Next Article in Journal
Post-Border Forest Biosecurity in Australia: Response to Recent Exotic Detections, Current Surveillance and Ongoing Needs
Previous Article in Journal
Genetic Diversity and Differentiation of Relict Plant Liriodendron Populations Based on 29 Novel EST-SSR Markers
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Genome-Wide Identification of WRKY Genes and Their Response to Cold Stress in Coffea canephora

1
School of Agriculture, Yunnan University, Kunming 650500, China
2
Dehong Tropical Agriculture Research Institute, Dehong 678600, China
3
Department of Biological Sciences, Chungnam National University, Daejeon 34141, Korea
*
Author to whom correspondence should be addressed.
Forests 2019, 10(4), 335; https://doi.org/10.3390/f10040335
Submission received: 6 March 2019 / Revised: 3 April 2019 / Accepted: 11 April 2019 / Published: 14 April 2019
(This article belongs to the Section Forest Ecophysiology and Biology)

Abstract

WRKY transcription factors are known to play roles in diverse stress responses in plants. Low temperatures limit the geographic distribution of Coffea canephora Pierre ex A.Froehner. The WRKYs of C. canephora are still not well characterized, and the response of C. canephora WRKYs (CcWRKYs) under cold stress is still largely unknown. We identified 49 CcWRKYs from the C. canephora genome to gain insight into these mechanisms. These CcWRKYs were divided into three groups that were based on the conserved WRKY domains and zinc-finger structure. Gene expression analysis demonstrated that 14 CcWRKYs were induced during the cold acclimation stage, 17 CcWRKYs were preferentially upregulated by 4 °C treatment, and 12 CcWRKYs were downregulated by cold stress. Subsequently, we carried out a genome-wide analysis to predict 14,513 potential CcWRKY target genes in C. canephora. These isolated genes were involved in multiple biological processes, and most of them could be grouped by the response to stimulus. Among the putative CcWRKY target genes, 235 genes were categorized into response to the cold process, including carbohydrate metabolic, lipid metabolic, and photosynthesis process-related genes. Furthermore, the qRT-PCR and correlation analysis indicated that CcWRKY might control their putative targets that respond to cold stress. These results provide a basis for understanding the molecular mechanism for CcWRKY-mediated cold responses.

1. Introduction

WRKY transcription factors (TFs) were first reported in sweet potato as DNA-binding proteins [1]. WRKY TFs not only regulate plant growth and development, but they also play a key role in biotic and abiotic stress responses [2]. The WRKY domain characterizes the WRKY proteins, which contains approximately 60 amino acids with a highly conserved WRKYGQK heptapeptide [2,3,4,5]. The WRKY proteins also have a zinc-finger motif at the C-terminus [3,4]. Based on the number of WRKY domains and the pattern of zinc finger motifs, the WRKY proteins can be divided into three groups I, II, and III. Proteins from group I include two WRKY domains and a C2H2 (CX4-5CX22-23HXH) zinc finger motif, while proteins from groups II and III contain a single WRKY domain and a C2H2 or C2HC (CX7CX23HXC) zinc finger motif, respectively [3,4]. Furthermore, group II WRKY proteins can be subdivided into five subgroups (IIa-IIe) [3,4,5].
WRKY proteins usually bind to the W-box [(C/T)TGAC(T/C)] cis-element in the promoter of their target genes to regulate the downstream genes that are involved in all types of biological functions, including diverse abiotic and biotic stress responses and different plant development processes [3,4,5]. Owing to their functions, WRKY proteins have been systematically analyzed in numerous plants at the genomic level in Arabidopsis (Arabidopsis thaliana (L.) Heynh.), field mustard (Brassica rapa L.), tomato (Solanum lycopersicum L.), black cottonwood (Populus trichocarpa Torr. & A.Gray ex. Hook.), papaya (Carica papaya L.), grape (Vitis vinifera L.), peach (Prunus persica (L.) Batsch 1801 not Stokes 1812 nor (L.) Siebold & Zucc. 1845), wild strawberry (Fragaria vesca L.), soybean (Glycine max (L.) Merr.), cucumber (Cucumis sativus L.), rice (Oryza sativa L.), stem-orchid (Dendrobium officinale Kimura et Migo), and the thorny shrub Caragana intermedia Kuang et H.C.Fu [3,6,7,8,9,10,11,12,13,14,15,16]. Among them, many WRKY proteins have been cloned and shown to be associated with abiotic stress responses, such as cold [17,18], salt [19], and drought [20]. For example, cold stress and ABA treatment upregulated CsWRKY46, and the overexpression of CsWRKY46 increases the freezing and chilling tolerance in cucumber [20]. OsWRKY71 is highly upregulated in response to cold stress, and the overexpression of OsWRKY71 can increase the survival rate under cold treatment in rice [21].
WRKY proteins that are involved in plant biotic responses have also been broadly characterized. For instance, the overexpression of OsWRKY76 in rice results in decrease in the blast disease resistance [22]. Overexpression of OsWRKY45-2 can enhance the resistance to bacterial blight [23]. Overexpression of VvWRKY1 in tobacco shows enhanced resistance to fungal pathogens [24]. The role of WRKY proteins involves different plant development processes, such as trichome morphogenesis, flowering, seed development, root development, dormancy, and germination; additionally, senescence has been widely reported [25,26,27,28,29,30,31].
Coffea canephora, which belongs to the Rubiaceae family, is one of the key commercial crops in subtropical and tropical developing countries, and it accounts for approximately 30% of the world coffee bean production [32,33]. Commonly known as robusta coffee, C. canephora is a species that is considered as one of the parents of Coffea arabica, which represents 70% of the coffee bean production in the world [34,35]. For cup quality, C. canephora is famous for its dark color and intense flavor and bitterness when compared with C. arabica [36]. For agronomic traits, C. canephora can provide a higher high-temperature, drought, and coffee-rust tolerant plant as compared to C. arabica [33,36,37]. However, like most subtropical and tropical plants, C. canephora is sensitive to low temperatures [33]. Low temperature is one of the main factors limiting the geographic distribution of C. canephora. Developing cold-tolerant C. canephora plants and understanding its cold response mechanisms are exploited in genotype screening and breeding programs of the coffee industry.
The aim of the current research was to identify the WRKY genes in the C. canephora genome, to classify their expression patterns, and to reveal the putative CcWRKY targets and their regulatory biological processes under cold stress. Our results might provide insight regarding the molecular significance of CcWRKYs under cold stress.

2. Materials and Methods

2.1. Plant Materials and Cold Treatment

One-year-old seedlings of C. canephora were provided by the Germplasm Repository of Coffee (Coffea spp.), RuiLi City, Ministry of Agriculture (RuiLi, Yunnan, China). The plants were grown at a constant temperature of 24 °C under a long-day cycle (16 h light/8 h cark) in a greenhouse before cold treatment. Cold treatments were carried out as described by a previous report [38], with some modifications. The plants were transferred into a growth chamber and submitted to 24 °C/20 °C (day/night) for seven days, followed by seven days at 13 °C/8 °C (day/night) to express cold acclimation ability, and followed by three days at 4 °C/4 °C (day/night). During the cold treatment, the following parameters were fixed: photoperiod (16 h light/8 h dark), humidity (60%), and luminosity (600–650 µmol m−2 s−1). At the end of each treatment time point, five plants were taken out and the two top pairs of recent mature leaves were sampled, frozen immediately in liquid nitrogen, and then stored at −80 °C for further analysis. Three independent biological replicates were obtained and analyzed.

