocytolysis. Proc. Natl. Acad. Sci. USA 1977, 74, 638–642. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Stojek, W.; Borman, A.; Glac, W.; Baracz-Jóźwik, B.; Witek, B.; Kamyczek, M.; Tokarski, J. Stress-induced enhancement of activity of lymphocyte lysosomal enzymes in pigs of different stress-susceptibility. J. Physiol. Pharmacol. 2006, 57 Suppl 8, 61–72. [Google Scholar]
- O’Neill, K.C.; Shen, H.G.; Lin, K.; Hemann, M.; Beach, N.M.; Meng, X.J.; Halbur, P.G.; Opriessnig, T. Studies on porcine circovirus type 2 vaccination of 5-day-old piglets. Clin. Vaccine Immunol. 2011, 18, 1865–1871. [Google Scholar] [CrossRef] [Scilit]
- Fraile, L.; Grau-Roma, L.; Sarasola, P.; Sinovas, N.; Nofrarías, M.; López-Jimenez, R.; López-Soria, S.; Sibila, M.; Segalés, J. Inactivated PCV2 one shot vaccine applied in 3-week-old piglets: Improvement of production parameters and interaction with maternally derived immunity. Vaccine 2012, 30, 1986–1992. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Afghah, Z.; Webb, B.; Meng, X.-J.; Ramamoorthy, S. Ten years of PCV2 vaccines and vaccination: Is eradication a possibility? Vet. Microbiol. 2017, 206, 21–28. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerber, P.F.; Garrocho, F.M.; Lana, Â.M.Q.; Lobato, Z.I.P. Fetal infections and antibody profiles in pigs naturally infected with porcine circovirus type 2 (PCV2). Can. J. Vet. Res. 2012, 76, 38–44. [Google Scholar]
- López-Lorenzo, G.; Díaz-Cao, J.M.; Prieto, A.; López-Novo, C.; López, C.M.; Díaz, P.; Rodríguez-Vega, V.; Díez-Baños, P.; Fernández, G. Environmental distribution of Porcine Circovirus Type 2 (PCV2) in swine herds with natural infection. Sci. Rep. 2019, 9, 14816. [Google Scholar] [CrossRef] [Scilit]
- Khayat, R.; Brunn, N.; Speir, J.A.; Hardham, J.M.; Ankenbauer, R.G.; Schneemann, A.; Johnson, J.E. The 2.3-angstrom structure of porcine circovirus 2. J. Virol. 2011, 85, 7856–7862. [Google Scholar] [CrossRef] [Scilit]
- Fort, M.; Sibila, M.; Pérez-Martín, E.; Nofrarías, M.; Mateu, E.; Segalés, J. One dose of a porcine circovirus 2 (PCV2) sub-unit vaccine administered to 3-week-old conventional piglets elicits cell-mediated immunity and significantly reduces PCV2 viremia in an experimental model. Vaccine 2009, 27, 4031–4037. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Fan, H.; Ju, C.; Tong, T.; Huang, H.; Lv, J.; Chen, H. Immunogenicity of empty capsids of porcine circovius type 2 produced in insect cells. Vet. Res. Commun. 2007, 31, 487–496. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Teras, M.; Viisileht, E.; Pahtma-Hall, M.; Rump, A.; Paalme, V.; Pata, P.; Pata, I.; Langevin, C.; Rüütel Boudinot, S. Porcine circovirus type 2 ORF3 protein induces apoptosis in melanoma cells. BMC Cancer 2018, 18, 1237. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Saha, D.; Huang, L.; Bussalleu, E.; Lefebvre, D.J.; Fort, M.; Van Doorsselaere, J.; Nauwynck, H.J. Antigenic subtyping and epitopes’ competition analysis of porcine circovirus type 2 using monoclonal antibodies. Vet. Microbiol. 2012, 157, 13–22. [Google Scholar] [CrossRef] [Scilit]