2.2. WRKY Gene Family Identification

The entire genome sequence of C. canephora was downloaded from the Coffee Genome Hub (http://coffee-genome.org/) [34]. All of the protein sequences were used as queries to search against the profile Hidden Markov Model (HMM) by HMMER v3.1b2 software (http://hmmer.org/) with Pfam HMM library Pfam 31.0, and the WRKY DNA-binding domain (PF03106, E < 0.1) was isolated [39]. A similar method was applied for the isolation of the AtWRKY gene family from TAIR10 (www.arabidopsis.org).

2.3. Chromosomal Location of CcWRKYs

All of the putative CcWRKY genes were mapped to C. canephora chromosomes based on information available at the Coffee Genome Hub (http://coffee-genome.org/) with Tools of ‘Advanced Search’. Figures were modified with Inkscape (version 0.92, Inkscape’s Contributors, https://inkscape.org/).

2.4. Sequence Alignment and Phylogenetic Analysis

Multiple alignments of the protein sequences of C. canephora and Arabidopsis were performed while using ClustalX2 software with default settings [40]. MEGA6 software using a Poisson model constructed the phylogenetic trees, with the following options: pairwise deletion, homogeneous pattern, and 1000-replicate bootstrap [41].

2.5. Exon-Intron Structure Analysis of CcWRKY Ggenes

The exon-intron structures of the CcWRKY genes were determined according to the alignments of their full genomic DNA sequences and their respective coding sequences (http://coffee-genome.org). The gene structure diagrams were obtained from the online program GSDS (Gene Structure Display Server, http://gsds.cbi.pku.edu.cn) [42].

2.6. Conserved Motifs Search and GO Enrichment

To identify the conserved motifs of CcWRKY proteins, the full-length protein sequences of CcWRKY genes were submitted to MEME (Multiple Em for Motif Elicitation, http://meme-suite.org/tools/meme) with the following criteria: 0 or 1 per sequence for number of repetitions; maximum number of motifs, 100. The motifs with E value ≤ 0.1 were selected for further analysis [43]. GO enrichment was carried out using agriGO (http://bioinfo.cau.edu.cn/agriGO/index.php) [44].

2.7. Identification and Analysis of Potential CcWRKY Target Genes

The potential binding site of the WRKY transcription factor, W-box element (C/TTGACT/C), was scanned in the 1,000 bp upstream regions from all 25,572 putative genes of C. canephora (http://coffee-genome.org/) while using PlantPAN 2.0 (http://plantpan2.itps.ncku.edu.tw/). As previously reported, genes with ≥ 3 putative WRKY binding sites were considered as potential CcWRKY target genes [15]. The GO information for CcWRKY target genes was downloaded from PLAZA (version 4.0, https://bioinformatics.psb.ugent.be/plaza/) and then submitted to WEGO 2.0 (http://wego.genomics.org.cn/) for functional classification [45,46].

2.8. qRT-PCR Analysis

The samples from C. canephora were stored at −80 °C until use. RNA was isolated using the RNAiso Plus Reagent (TAKARA BIO INC., Shiga, Japan), according to the manufacturer’s protocols. The first-strand cDNA was synthesized using the PrimeScript™ RT reagent Kit with gDNA Eraser (TAKARA BIO INC., Shiga, Japan). The concentration of cDNA was determined and then diluted to 12.5 ng/µl. PCR was performed using the QuantStudio™ 7 Flex Real Time PCR System (Applied Biosystems®, Foster City, CA, USA). The reactions were prepared in a total volume of 20 µl containing 2 µl cDNA, 10 µl of SYBR® Premix Ex Taq™ II (Tli RNaseH Plus) (TAKARA BIO INC., Shiga, Japan), 1.0 µl of each primer at 10 µM, and 6 µl distilled water. PCR was performed with the following program: 95 °C for 30 s, followed by 40 cycles of 95 °C for 5 s, and 56 °C for 30 s. All of the primer sequences that were used in this study are listed in Table S1. The PCR data were analyzed based on the 2−ΔΔCT method [47], and re-represented by a heatmap, as described by previous research [9] using MeV software [48] with the average mean values of three independent biological replicates. All qRT-PCR was carried out using a sample from the three biological repeats with triplicate technique repeats for each sample.

3. Results

3.1. Isolation of the WRKY Genes in C. canephora

Based on the HMM (Hidden Markov Model) search, 49 protein sequences were identified as members of the WRKY family in C. canephora. These proteins were named from CcWRKY01 to CcWRKY49, according to their order on the C. canephora chromosomes. Table S2 lists the locus ID, CDS (coding sequence) length, protein length, and genome location of the genes. With the average sequence length of 1132 bp, the CDS sizes of CcWRKY genes varied from 312 bp (CcWRKY28) to 2985 bp (CcWRKY26). The genomic sequence of the CcWRKY genes ranged from 827 bp to 10,852 bp (Table S2). For comparative genomic analyses, we collected the WRKY protein coding genes in other plants from previous publications. Finally, 81, 59, 72, 52, 188, 62, 58, and 104 WRKY genes were collected from S. lycopersicum, V. vinifera, A. thaliana, C. papaya, G. max, F. vesca, P. persica, and P. trichocarpa, respectively [8,9,10,11,12,13,14,15,16,49]. The number of CcWRKY genes was similar to V. vinifera, C. papaya, F. vesca, and P. persica; but less than S. lycopersicum, A. thaliana, G. max, and P. trichocarpa (Figure 1).
Based on the previously study of phylogeny, whole-genome duplication, and chromosomal structure [34], forty-six of the CcWRKYs could be mapped to one of eleven chromosomes of C. canephora. CcWRKY47–49 (Cc00_g06830, Cc00_g13890, Cc00_g21560) was putatively located on ‘Chromosome Unknown’. CcWRKYs were not evenly distributed across the chromosomes of the C. canephora genome. The most abundant distribution was located on Chromosome 2 (ten CcWRKYs, 20.4%), and the least abundant was located on Chromosome 3 (one CcWRKYs, 6.1%) (Figure 2). Most of the CcWRKYs (38 genes) that are located on the ancestral blocks correspond to the seven core eudicot chromosomes (Figure 2).

3.2. Phylogenetic Analysis and Motif Identification of the CcWRKY Family

To analyze the evolution and relationships among the CcWRKYs, we carried out a phylogenetic analysis of the CcWRKYs and A. thaliana WRKY (AtWRKY) genes. The Arabidopsis genome (TAIR10) also has been analyzed by HMM search, as described above for C. canephora. Finally, 72 AtWRKY genes were isolated. An unrooted phylogenetic tree was constructed for 49 CcWRKYs and 72 AtWRKYs while using the NJ (neighbor-joining) method in MEGA6 (Figure 3). According to the results of the phylogenetic analyses using the predicted WRKY domains and zinc finger structures, the 49 CcWRKY genes were divided into three main groups, group I, II and III (Figure 3, Table S2). Table S2 shows the number of WRKY domains and the type of zinc finger motifs. Ten of the CcWRKY proteins contained two complete WRKY domains and a C2H2-type (CX4-5CX22-23HXH) zinc finger motif, and these proteins were classified into group I. The 34 CcWRKY proteins in group II were categorized into five subgroups that were based on the classifications of WRKY genes in Arabidopsis [3]. Additionally, three, six, fifteen, six, and four CcWRKY proteins were found in subgroups II a, II b, II c, II d, and II e, respectively. Subgroup II c showed higher divergence than the other subgroups. There were five CcWRKY proteins that constituted group III, which contained one WRKY domain and a C2HC-type (CX7CX23HXC) zinc finger motif. WRKY proteins were characterized by the WRKY domain, which included a conserved WRKYGQK heptapeptide [3]. In C. canephora, one variant in the signature WRKY domain, WRKYGKK, was identified in three CcWRKYs: CcWRKY28, CcWRKY33, and CcWRKY43 (Table S2).
The conserved motifs and sequences imply important roles in the gene functions. A total of ten motifs (E value ≤ 0.1) were identified from the 49 CcWRKY proteins (Table 1). Motifs 1 and 2 were highly conserved in all of the CcWRKY proteins, and motif 1 contained the C-terminal WRKY domain, while motif 2 included the zinc finger motifs. Motifs 3 and 4 were found in all the group I CcWRKY proteins, and motif 3 was composed of the N-terminal WRKY domain in group I. In addition to these four highly conserved motifs, motifs 6, 7, and 10 were specific to group II a and II b; motifs 8 and 9 were only found in group II a and I, respectively.

3.3. Exon–Intron Organization of CcWRKY Genes

Gene structure analysis revealed that the CcWRKY genes consisted of, on average, four exons. Nineteen CcWRKY genes (38.8%) contained three exons (Table S2 and Figure S1). The remaining genes contained two exons (six genes), four exons (eleven genes), five exons (five genes), six exons (six genes), seven exons (one gene, CcWRKY37), or 12 exons (one gene, CcWRKY26). The diversity of the exon number may be related to the functional diversity of CcWRKYs. In this analysis, we noted that CcWRKYs in the same group usually contained a similar number of exons. In group I, the number of exons ranged from four to twelve, while the genes that were involved in group II contained two to seven exons, and the number of exons in group III ranged from three to four. The exon pattern similarity in the same group might be the result of gene duplication events. These results were similar to the observations that were obtained for Vitis vinifera [9,50].

3.4. CcWRKYs Expression in Response to Cold Stress

To obtain additional information regarding the responses of the CcWRKYs in cold stress, we carried out qRT-PCR using the two top pairs of recent mature leaves of one-year old C. canephora seedlings that had been subject to cold treatments. Twelve genes were downregulated by cold treatments (Figure 4A, 4B). Fourteen genes were induced by the cold acclimation process (13 °C) and sustained the up-regulation at 4 °C, which indicated that these genes might be involved in cold acclimation in C. canephora (Figure 4C). Seventeen genes were preferentially upregulated by 4 °C cold treatment (Figure 4D). Two WRKY genes showed no significantly changed (below a two-fold change) expression level under cold treatment, indicating that they might not be involved in cold responses (Figure 4E). Four genes, CcWRKY06, CcWRKY21, CcWRKY25, and CcWRKY38, were excluded from cold treatments due to their high Ct value (≥35 cycles) in the templates of normal and cold-treated leaves. From Figure 4C and 4D, a number of CcWRKY genes might be considered as candidate transcription factors for further study in relation to cold responsiveness: CcWRKY01, CcWRKY10, CcWRKY13, CcWRKY14, CcWRKY15, CcWRKY24, CcWRKY30, CcWRKY35, CcWRKY37, CcWRKY40, CcWRKY41, CcWRKY48, and so on.

3.5. CcWRKYs Response to Cold Stress by Mediating Multiple Biological Processes

To analyze the CcWRKY-mediated regulatory processes, we examined the potential promoter regions of all the annotated genes in C. canephora. A total of 25,574 putative gene promoters from C. canephora were screened. Finally, 14,513 genes were found have at least three W-box elements in their putative promoter regions (Table S3). To obtain more information regarding these potential CcWRKY target genes, the GO information was downloaded from PLAZA 4.0 and then analyzed by WEGO software [45,46]. Of the 14,513 genes, 11,527 genes exhibited GO annotation and they were categorized into 58 functional groups under three major categories: cellular components, molecular functions, and biological process (Figure 5). Metabolic process (6079, 52.7%), cellular process (5596, 48.5%), and response to stimulus (2865, 24.9%) were the most highly represented GO terms in the category of biological process. Cell (5503, 47.7%), cell part (5500, 47.7%), organelle (4135, 35.9%), and membrane (2850, 24.7%) were the most abundant cellular component ontologies. In the molecular function category, binding (7106, 61.6%) and catalytic activity (5313, 46.1%) were the most abundant terms. Furthermore, we also found that 39 CcWRKY genes were included in the putative CcWRKY genes, which indicated that the CcWRKY genes regulated themselves (Table S3).
To reveal the regulatory network of the CcWRKY genes under cold stress, all of the potential CcWRKY target genes that were involved in the biological process of response to cold (GO:0009409) were isolated, and 235 genes were obtained (Table S4). Functional classification showed that the categories of membrane (58 genes), cold acclimation (21 genes), lipid metabolic process (21 genes), carbohydrate metabolic process (20 genes), hormone-mediated signaling pathway (15 genes), response to sucrose stimulus (13 genes), and photosynthesis process (12 genes) were highlighted (Table S4). Furthermore, 31 GO items were significantly (false discovery rate, FDR < 0.05) represented, including hexose catabolic process, cellular carbohydrate metabolic process, glucose metabolic process, monosaccharide catabolic process, calcium-dependent phospholipid binding, UDP-glucosyltransferase activity, fatty acid biosynthetic process, and others (Table 2).

3.6. Confirmations of the Expression Patterns of the Putative CcWRKY Target Genes under Cold Stress

Ten randomly selected putative CcWRKY target genes that involved in the biological process of cellular carbohydrate metabolic were analyzed by qRT-PCR to determine their responses to cold stress to which CcWRKYs responded (Table S5). As shown in Figure 4, three genes (Cc05_g16350, Cc06_g05150, and Cc05_g11390) were induced by cold treatment, four genes (Cc01_g06200, Cc05_g16370, Cc07_g15470, and Cc10_g00410) were downregulated by cold treatment, two genes (Cc11_g00340 and Cc02_g32320) were almost no changed, and one gene (Cc05_g00860) was slightly only increased by 4 °C treatment. Furthermore, we calculated the Pearson correlation coefficients (PCC) between the CcWRKY genes and the ten selected genes based on the Ct value. With PCC above 0.9, one to four CcWRKYs were found to be co-expressed with the target genes, except Cc05_g11390 (Figure 4 and Table S5). These analyses indicated that the CcWRKYs directly regulated the putative target of response to cold stress.