- Huang, L.P.; Lu, Y.H.; Wei, Y.W.; Guo, L.J.; Liu, C.M. Identification of one critical amino acid that determines a conformational neutralizing epitope in the capsid protein of porcine circovirus type 2. BMC Microbiol. 2011, 11, 188. [Google Scholar] [CrossRef] [Scilit]
- Shang, S.-B.; Jin, Y.-L.; Jiang, X.; Zhou, J.-Y.; Zhang, X.; Xing, G.; He, J.L.; Yan, Y. Fine mapping of antigenic epitopes on capsid proteins of porcine circovirus, and antigenic phenotype of porcine circovirus type 2. Mol. Immunol. 2009, 46, 327–334. [Google Scholar] [CrossRef] [Scilit]
- Cruz, T.F.; Magro, A.J.; de Castro, A.M.M.G.; Pedraza-Ordoñez, F.J.; Tsunemi, M.H.; Perahia, D.; Araujo, J.P. In vitro and in silico studies reveal capsid-mutant Porcine circovirus 2b with novel cytopathogenic and structural characteristics. Virus Res. 2018, 251, 22–33. [Google Scholar] [CrossRef] [Scilit]
- Gava, D.; Serrão, V.H.B.; Fernandes, L.T.; Cantão, M.E.; Ciacci-Zanella, J.R.; Morés, N.; Schaefer, R. Structure analysis of capsid protein of Porcine circovirus type 2 from pigs with systemic disease. Braz. J. Microbiol. 2018, 49, 351–357. [Google Scholar] [CrossRef] [Scilit]
- Trible, B.R.; Kerrigan, M.; Crossland, N.; Potter, M.; Faaberg, K.; Hesse, R.; Rowland, R.R.R. Antibody recognition of porcine circovirus type 2 capsid protein epitopes after vaccination, infection, and disease. Clin. Vaccine Immunol. 2011, 18, 749–757. [Google Scholar] [CrossRef] [Scilit]
- Trible, B.R.; Suddith, A.W.; Kerrigan, M.A.; Cino-Ozuna, A.G.; Hesse, R.A.; Rowland, R.R.R. Recognition of the Different Structural Forms of the Capsid Protein Determines the Outcome following Infection with Porcine Circovirus Type 2. J. Virol. 2012, 86, 13508–13514. [Google Scholar] [CrossRef] [Scilit]







| Name | PCV Type | Position | Peptide Sequence |
|---|---|---|---|
| N1 | 2b | ORF3(35–66) | CHNDVYISLPITLLHFPAHFQKFSQPAEISDKR |
| P31 | 2b | ORF3(35–44) | HNDVYISLPI |
| P32 | 2b | ORF3(45–54) | TLLHFPAHFQ |
| P33 | 2b | ORF3(55–66) | KFSQPAEISDKR |
| P40 | 2b | ORF3(40–49) | ISLPITLLHF |
| P41 | 2b | ORF3(50–59) | PAHFQKFSQP |
| P42 | 2b | ORF3(60–68) | AEISDKRRV |
| P48 | 2a | ORF3(35–44) | HNDVYIGLPI |
| P49 | 2 | ORF3(35–44) | HNDVYIRLPI |
| P56 | 1 | ORF3(35–44) | HYDVYSCLPI |
| P61 | 2b | ORF3(35–47) | HNDVYISLPITLL |
| P69 | 2b | ORF3(45–66) | TLLHFPAHFQKFSQPAEISDKR |
| P75 | 2b | ORF3(40–59) | ISLPITLLHFPAHFQKFSQP |
| P126 | 2b | ORF3(35–66) | HNDVYISLPITLLHFPAHFQKFSQPAEISDKR |
| C3 | 2b | CP(195–233) | CHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPLNP |
© 2020 by the author. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hung, L.-C. The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells. Viruses 2020, 12, 961. https://doi.org/10.3390/v12090961
Hung L-C. The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells. Viruses. 2020; 12(9):961. https://doi.org/10.3390/v12090961
Chicago/Turabian StyleHung, Ling-Chu. 2020. "The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells" Viruses 12, no. 9: 961. https://doi.org/10.3390/v12090961
APA StyleHung, L.-C. (2020). The Monoclonal Antibody Recognized the Open Reading Frame Protein in Porcine Circovirus Type 2-Infected Peripheral Blood Mononuclear Cells. Viruses, 12(9), 961. https://doi.org/10.3390/v12090961