4. Discussion

4.1. WRKY Genes in Coffee (Coffea spp.)

Owing to the important roles of WRKY transcription factors in plant kingdoms, genome-wide analyses of the WRKY gene family have been performed in A. thaliana, B. rapa, S. lycopersicum, P. trichocarpa, C. papaya, V. vinifera, peach (P. persica), F. vesca, soybean (G. max), C. sativus, O. sativa, D. officinale, and C. intermedia [3,6,7,8,9,10,11,12,13,14,15,16,18,49]. In coffee plants, 22 WRKY genes have been isolated based on the EST database [51]; however, only four CcWRKY genes were involved in their study. In the current study, we first provided a systematical analysis of CcWRKY genes and then identified 49 CcWRKYs based on the information regarding the C. canephora genome sequence (Table S1). A comparison of the number of CcWRKYs in C. canephora with other sequenced plants [8,9,10,11,12,13,14,15,16,49], the number of CcWRKY genes was similar to V. vinifera, C. papaya, F. vesca, and P. persica; but, less than S. lycopersicum, A. thaliana, G. max, and P. trichocarpa (Figure 1), which might be due to the whole-genome polyploidization event of S. lycopersicum, A. thaliana, G. max, and P. trichocarpa, because of the ℽ triplication at the origin of the core eudicots [34,50].

4.2. Phylogenetic Analysis, Conserved Motifs, and Structure of the CcWRKYs

In this study, we identified 49 CcWRKYs and divided into three major groups (Table S2, Figure 3), based on the motif features of the zinc finger and the number of WRKY domains. Ten CcWRKYs with two WRKY domains belonged to group I. 34 CcWRKYs with one WRKY domain and the zinc finger structure of CX4-5CX22-23HXH were assigned to group II and accounted for the largest proportion of 69.5%, and 5 CcWRKYs contained a WRKY domain and C2HC-type (CX7CX23HXC) zinc finger motif and were classified into group III. Our findings are consistent with those of S. lycopersicum, V. vinifera, A. thaliana, C. papaya, G. max, F. vesca, P. persica, and Caragana intermedia [8,9,10,12,13,14,15,16], which contained the largest numbers of group II WRKY genes and showed no WRKY domain loss.
The variation in the number of group III WRKY genes was considered to be one of the causes of diversity of WRKY gene family size [52]. In C. canephora, five group III CcWRKY genes were fewer than S. lycopersicum, A. thaliana, G. max, and similar to V. vinifera and C. papaya (Figure 1). The smaller number of group III WRKY genes in C. canephora, V. vinifera and C. papaya might due to the different pattern of duplication events.
The highly conserved WRKYGQK heptapeptide characterizes the WRKY proteins [3]. However, this protein sequence can be replaced by some variants, such as WRKYGQR, WRKYGKK, WRKYGYA, and WRKYGYK [4]. In our analysis, the WRKYGKK variant was observed in CcWRKY28, CcWRKY33, and CcWRKY43 proteins (Table S2). This result is consistent with recent reports regarding other species, such as V. vinifera (VvWRKY8, VvWRKY13, VvWRKY14, and VvWRKY24), radish (Raphanus sativus L.) (RsWRKY79, 105, 109, 113, 120, and 121) and C. intermedia (CiWRKY41–1, 2, 50 and 51) [9,16,53].
Using MEME, we analyzed the conserved motifs of the CcWRKYs, and ten conserved motifs were identified (Table 1). Motifs 1 and 2 were consistent with the C-terminal WRKY domain and zinc finger motifs separately and were located in all the CcWRKYs. Motifs 3 and 4 were unique to group I, whereas motifs 6, 7, and 10 were specific to group IIa and IIb. The similar motif composition in the same groups or sub-groups indicated their conserved protein architecture.
The exon-intron structural diversification also provided some important clues regarding the evolution of gene families that is caused by the fusions and rearrangement of different chromosome parts [52,54]. In the current study, genes that are involved in the same group usually contain a similar structures, such as four to six exons that were found in group I, except CcWRKY26 (12 exons), all CcWRKYs in group IIe that contained three exons, except CcWRKY39 (four exons), and all of the CcWRKYs in group III that have three exons, in addition to CcWRKY36 (four exons) (Table S2 and Figure S1). Given all of that, the conserved protein architecture, motif compositions, and similar gene structures strongly supported the phylogenetic analysis results.

4.3. Identification of CcWRKYs and Their Target’s Responses to Cold Stress in C. canephora

WRKY genes participate in the cold response, and they have been reported in several plants, such as V. vinifera and D. officinale [17,18]. To analyze the detailed response of CcWRKY genes to cold stress, the C. canephora plants were submitted to cold treatments, and the expression patterns were analyzed using qRT-PCR. Based on the results of analysis, CcWRKYs can be divided into five groups: cold acclimation-induced genes (14 genes, Figure 4C), 4 °C preferentially induced genes (17 genes, Figure 4D), downregulated by 4 °C/4 °C cold treatments (10 genes, Figure 4A), and downregulated by cold treatments (two genes, Figure 4B), and unchanged genes (two genes, Figure 4E). Furthermore, the GO items of these 14,513 genes were grouped into 58 functional groups. Based on the GO analysis, the processes of metabolic process, cellular process, and response to stimulus were highly represented (Figure 5).
To obtain additional information regarding the regulatory network under cold stress in C. canephora, the putative target genes of CcWRKYs that are involved in the GO process of response to cold stress (GO:0009409) were isolated, and 235 genes were obtained (Table S4). Functional classification and GO enrichment analysis revealed that the 235 genes can be grouped into multiple biological processes, such as carbohydrate metabolic, fatty acid biosynthetic, hormone-mediated signaling, photosynthesis, and others (Table 2 and Table S4), indicating that the CcWRKY-mediated cold-responsive regulatory network may cover these processes. Out of 10 putative CcWRKY target genes that were randomly selected, only five genes were upregulated upon cold treatment, while four genes were downregulated (Figure 4), indicating that some CcWRKY transcription factors might act as negative regulators. Particularly, three putative target genes would be potent candidate target genes for cold stress-related maker development in C. canephora. The expression of three genes was matched to corresponding WRKY protein: Cc05_g16350/CcWRKY44, Cco5_g11390/CcWRKY12, and CC06_g05150/CcWRKY01 (Figure 4). In addition, several putative target genes from Table S5 would be also good candidate for further study and application in breeding: CcSFR2 (Cc03_g00500), CcDREB1D/CBF4 (Cc09_g09540), CcCOR413 (Cc07_g05360 and Cc02_g18110), and CcCOR314 (Cc09_g09540). (Figure 4). Taken together, our analysis extends the knowledge regarding how WRKYs regulate downstream genes in response to cold stress.

5. Conclusions

In summary, 49 CcWRKYs were identified from the C. canephora genome. These CcWRKYs were divided into three groups that were based on the conserved WRKY domains and zinc finger structure. Ten conserved motifs were identified from the 49 CcWRKY proteins, and motif 1 contained the C-terminal WRKY domain. In addition to the highly conserved WRKYGQK motif, one variant motif (WRKYGKK) of the WRKY domain was isolated. The qRT-PCR results demonstrated that 14 CcWRKYs could be induced during the cold acclimation stage, 17 CcWRKYs were preferentially upregulated by 4°C treatment, and 12 CcWRKYs were downregulated by cold stress. There were 14,513 potential CcWRKY target genes that were isolated from the C. canephora genome, and most of them were grouped into response to stimulus process. In addition, 235 genes of the potential targets were categorized in response to cold process, and these genes can also be grouped into carbohydrate metabolic, lipid metabolic, and photosynthesis processes. The qRT-PCR results and co-expression analysis showed that the CcWRKYs might directly control the targets responding to cold stress. Our results not only provide clues for future analyses of the mechanisms that are used by CcWRKYs to mediate cold responses, but also extend our knowledge regarding the WRKY family in plants.

Supplementary Materials

The following are available online at https://www.mdpi.com/1999-4907/10/4/335/s1. Figure S1: Gene structures of the CcWRKYs, blue boxes represent CDS regions, and solid lines indicate intron regions. Table S1: List of primers used in this study. Table S2: Characteristic features of WRKY Transcription factor gene family identified in Coffea Canephora, the red color letters indicate the variant WRKY domain. Table S3: Potential WRKY target genes in Coffea canephora, genes with at least three W-box elements in their putative promoters were consider as the potential CcWRKY target genes. Table S4: Potential CcWRKY target genes involved in response to cold stress process. Table S5: Information for 10 selected target genes of CcWRKYs in Coffea canephora for qRT-PCR verification, the co-expressed CcWRKYs were the CcWRKY genes that had Pearson correlation coefficients (PCC) ≥ 9.0 with the putative targets based on the Ct value. “━” indicates no correlational CcWRKY genes.

Author Contributions

Data curation, X.D., Y.Y. and Z.Z.; Formal analysis, X.D.; Funding acquisition, X.D., S.H. and F.H.; Investigation, J.G.; Resources, Z.X. and X.B.; Supervision, S.H. and F.H.; Writing-original draft, X.D.; Writing-review & editing, Y.H.

Funding

This research was funded by National Natural Science Foundation of China, 31601771 and Applied Basic Research Project of Yunnan, 2017FB056, and Scientific Research Fund of Yunnan Provincial Education Department of China, 2016zzx007.

Acknowledgments

We thank LetPub (www.letpub.com) for its linguistic assistance during the preparation of this manuscript.

Conflicts of Interest

The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.

References

  1. Ishiguro, S.; Nakamura, K. Characterization of a cdna encoding a novel DNA-binding protein, spf1, that recognizes sp8 sequences in the 5′ upstream regions of genes coding for sporamin and β-amylase from sweet potato. Mol. Gen. Genet. 1994, 244, 563–571. [Google Scholar] [CrossRef] [Scilit]
  2. Ulker, B.; Somssich, I.E. Wrky transcription factors: From DNA binding towards biological function. Curr. Opin. Plant Biol. 2004, 7, 491–498. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Eulgem, T.; Rushton, P.J.; Robatzek, S.; Somssich, I.E. The wrky superfamily of plant transcription factors. Trends Plant Sci. 2000, 5, 199–206. [Google Scholar] [CrossRef] [Scilit]
  4. Rushton, P.J.; Somssich, I.E.; Ringler, P.; Shen, Q.J. Wrky transcription factors. Trends Plant Sci. 2010, 15, 247–258. [Google Scholar] [CrossRef] [Scilit]
  5. Song, H.; Wang, P.; Lin, J.Y.; Zhao, C.; Bi, Y.; Wang, X. Genome-wide identification and characterization of wrky gene family in peanut. Front Plant Sci. 2016, 7, 534. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Ross, C.; Liu, Y.; Shen, Q.J. The wrky gene family in rice (oryza sativa). J. Integr. Plant Biol. 2007, 49, 827–842. [Google Scholar] [CrossRef] [Scilit]
  7. Ling, J.; Jiang, W.; Zhang, Y.; Yu, H.; Mao, Z.; Gu, X.; Huang, S.; Xie, B. Genome-wide analysis of wrky gene family in cucumis sativus. BMC Genom. 2011, 12, 471. [Google Scholar] [CrossRef] [Scilit]
  8. Huang, S.; Gao, Y.; Liu, J.; Peng, X.; Niu, X.; Fei, Z.; Cao, S.; Liu, Y. Genome-wide analysis of wrky transcription factors in solanum lycopersicum. Mol. Genet. Genom. 2012, 287, 495–513. [Google Scholar] [CrossRef] [Scilit]
  9. Guo, C.; Guo, R.; Xu, X.; Gao, M.; Li, X.; Song, J.; Zheng, Y.; Wang, X. Evolution and expression analysis of the grape (vitis vinifera l.) wrky gene family. J. Exp. Bot. 2014, 65, 1513–1528. [Google Scholar] [CrossRef] [Scilit]
  10. Pan, L.J.; Jiang, L. Identification and expression of the wrky transcription factors of carica papaya in response to abiotic and biotic stresses. Mol. Biol. Rep. 2014, 41, 1215–1225. [Google Scholar] [CrossRef] [Scilit]
  11. Kayum, M.A.; Jung, H.J.; Park, J.I.; Ahmed, N.U.; Saha, G.; Yang, T.J.; Nou, I.S. Identification and expression analysis of wrky family genes under biotic and abiotic stresses in brassica rapa. Mol. Genet. Genom. 2015, 290, 79–95. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Chen, M.; Tan, Q.; Sun, M.; Li, D.; Fu, X.; Chen, X.; Xiao, W.; Li, L.; Gao, D. Genome-wide identification of wrky family genes in peach and analysis of wrky expression during bud dormancy. Mol. Genet. Genom. 2016, 291, 1319–1332. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Wei, W.; Hu, Y.; Han, Y.; Zhang, K.; Zhao, F.; Feng, J. The wrky transcription factors in the diploid woodland strawberry fragaria vesca: Identification and expression analysis under biotic and abiotic stresses. Plant Physiol. Biochem. 2016, 105, 129–144. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Yu, Y.; Wang, N.; Hu, R.; Xiang, F. Genome-wide identification of soybean wrky transcription factors in response to salt stress. SpringerPlus 2016, 5, 920. [Google Scholar] [CrossRef] [Scilit]
  15. He, C.; Teixeira da Silva, J.A.; Tan, J.; Zhang, J.; Pan, X.; Li, M.; Luo, J.; Duan, J. A genome-wide identification of the wrky family genes and a survey of potential wrky target genes in dendrobium officinale. Sci. Rep. 2017, 7, 9200. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Wan, Y.; Mao, M.; Wan, D.; Yang, Q.; Yang, F.; Mandlaa; Li, G.; Wang, R. Identification of the wrky gene family and functional analysis of two genes in caragana intermedia. BMC Plant Biol. 2018, 18, 31. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Zou, C.; Jiang, W.; Yu, D. Male gametophyte-specific wrky34 transcription factor mediates cold sensitivity of mature pollen in arabidopsis. J. Exp. Bot. 2010, 61, 3901–3914. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Wang, L.; Zhu, W.; Fang, L.; Sun, X.; Su, L.; Liang, Z.; Wang, N.; Londo, J.P.; Li, S.; Xin, H. Genome-wide identification of wrky family genes and their response to cold stress in vitis vinifera. BMC Plant Biol. 2014, 14, 103. [Google Scholar] [CrossRef] [Scilit]
  19. Li, P.; Song, A.; Gao, C.; Wang, L.; Wang, Y.; Sun, J.; Jiang, J.; Chen, F.; Chen, S. Chrysanthemum wrky gene cmwrky17 negatively regulates salt stress tolerance in transgenic chrysanthemum and arabidopsis plants. Plant Cell Rep. 2015, 34, 1365–1378. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  20. Zhang, Y.; Yu, H.; Yang, X.; Li, Q.; Ling, J.; Wang, H.; Gu, X.; Huang, S.; Jiang, W. Cswrky46, a wrky transcription factor from cucumber, confers cold resistance in transgenic-plant by regulating a set of cold-stress responsive genes in an aba-dependent manner. Plant Physiol. Biochem. 2016, 108, 478–487. [Google Scholar] [CrossRef] [Scilit]
  21. Kim, C.-Y.; Vo, K.T.X.; Nguyen, C.D.; Jeong, D.-H.; Lee, S.-K.; Kumar, M.; Kim, S.-R.; Park, S.-H.; Kim, J.-K.; Jeon, J.-S. Functional analysis of a cold-responsive rice wrky gene, oswrky71. Plant Biotechnol. Rep. 2016, 10, 13–23. [Google Scholar] [CrossRef] [Scilit]
  22. Yokotani, N.; Sato, Y.; Tanabe, S.; Chujo, T.; Shimizu, T.; Okada, K.; Yamane, H.; Shimono, M.; Sugano, S.; Takatsuji, H.; et al. Wrky76 is a rice transcriptional repressor playing opposite roles in blast disease resistance and cold stress tolerance. J. Exp. Bot. 2013, 64, 5085–5097. [Google Scholar] [CrossRef] [Scilit]
  23. Tao, Z.; Liu, H.; Qiu, D.; Zhou, Y.; Li, X.; Xu, C.; Wang, S. A pair of allelic wrky genes play opposite roles in rice-bacteria interactions. Plant Physiol. 2009, 151, 936–948. [Google Scholar] [CrossRef] [Scilit]
  24. Marchive, C.; Mzid, R.; Deluc, L.; Barrieu, F.; Pirrello, J.; Gauthier, A.; Corio-Costet, M.F.; Regad, F.; Cailleteau, B.; Hamdi, S.; et al. Isolation and characterization of a vitis vinifera transcription factor, vvwrky1, and its effect on responses to fungal pathogens in transgenic tobacco plants. J. Exp. Bot. 2007, 58, 1999–2010. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Johnson, C.S.; Kolevski, B.; Smyth, D.R. Transparent testa glabra2, a trichome and seed coat development gene of arabidopsis, encodes a wrky transcription factor. Plant Cell 2002, 14, 1359–1375. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Miao, Y.; Laun, T.; Zimmermann, P.; Zentgraf, U. Targets of the wrky53 transcription factor and its role during leaf senescence in arabidopsis. Plant Mol. Biol. 2004, 55, 853–867. [Google Scholar] [CrossRef] [Scilit]
  27. Luo, M.; Dennis, E.S.; Berger, F.; Peacock, W.J.; Chaudhury, A. Miniseed3 (mini3), a wrky family gene, and haiku2 (iku2), a leucine-rich repeat (lrr) kinase gene, are regulators of seed size in arabidopsis. Proc. Natl. Acad. Sci. USA 2005, 102, 17531–17536. [Google Scholar] [CrossRef] [Scilit]
  28. Miao, Y.; Zentgraf, U. A hect e3 ubiquitin ligase negatively regulates arabidopsis leaf senescence through degradation of the transcription factor wrky53. Plant J. 2010, 63, 179–188. [Google Scholar] [CrossRef] [Scilit]
  29. Grunewald, W.; De Smet, I.; Lewis, D.R.; Löfke, C.; Jansen, L.; Goeminne, G.; Vanden Bossche, R.; Karimi, M.; De Rybel, B.; Vanholme, B.; et al. Transcription factor wrky23 assists auxin distribution patterns during Arabidopsis root development through local control on flavonol biosynthesis. Proc. Natl. Acad. Sci. USA 2012, 109, 1554–1559. [Google Scholar] [CrossRef] [Scilit]
  30. Luo, X.; Sun, X.; Liu, B.; Zhu, D.; Bai, X.; Cai, H.; Ji, W.; Cao, L.; Wu, J.; Wang, M.; et al. Ectopic expression of a wrky homolog from glycine soja alters flowering time in arabidopsis. PLoS ONE 2013, 8, e73295. [Google Scholar] [CrossRef] [Scilit]
  31. Li, W.; Wang, H.; Yu, D. Arabidopsis wrky transcription factors wrky12 and wrky13 oppositely regulate flowering under short-day conditions. Mol. Plant 2016, 9, 1492–1503. [Google Scholar] [CrossRef] [Scilit]
  32. Batista-Santos, P.; Lidon, F.C.; Fortunato, A.; Leitao, A.E.; Lopes, E.; Partelli, F.; Ribeiro, A.I.; Ramalho, J.C. The impact of cold on photosynthesis in genotypes of Coffea spp.—Photosystem sensitivity, photoprotective mechanisms and gene expression. J. Plant Physiol. 2011, 168, 792–806. [Google Scholar] [CrossRef] [Scilit]
  33. Ramalho, J.C.; DaMatta, F.M.; Rodrigues, A.P.; Scotti-Campos, P.; Pais, I.; Batista-Santos, P.; Partelli, F.L.; Ribeiro, A.; Lidon, F.C.; Leitão, A.E. Cold impact and acclimation response of coffea spp. Plants. Theor. Exp. Plant Physiol. 2014, 26, 5–18. [Google Scholar] [CrossRef] [Scilit]
  34. Denoeud, F.; Carretero-Paulet, L.; Dereeper, A.; Droc, G.; Guyot, R.; Pietrella, M.; Zheng, C.; Alberti, A.; Anthony, F.; Aprea, G.; et al. The coffee genome provides insight into the convergent evolution of caffeine biosynthesis. Science 2014, 345, 1181–1184. [Google Scholar] [CrossRef] [Scilit]
  35. Perrois, C.; Strickler, S.R.; Mathieu, G.; Lepelley, M.; Bedon, L.; Michaux, S.; Husson, J.; Mueller, L.; Privat, I. Differential regulation of caffeine metabolism in coffea arabica (arabica) and coffea canephora (robusta). Planta 2015, 241, 179–191. [Google Scholar] [CrossRef] [Scilit]
  36. Castro Caicedo, B.L.; Cortina Guerrero, H.A.; Roux, J.; Wingfield, M.J. New coffee (coffea arabica) genotypes derived from coffea canephora exhibiting high levels of resistance to leaf rust and ceratocystis canker. Trop. Plant Pathol. 2013, 38, 485–494. [Google Scholar] [CrossRef] [Scilit]
  37. Santos, T.B.; de Lima, R.B.; Nagashima, G.T.; Petkowicz, C.L.; Carpentieri-Pipolo, V.; Pereira, L.F.; Domingues, D.S.; Vieira, L.G. Galactinol synthase transcriptional profile in two genotypes of coffea canephora with contrasting tolerance to drought. Genet. Mol. Biol. 2015, 38, 182–190. [Google Scholar] [CrossRef] [Scilit]
  38. Fortunato, A.S.; Lidon, F.C.; Batista-Santos, P.; Eduardo Leitão, A.; Pais, I.P.; Ribeiro, A.I.; Cochicho Ramalho, J. Biochemical and molecular characterization of the antioxidative system of coffea sp. Under cold conditions in genotypes with contrasting tolerance. J. Plant Physiol. 2010, 167, 333–342. [Google Scholar] [CrossRef] [Scilit]
  39. Finn, R.D.; Clements, J.; Eddy, S.R. Hmmer web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [Scilit]
  40. Larkin, M.A.; Blackshields, G.; Brown, N.P.; Chenna, R.; McGettigan, P.A.; McWilliam, H.; Valentin, F.; Wallace, I.M.; Wilm, A.; Lopez, R.; et al. Clustal w and clustal x version 2.0. Bioinformatics 2007, 23, 2947–2948. [Google Scholar] [CrossRef] [Scilit]
  41. Tamura, K.; Stecher, G.; Peterson, D.; Filipski, A.; Kumar, S. Mega6: Molecular evolutionary genetics analysis version 6.0. Mol. Biol. Evol. 2013, 30, 2725–2729. [Google Scholar] [CrossRef] [Scilit]
  42. Hu, B.; Jin, J.; Guo, A.Y.; Zhang, H.; Luo, J.; Gao, G. Gsds 2.0: An upgraded gene feature visualization server. Bioinformatics 2015, 31, 1296–1297. [Google Scholar] [CrossRef] [Scilit]
  43. Bailey, T.L.; Boden, M.; Buske, F.A.; Frith, M.; Grant, C.E.; Clementi, L.; Ren, J.; Li, W.W.; Noble, W.S. Meme suite: Tools for motif discovery and searching. Nucleic Acids Res. 2009, 37, W202–W208. [Google Scholar] [CrossRef] [Scilit]
  44. Tian, T.; Liu, Y.; Yan, H.; You, Q.; Yi, X.; Du, Z.; Xu, W.; Su, Z. Agrigo v2.0: A go analysis toolkit for the agricultural community, 2017 update. Nucleic Acids Res. 2017, 45, W122–W129. [Google Scholar] [CrossRef] [Scilit]
  45. Ye, J.; Fang, L.; Zheng, H.; Zhang, Y.; Chen, J.; Zhang, Z.; Wang, J.; Li, S.; Li, R.; Bolund, L.; et al. Wego: A web tool for plotting go annotations. Nucleic Acids Res. 2006, 34, W293–W297. [Google Scholar] [CrossRef] [Scilit]
  46. Van Bel, M.; Diels, T.; Vancaester, E.; Kreft, L.; Botzki, A.; Van de Peer, Y.; Coppens, F.; Vandepoele, K. Plaza 4.0: An integrative resource for functional, evolutionary and comparative plant genomics. Nucleic Acids Res. 2018, 46, D1190–D1196. [Google Scholar] [CrossRef] [Scilit]
  47. Livak, K.J.; Schmittgen, T.D. Analysis of relative gene expression data using real-time quantitative pcr and the 2−δδct method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef] [Scilit]
  48. Saeed, A.I.; Sharov, V.; White, J.; Li, J.; Liang, W.; Bhagabati, N.; Braisted, J.; Klapa, M.; Currier, T.; Thiagarajan, M.; et al. Tm4: A free, open-source system for microarray data management and analysis. Biotechniques 2003, 34, 374–378. [Google Scholar] [CrossRef] [Scilit]
  49. He, H.; Dong, Q.; Shao, Y.; Jiang, H.; Zhu, S.; Cheng, B.; Xiang, Y. Genome-wide survey and characterization of the wrky gene family in populus trichocarpa. Plant Cell Rep. 2012, 31, 1199–1217. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Jaillon, O.; Aury, J.M.; Noel, B.; Policriti, A.; Clepet, C.; Casagrande, A.; Choisne, N.; Aubourg, S.; Vitulo, N.; Jubin, C.; et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature 2007, 449, 463–467. [Google Scholar]
  51. Ramiro, D.; Jalloul, A.; Petitot, A.; De Sa, M.F.G.; Maluf, M.P.; Fernandez, D. Identification of coffee wrky transcription factor genes and expression profiling in resistance responses to pathogens. Tree Genet. Genomes 2010, 6, 767–781. [Google Scholar] [CrossRef] [Scilit]
  52. Wang, Y.; Feng, L.; Zhu, Y.; Li, Y.; Yan, H.; Xiang, Y. Comparative genomic analysis of the wrky iii gene family in populus, grape, arabidopsis and rice. Biol. Direct. 2015, 10, 48. [Google Scholar] [CrossRef] [Scilit]
  53. Karanja, B.K.; Fan, L.; Xu, L.; Wang, Y.; Zhu, X.; Tang, M.; Wang, R.; Zhang, F.; Muleke, E.M.; Liu, L. Genome-wide characterization of the wrky gene family in radish (raphanus sativus l.) reveals its critical functions under different abiotic stresses. Plant Cell Rep. 2017, 36, 1757–1773. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Xu, G.; Guo, C.; Shan, H.; Kong, H. Divergence of duplicate genes in exon-intron structure. Proc. Natl. Acad. Sci. USA 2012, 109, 1187–1192. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. Evolutionary relationships of WRKY genes in C. canephora and other species. UG, ungrouped, indicates the subfamily members from a distinct group in a combined phylogenetic tree. Green arrowheads indicate all genome triplication events. The blue arrowheads show all genome duplication events. The red lines trace lineages of five species that have not undergone further polyploidization. The number of WRKY genes in Solanum lycopersicum, Vitis vinifera, Glycine max, Fragaria vesca, Prunus persica, and Populus trichocarpa were collected from previous studies [8,9,10,11,12,13,14,15,16,49]. The phylogeny and genome duplication history of core eudicots was also cited from a previous study [34].
Figure 1. Evolutionary relationships of WRKY genes in C. canephora and other species. UG, ungrouped, indicates the subfamily members from a distinct group in a combined phylogenetic tree. Green arrowheads indicate all genome triplication events. The blue arrowheads show all genome duplication events. The red lines trace lineages of five species that have not undergone further polyploidization. The number of WRKY genes in Solanum lycopersicum, Vitis vinifera, Glycine max, Fragaria vesca, Prunus persica, and Populus trichocarpa were collected from previous studies [8,9,10,11,12,13,14,15,16,49]. The phylogeny and genome duplication history of core eudicots was also cited from a previous study [34].
Forests 10 00335 g001
Figure 2. Chromosomal location of 49 CcWRYKs. CcWRKY47–49 (Cc00_g06830, Cc00_g13890, Cc00_g21560) were putatively located on ‘Chromosome Unknown’. The chromosomal structure and gene locations were obtained from the Coffee Genome Hub (http://coffee-genome.org/) [33].
Figure 2. Chromosomal location of 49 CcWRYKs. CcWRKY47–49 (Cc00_g06830, Cc00_g13890, Cc00_g21560) were putatively located on ‘Chromosome Unknown’. The chromosomal structure and gene locations were obtained from the Coffee Genome Hub (http://coffee-genome.org/) [33].
Forests 10 00335 g002
Figure 3. Phylogenetic tree of CcWRKY proteins. The multiple protein sequence alignment was performed using ClustalX2. The NJ (neighbor-joining) tree was constructed in MEGA6 while using a Poisson model with the following options: pairwise deletion, homogeneous pattern, and 1000-replicate bootstrap. Different clades (or subclades) are indicated by the colors of the branch lines, respectively. The red cycles indicate the gene ID from Arabidopsis, and the blue triangle indicates the gene from C. canephora.
Figure 3. Phylogenetic tree of CcWRKY proteins. The multiple protein sequence alignment was performed using ClustalX2. The NJ (neighbor-joining) tree was constructed in MEGA6 while using a Poisson model with the following options: pairwise deletion, homogeneous pattern, and 1000-replicate bootstrap. Different clades (or subclades) are indicated by the colors of the branch lines, respectively. The red cycles indicate the gene ID from Arabidopsis, and the blue triangle indicates the gene from C. canephora.
Forests 10 00335 g003
Figure 4. qRT-PCR analysis of expression patterns of CcWRKYs and their ten putative targeted genes under cold stress. A, genes were downregulated by 4 °C/4 °C cold treatments. B, genes downregulated by 13 °C/8 °C and 4 °C/4 °C cold treatments. C, genes were upregulated by 13 °C/8 °C and 4 °C/4 °C cold treatments. D, genes were upregulated by 4 °C/4 °C cold treatments. E, genes with no significantly changed expression under cold treatment.
Figure 4. qRT-PCR analysis of expression patterns of CcWRKYs and their ten putative targeted genes under cold stress. A, genes were downregulated by 4 °C/4 °C cold treatments. B, genes downregulated by 13 °C/8 °C and 4 °C/4 °C cold treatments. C, genes were upregulated by 13 °C/8 °C and 4 °C/4 °C cold treatments. D, genes were upregulated by 4 °C/4 °C cold treatments. E, genes with no significantly changed expression under cold treatment.
Forests 10 00335 g004
Figure 5. Gene ontology (GO) analysis of CcWRKY target genes. Categories pertaining to cellular components (green color), molecular functions (blue color), and biological processes (red color) were defined by GO classification.
Figure 5. Gene ontology (GO) analysis of CcWRKY target genes. Categories pertaining to cellular components (green color), molecular functions (blue color), and biological processes (red color) were defined by GO classification.
Forests 10 00335 g005
Table 1. Conserved motifs identified in the CcWRKY proteins. The underlined letters indicate the conserved WRKY domains and zinc finger motifs.
Table 1. Conserved motifs identified in the CcWRKY proteins. The underlined letters indicate the conserved WRKY domains and zinc finger motifs.
MotifE ValueSitesWidthBest Possible MatchGroups
19.2 × 10−10824931EVDILDDGYRWRKYGQKVVKGNPNPRSYYKCI, II a, II b, II c, II d, II e, III
21.2 × 10−8504929GCPVRKQVQRCLEDMSILITTYEGTHNHPI, II a, II b, II c, II d, II e, III
38.2 × 10−2421040AEDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERI
41.1 × 10−741024LDGQITEIVYKGNHNHPKPQSTRRI
55.8 × 10−653715QKKTRKPRFAFQTRSI, II a, II b, II c, II d, III
63.3 × 10−59839MGEVMEENQKLRMHLDRVMKEYRALQMQFHDMVQQEPNKII a, II b
72.4 × 10−53932SFADTLSAATAAITADPNFTAALAAAISSIIGII a, II b
81.7 × 10−31629VAATAMASTTSAAASMLMSGSTTSTSGLLII b
95.3 × 10−21633LTIPPGLSPTSFLESPVLLSNIKAEPSPTTGTFI
102.7 × 10−11719ISASAPFPTVTLDLTQNPNII a, II b
Table 2. GO enrichment of the 235 putative CcWRKY target genes involved in the biological processes of response to cold (GO: 0009409).
Table 2. GO enrichment of the 235 putative CcWRKY target genes involved in the biological processes of response to cold (GO: 0009409).
GO TermOntologyDescriptionNo. 1FDR 2
GO:0019320PHexose catabolic process95.9 × 10−5
GO:0044262PCellular carbohydrate metabolic process175.9 × 10−5
GO:0006006PGlucose metabolic process105.9 × 10−5
GO:0006007PGlucose catabolic process95.9 × 10−5
GO:0046365PMonosaccharide catabolic process95.9 × 10−5
GO:0006091PGeneration of precursor metabolites and energy115.9 × 10−5
GO:0006096PGlycolysis85.9 × 10−5
GO:0005975PCarbohydrate metabolic process285.9 × 10−5
GO:0005544FCalcium-dependent phospholipid binding66.0 × 10−5
GO:0044275PCellular carbohydrate catabolic process91.1 × 10−4
GO:0046164PAlcohol catabolic process91.1 × 10−4
GO:0016052PCarbohydrate catabolic process101.5 × 10−4
GO:0019318PHexose metabolic process101.5 × 10−4
GO:0005996PMonosaccharide metabolic process102.3 × 10−4
GO:0006066PAlcohol metabolic process114.0 × 10−4
GO:0005509FCalcium ion binding128.3 × 10−4
GO:0005543FPhospholipid binding69.9 × 10−4
GO:0044282PSmall-molecule catabolic process91.8 × 10−3
GO:0006414PTranslational elongation52.9 × 10−3
GO:0044265PCellular macromolecule catabolic process103.2 × 10−3
GO:0009057PMacromolecule catabolic process115.2 × 10−3
GO:0044248PCellular catabolic process119.3 × 10−3
GO:0044281PSmall-molecule metabolic process231.6 × 10−2
GO:0009058PBiosynthetic process431.6 × 10−2
GO:0035251FUDP-glucosyltransferase activity51.8 × 10−2
GO:0008289FLipid binding61.8 × 10−2
GO:0009056PCatabolic process122.2 × 10−2
GO:0046527FGlucosyltransferase activity52.5 × 10−2
GO:0044237PCellular metabolic process772.9 × 10−2
GO:0006633PFatty acid biosynthetic process53.6 × 10−2
GO:0050794PRegulation of cellular process234.3 × 10−2
1 Number of genes in our study included in the 235 putative CcWRKY target genes. 2 FDR, false discovery rate.

Share and Cite

MDPI and ACS Style

Dong, X.; Yang, Y.; Zhang, Z.; Xiao, Z.; Bai, X.; Gao, J.; Hur, Y.; Hao, S.; He, F. Genome-Wide Identification of WRKY Genes and Their Response to Cold Stress in Coffea canephora. Forests 2019, 10, 335. https://doi.org/10.3390/f10040335

AMA Style

Dong X, Yang Y, Zhang Z, Xiao Z, Bai X, Gao J, Hur Y, Hao S, He F. Genome-Wide Identification of WRKY Genes and Their Response to Cold Stress in Coffea canephora. Forests. 2019; 10(4):335. https://doi.org/10.3390/f10040335

Chicago/Turabian Style

Dong, Xiangshu, Yanan Yang, Ziying Zhang, Ziwei Xiao, Xuehui Bai, Jing Gao, Yoonkang Hur, Shumei Hao, and Feifei He. 2019. "Genome-Wide Identification of WRKY Genes and Their Response to Cold Stress in Coffea canephora" Forests 10, no. 4: 335. https://doi.org/10.3390/f10040335

APA Style

Dong, X., Yang, Y., Zhang, Z., Xiao, Z., Bai, X., Gao, J., Hur, Y., Hao, S., & He, F. (2019). Genome-Wide Identification of WRKY Genes and Their Response to Cold Stress in Coffea canephora. Forests, 10(4), 335. https://doi.org/10.3390/f10040335

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop