Next Article in Journal
Functional and Bioactive Properties of Peptides Derived from Marine Side Streams
Next Article in Special Issue
Marine Sulfated Polysaccharides as Promising Antiviral Agents: A Comprehensive Report and Modeling Study Focusing on SARS CoV-2
Previous Article in Journal
Screening of Marine Bioactive Antimicrobial Compounds for Plant Pathogens
Previous Article in Special Issue
Viridicatol Isolated from Deep-Sea Penicillium Griseofulvum Alleviates Anaphylaxis and Repairs the Intestinal Barrier in Mice by Suppressing Mast Cell Activation
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Molecular and Structural Characterizations of Lipases from Chlorella by Functional Genomics

1
Laboratoire de Génie Enzymatique et de Microbiologie, Equipe de Biotechnologie des Algues, Ecole Nationale d’Ingénieurs de Sfax, Université de Sfax, Sfax 3038, Tunisia
2
Laboratoire de Biochimie et de Génie Enzymatique des Lipases, Ecole Nationale d’Ingénieurs de Sfax, Université de Sfax, Sfax 3038, Tunisia
3
Laboratoire de Biotechnologie Végétale Appliquée à l’Amélioration des Cultures, Faculté des Sciences de Sfax, Université de Sfax, Sfax 3038, Tunisia
4
CNRS, SIGMA Clermont, Institut Pascal, Université Clermont-Auvergne, F-63000 Clermont-Ferrand, France
*
Authors to whom correspondence should be addressed.
Mar. Drugs 2021, 19(2), 70; https://doi.org/10.3390/md19020070
Submission received: 27 December 2020 / Revised: 24 January 2021 / Accepted: 26 January 2021 / Published: 28 January 2021
(This article belongs to the Special Issue Marine Microbial Diversity as Source of Bioactive Compounds)

Abstract

Microalgae have been poorly investigated for new-lipolytic enzymes of biotechnological interest. In silico study combining analysis of sequences homologies and bioinformatic tools allowed the identification and preliminary characterization of 14 putative lipases expressed by Chlorella vulagaris. These proteins have different molecular weights, subcellular localizations, low instability index range and at least 40% of sequence identity with other microalgal lipases. Sequence comparison indicated that the catalytic triad corresponded to residues Ser, Asp and His, with the nucleophilic residue Ser positioned within the consensus GXSXG pentapeptide. 3D models were generated using different approaches and templates and demonstrated that these putative enzymes share a similar core with common α/β hydrolases fold belonging to family 3 lipases and class GX. Six lipases were predicted to have a transmembrane domain and a lysosomal acid lipase was identified. A similar mammalian enzyme plays an important role in breaking down cholesteryl esters and triglycerides and its deficiency causes serious digestive problems in human. More structural insight would provide important information on the enzyme characteristics.

1. Introduction

The industrial enzymes market is estimated to be valued at USD 5.9 billion in 2020 and is projected to reach USD 8.7 billion by 2026, recording a Compound Annual Growth Rate (CAGR) of 6.5%, in terms of value [1]. The majority of enzymes currently used in industrial processes (more than 75%) are hydrolases [2]. Lipases represent the third most commercialized enzymes, after carbohydrases and proteases [3], and their production has constantly increased, they now account for more than one-fifth of the global enzyme market. The global Lipase Market size is anticipated to develop at a notable CAGR of about 7% over the calculated period from the current value of USD 0.6 billion in 2020. Lipases form an integral part of the industries ranging from biodiesels, food, nutraceuticals and detergents with little utilization in bioremediation, agriculture, cosmetics and leather [4].
Although lipases are produced by a huge number of organisms (bacterial, plant and animal origin), microbial lipases have attracted far more interest from researchers and industries than lipases from other sources, due to both their specific features and ease of production on large scale [5,6,7]. Notwithstanding current achievements, there is still a quest for lipases with improved and/or novel catalytic features like stability in harsh environments. Marine organisms can be an adequate source for such lipases as marine enzymes have demonstrated their useful for both process improvement and for the development of new process or products. Relevant types of lipases from marine organisms were identified and their novel features were discussed. They display, for example, salt tolerance, calcium independence and thermostable activities; they can also be stable in alkaline environment and were suggested to have antibiofilm action and higher catalytic efficiencies at temperatures lower than those from terrestrial microbial and/or mammal lipases [8]. However, few microalgal lipases and genes encoding lipases have been investigated and compared to bacterial, fungal, animal and plant lipases. In 2010, Demir and Tukel isolated and characterized for the first time a lipase from the photosynthetic cyanobacterium Arthrospira. platensis [9]. The lipase was a monomeric protein of 45 kDa with an isoelectric point of 5.9. It was specific for the 3-position in the ester bond. Godet et al. [10] isolated a new gene from the microalgae Isochrysis galbana encoding a 49 kDa lipase that shares similarities with fungal known lipase sequences. Chlorella vulgaris is a microalga belonging to the order of the Chlorococcales, which has a green color. It contains a significant number of intracellular proteins, carbohydrates, lipids, vitamin C, β-carotenes and B vitamins (B1, B2, B6 and B12), which is why it is commonly used for the preparation of food supplements. It is considered as raw materials for chemical compounds that have been affected by its primary and secondary metabolism, such as lipids, whose main application is for the generation of biodiesel [11]. This microalga has one of the highest lipid accumulating abilities in microalgae (50% of its DW), very high volumetric lipid productivity (VLP) of about 80 mg/L.day with a high growth rate in large-scale outdoor cultivation systems. Genetic manipulation technique for this microalga has already been established, showing great promise for improving its oleaginous phenotype by metabolic engineering [12]. Recently, its whole genome sequence was revealed by next-generation sequencing technologies, and the major metabolic pathways were identified [13]. Lipid metabolism has also been analyzed in multi-omics studies, including transcriptomics and proteomics to obtain the mechanistic insight of its lipid biosynthesis [14]. However, the TAG lipases have not been investigated yet. It will be of great importance to estimate the number and characteristics of its lipases, attracting knockdown targets for enhancement of lipid productivity. Here, a bioinformatic screening of a C. vulgaris genome was done to explore the presence of genes encoding putative lipases. The potential properties of the candidates are discussed on the basis of their three-dimensional (3D) model structures.

2. Results

2.1. Sequence Retrieval

The results of the amino acid sequence search showed that 14 protein sequences from nine C. vulgaris strains of the UTEX259 UTEX259 culture collection (taxid 3077)-scaffolds met determined criteria. The accession numbers of Transcriptome Shotgun Assembly (TSA) and Whole Genome Shotgun (WGS) sequences are given in Table 1andTable 2, respectively. As can be seen from the Table 1, all found lipase sequences belong to AB_hydrolase family (Interpro number IPR029058) and display Acyl hydrolase motif GXSXG. Nine of them show high sequence identity to Lipase_3 domain-containing protein (Chlorella variabilis) from the ESTHER database. Two sequences, namely Lip_5800 and Lip_5999, present high identity with sn1-specific diacylglycerol lipases alpha from Auxenochlorella protothecoides and Micractinium conductrix, respectively. In addition, 46.6% of sequence identity with chloroplastic Phospholipase A1 from M. conductrix was also detected with Lip_3448. Sequence homology analysis with multiple alignments revealed that these 14 sequences could be broadly clustered into two groups; 3 probable sn1-diacylglycerol lipases and 11 other lipase_3 family. Subsequently, gene prediction experiments were carried out with ab initio gene models (Table 2). These predictions showed different scaffold localization of the predicted lipase sequences with an exon number varying from 8 (Lip_5800 and Lip_5462) to 23 (Lip_2999). Lip_4551 and Lip_6297 lipases genes were found to be tandemly arrayed in the genome structure. These two genes have different sequence and size and their adjacent organization could allow faster transcription [15].

2.2. Physicochemical Characterization of Protein Sequences

ProtParam parameters shown in Table 3 reveal protein lengths varying from 421 to 1145 amino acids corresponding to diverse molecular masses (from 44.8 to 124.3 kDa). Various theoretical isoelectric points (Ip) were also found (4.09 to 9.34) and all proteins were predicted to have high molar extinction coefficients (46,300 to 193,210). Predicted repeats, motifs and localizations are given in Table 4. Among all predicted lipases, seven proteins have transmembrane motifs, including four predicted as being localized in plasma membrane and three in chloroplastic membrane. The seven other lipases have different cellular localizations (cytoplasmic, mitochondrian, chloroplastic or extracellular space), with five of them possessing a predicted signal peptide sequence. This enhances the possibility of extracellularity prediction however the signal peptides of chloroplasts and mitochondria are also N-terminal cleavable peptides [16]. They are less characterized than the secretory ones, but they are both rare in negatively charged amino acids and able to fold into amphiphilic α-helices [17].
The half-life is a prediction of the time it takes for half of the amount of protein in a cell to disappear after its synthesis in the cell; for all predicted lipases, it was found to be 30 h in mammalian (in vitro), more than 20 h in yeast, (in vivo) and more than 10 h in Escherichia coli (in vivo). ProtParam classifies also all studies proteins as stable (Instability index < 40).
Soluble predicted lipases have molecular weights between 44.8 and 102.5 kDa and Ip between 4.09 and 8.5. Concordant results were found by Ursu et al. [18]. The authors demonstrated, using the 2-DE profile of C. vulgaris soluble proteins, the presence of two protein groups that have been identified considering their isoelectrical points: a main group, having an Ip range of 4.0–5.5, and a minor group, with an Ip range of 6.0–8.0. However, the majority of separated proteins have apparent molecular weights range between 12 and 75 kDa. The difference observed herein could be explained by the fact that some proteins are not expressed under the culture conditions used by the authors.

2.3. D-Structural Modeling

The programs for 3D structural modeling automatically selected template structures mostly from fungal lipases as shown in Table S1 (PDBs: 6A0w, 6qpr, 4jei, 3o0d, 6unv, 4tgl, 3tgl). All models presented the typical α/β-hydrolase fold, with mostly parallel β-sheets, flanked on both sides by α-helixes. The highly conserved catalytic triad (serine, aspartic/glutamic acid and histidine) and the oxyanionic hole were well orientated in the space. The α/β hydrolase fold is one of the most thriving architectures in proteins across kingdoms, providing the skeleton for diverse enzymes [19] as well as an emerging class of non-catalytic but functionally important receptors [20]. Some of the predicted structures were very similar with the typical lipase motifs and are formed by one domain, but some other possesses an extra-transmembrane domain which could be quite bulky (Lip_4551 displays 9 helices against 4 for Lip_3928). Few membrane-bound lipases over intracellular or extracellular counterparts were studied. Recently the catalytic behavior of a membrane-associated lipolytic enzyme (MBL-Enzyme) from the microalgae Nannochloropsis oceanica was investigated by Savvidou et al. [21].

3. Discussion

TAG lipases responsible for the degradation of the lipids accumulated in oil bodies are attractive knockdown targets for the enhancement of the lipid productivity and storage in microalgae. Nonetheless, considering the numerous data available on bacterial, terrestrial plant and animal lipases those from algae and more especially microalgae have been relatively neglected. Therefore, more emphasize has to be given to the characterization of algal lipases, and hence, further work is needed in these aspects. Future approaches to maximize the enzymatic potential of microalgae are likely to focus on three different strategies: (i) the use of ever-increasing amounts of available omics data to optimize microalgal strains for the production of valuable products, through the overexpression of one or more enzymes by the use of genome editing tools; (ii) the identification and subsequent characterization of metabolic pathways involving the production of specific enzymes, such as lipases which are still poorly characterized; (iii) the search for genes with direct biotechnological applications in microalgal genomes and transcriptomes datasets. The feasibility of employing any of the aforementioned approaches or a combination of them will be directly influenced by progress in growth and genetic manipulation of microalgae.
In this study, we have used computational approach to identify lipase genes and to classify the respective lipases from a C. vulgaris strain. Lipases operate usually at the interface between lipid and water. An important feature of many lipases that is used for lipase classification is the presence of a mobile subdomain lid or flap located over the active site [22]. Among the 14 putative TAG lipases identified after C. vulgaris genome analysis, 10 have high identity in ESTHER database with Lipase_3 domain-containing protein. Family 3 of lipolytic enzymes are widely distributed in animals, plants and prokaryotes and possess the conserved consensus sequence GXSXG. Members of this family were demonstrated to be very closely related and exhibit the canonical α/β-hydrolase fold as well as the typical catalytic triad. Enzymes of this class exhibit also high activities at low temperature (less than 15 °C) believed to originate from a conserved sequence motifs they display [23]. Four lipases out of the 10 aforementioned were predicted to be either cytoplasmic, chloroplastic or extracellular. The six remaining could be anchored to a membrane with a distinct N-terminal transmembrane domain formed by at least four transmembrane helices (Figure 1 and Figure 2). Lip_4551 and Lip_2999 were predicted with quite similar 3D models composed of three domains: a catalytic domain containing the catalytic triad and a one helix lid, an N terminal transmembrane domain formed by long helices and a C terminal domain with mainly α helices (Figure 2). It has been reported that 10 additional modules can be attached to the core domain including lid modules, cap modules, N-terminal or C-terminal domains. Accordingly, superfamilies could be assigned to five groups (core, lid, cap, one additional domain or two additional domains) [24]. Predicted transmembrane domains by bioinformatic tools were already reported for microalga lipases [25]. Some authors characterized and used as a self-immobilized lipase for esterification reactions membrane bound lipase from microalga [21]. The membrane localization could be in intracellular or extracellular counterparts or even in lipid droplets (LD). In eukaryotes, some TAG lipases and their cofactors have been demonstrated to localize to LDs [26]. For example, Diatom Oleosome-Associated Protein 1 (DOAP1) is translocated from the ER to LDs in Fistulifera solaris [27].
As for Lip_3448, the N terminal module is a PLAT domain found in a variety of lipid-associated proteins. It forms a β-sandwich composed of two β-sheets of four β-strands each, which is known as a C2 domain in pfam classification. Interestingly, two predicted lipases have a C terminal module only composed of α helices. These two proteins (Lip_5800 and Lip_5999) are shown to be closely related in cladogram of sequence similarity. Hence, the predicted lipases could be classified into a main core with Rossman fold architecture lipases (Lip_1704, Lip_1795, Lip_4364, Lip_6297, Lip_5462, Lip_3928, Lip_4575), two domain lipases (Lip_4232, Lip_3448, Lip_3076, Lip_5800, Lip_5999) and three domain lipases including a transmembrane domain (Lip_2999 and Lip_4551).
Oxyanion holes are crucial for high-energy oxyanion intermediate stabilization. They consist of two residues, which donate their backbone amide protons to stabilize the substrate in the transition state. In fact, during hydrolysis, a negatively charged tetrahedral intermediate is generated and the oxygen ion formed modulates the catalytic efficiency of the enzyme [28]. The first residue is located in the structurally conserved nucleophilic elbow. As a consequence, its backbone amide is positioned identically in all lipases. In contrast, the second oxyanion hole residue is not located in a region with conserved sequence and structure between lipases, but in a loop between the β3-strand and the αA-helix in the core module [29,30]. Consequently, lipases are classified into three classes according to their oxyanion hole type: GX, GGGX and Y [31]. In all lipases, the first oxyanion hole is a conserved glycine which contacts the nucleophilic elbow (highlighted with a star in Figure 3). When the oxyanion hole is formed by the amide backbone of the C-terminal neighbor X of this conserved glycine, it is termed as ‘GX type,’ with X being the second oxyanion hole residue. In our case, the inspection of the multiple sequence alignment of the 14 lipases demonstrates they belong all to the GX class with the conserved glycine (G) residue followed by an alanine (A), cysteine (C) or serine (S) residue (Figure 3). The lipases with GX oxyanion hole type are widely distributed and diverse, and they usually prefer hydrolyzing medium and long chain substrates [32]. The type of amino acid X is conserved inside the superfamilies; for example, it is hydrophilic in Candida antarctica like lipases (T), filamentous fungi lipases and cutinases (S, T), and hydrophobic in Moraxella (F), Mycoplasma (F, W) and Pseudomonas lipases (L, F, M) [29].
According to the shape of the binding site cavity, lipases can be divided into three categories: (i) lipases with a funnel-like binding site (lipases from the mammalian pancreas and cutinase), (ii) lipases with tunnel-like binding sites (lipases from Candida rugosa, and Candida antarctica A) [33] and (iii) lipases with a crevice-like binding site (lipases from Rhizomucor sp. and Rhizopus sp.) [34]. It should be noted that most of the template structures used for 3D modeling are lipases from Rhizomucor miehei. In addition, the inspection of predicted open lid models like Lip_1704 showed a crevice-like cavity shape as shown in Figure 4.
The amphipathic nature of the lid is crucial for the substrate specificity. It provides new insight into the structural basis of lipase substrate specificity and a way to tune the substrate preference of lipases. Based on the type of lid domain, lipases were also classified into three groups, such as lipases without lids, lipases with one loop or one helix lids and lipases with two or more helix lids. It has been reported that high temperature lipases contain larger lid domains with two or more helices, and that all mono- and diacylglycerol lipases have a small lid with a form of loop or helix [22]. As shown in Figure 1 and Figure 2, almost all lipases found in C. vulgaris have small lids with one loop (Lip_4364) or one helix (Lip_1704). However, Lip_5462 displays an entire cap domain with three small helices lid covering a deep cavity of 15.6 Å and shows, surprisingly, 40% of sequence identity with human lysosomal acid lipase (LAL). In fact, it has been demonstrated that, in addition to the direct association of lipases to oil bodies, macro-autophagy (referred to as lipophagy) plays a critical roles in lipid catabolism in eukaryotes [35]. During this type of autophagy, autophagosomes containing a portion of an oil body are merged with lysosomes containing LAL, which could contribute to TAG degradation [36]. Transcriptomic analysis of Neochloris oleoabundans (an oleaginous microalga) reveals up regulation of an LAL encoding gene under nitrogen starvation condition [37]. Accordingly, the in silico prediction method used for lipases of C. vulgaris allowed the identification of Lip_5264, which could be transported to lysosomes. This enzyme was predicted to have a signal peptide and 40% of sequence identity with the human LAL. It consists of a core domain belonging to the classical α/β hydrolase-fold family with a classical catalytic triad (Ser-161, His-378, Asp-347), an oxyanion hole and a “cap” domain, which probably regulates substrate entry to the catalytic site (Figure 5). LAL breaks down cholesteryl esters (CEs) and TGs into free cholesterol, glycerol and fatty acids (1–3). Defective LAL have been associated with two autosomal recessive diseases in humans: Wolman’s disease and CE storage disease [38,39]. The gene of Lip_5264 consists of 8 exons spread over almost 4 kb, while human LAL consists of 10 exons spread over 36 kb. Lip_5264 encodes a 445 amino acid mature protein following the cleavage of 24 signaling peptide residues, with an expected molecular mass of 50 kDa whereas human LAL encodes for 378 residues with a signal peptide of 21 amino acids and a molecular mass of 43 kDa. The two compared proteins are glycosylated and share high structure identity, as shown in Figure 5c with some differences, including the lid helices, which contain a cluster of highly conserved Cys residues C 236 and C 243 (Lip_5264 numbering) (Figure 5d). The lysosomal proteins in microalga have not yet been fully investigated, and it remains unclear how lipophagy contributes to lipid degradation. These should be an attractive research topic in a future work. Microalgae are a good source of nutrients for human nutrition. However, they are also rich in various biomolecules, which may have a potential in promoting human health. Defective or diminished LAL activity of human LAL has been associated with some mutations and the molecular mechanisms of these loss-of-function mutants leading to WD and CESD have yet to be explored. Some study demonstrated that these mutations could be located in the signal peptide or in the lid domain [40]. A complete physicochemical characterization of this C. vulgaris LAL combined with a deep structure–function relationship investigation of the probable mutation effect using a structure-based molecular model speculating the loss of function could be of interest. The current treatment options for CESD phenotypes are limited to diets excluding cholesterol and lipid-rich food, cholesterol lowering drugs such as statins and ultimately liver transplantation. Recombinant LAL replacement therapy has been shown to be effective in animal models and human clinical trials and was recently authorized in Europe and the United States [41].

4. Materials and Methods

4.1. Sequence Retrieval

BlastP search was performed using amino acid sequences of functionally characterized lipases from terrestrial plants (Trifolium pretense and Diplocarpon rosae), fungi (Colletotrichum chlorophyti), microalga (Scenedesmus sp. and Symbiodinium microadriaticum) and bacteria (Pseudomonas fluorescens and B. subtilis) available in the NCBI database (http://ncbi.nlm.gov/protein/). The FASTA sequences were searched using tblastn modality against Transcriptome Shotgun Assembly database (TSA) of C. vulgaris strain UTEX259 UTEX259 (taxid 3077) and every hit with an E-value < 10−5 was identified as putative Lipase transcript. The open reading frames (ORFs) were searched using the ORF finder program [42] and the longer ones were blasted a second time against non-redundant protein database to ensure that the respective TSA corresponds to a putative Lipase ORF. The selected TSA sequences were submitted to a blastn search against the whole Genome Shotgun contigs (WGS) database of the same C. vulgaris strain (taxid 3077) and single hits with E-value < 10−100 were identified as scaffolds with putative Lipase genes. Gene predictions from the selected WGS scaffolds were performed using ab initio gene models through Augustus [43]. The application was trained on the gene structures of Chlamydomonas reinhardtii and the TSA sequences were used in cDNA uploaded option. The final output ORF and protein sequences were saved for further in silico analysis.

4.2. Multiple Sequence Alignment

The multiple sequence alignment and calculation of cladogram illustrating sequence similarity relationships among the 14 putative lipase sequences was executed by MAFFT (v7.310) with G-INS-1 strategy, unalign level 0.8, leave gappy region options for alignment and UPGMA as average linkage method for clustering. Rendering was done using ESPript [44].

4.3. Physicochemical Characterization of Protein Sequences

Basic physicochemical properties such as molecular weight, extinction coefficient, isoelectric point, aliphatic index, grand average of hydropathicity and instability index were estimated by ProtParam tool (http://web.expasy.org/protparam/) [35]. Extinction coefficients were calculated assuming all pairs of Cys residues form cystines or assuming all Cys residues are reduced. Sequence analysis and lipase motifs search were performed with InterPro [45] and the Expasy my hits search tool (https://myhits.isb-sib.ch/cgi-bin/motif_scan), respectively. These sequences were also compared in the ESTHER database to check higher sequence identity [19]. For predicting subcellular localization Deepmito [46], Mitoprot v1.101 [47], HECTAR v1.3 [48] and TMHMM v2.0 [49] were performed. Putative signal peptides in each sequence were predicted using the SignalP 4.0 server [50]. Since N-glycosylation was widly described for lipases prediction of N-glycosylation sites were performed using NetOGlyc 4.0 Server [51].

4.4. Tertiary Structure Prediction, Structure Validation and Quality Prediction

Three-dimensional models of the selected putative enzymes were generated using different approaches. For sequences with acceptable homology in the template of the programs, UCSF Chimera (https://www.rbvi.ucsf.edu/chimera/) and the automated protein homology modeling server SWISS-MODEL (http://swissmodel.expasy.org/) were used. For sequences with low homology with the structures in the database, multiple-threading alignments using the I-TASSER approach (zhanglab.ccmb.med.umich.edu/I-TASSER/) was used. I-TASSER is an automated bioinformatics tool for predicting protein structures from an amino acid sequence followed by iterative structural assembly simulations and atomic-level structure refinement.
The predicted structures were evaluated to ensure correctness of the model stereochemistry, as checked by a Ramachandran plot (http://mordred.bioc.cam.ac.uk/~rapper/rampage.php) (Lovell et al., 2003) and Verify 3D [52]. The Ramachandran plot scores of the predicted structures showed more than 90% of the amino acids were in favorable regions. ProSA-web Z-score plot (https://prosa.services.came.sbg.ac.at/prosa.php) [53] was used to check whether the Z-score of the input structures is within the range of typically found for the native proteins of a similar size. The Z-score values of all protein structures checked in this study were highlighted as a black dot, which indicates being in the range of native conformations. The final modeled structures were further energetically minimized and molecular dynamics simulation was performed with CABS-flex 2.0 (http://212.87.3.12/CABSflex2). The latter program is an efficient simulation engine that allows modeling of the large-scale conformational change related to protein flexibility [54]. The models were comprehensively analyzed using PyMol (http://pymol.org/) to check for the presence of a lid, and the existence and orientation of the catalytic triad. The depth of the putative intramolecular tunnels was calculated with DEPTH [55] taking residues from the oxyanion hole in each candidate as the cavity end point.

5. Conclusions

Genomic mining by combining bioinformatics analysis and functional screening provides opportunities to find out novel biocatalysts, such as lipases. The present study allowed the in silico characterization of 14 putative C. vulgaris lipases with different cellular localization. Membrane associated lipases were also detected and described for the first time in this species. The 14 lipases display an acyl hydrolase motif (GXSXG) and belong to the α/β hydrolase lipase 3 family and GX class. These putative lipases could be candidates for metabolic engineering in a future study to improve this microalga lipid productivity. In this study, we also report, for the first time, a putative lysosomal acid lipase produced by a green microalga. Further investigation on the generated 3D models, such as docking studies and MD simulations, will provide important information on the substrate catalytic process and the binding characteristics and could be of interest to understand molecular mechanisms of the loss-of-function mutants leading to WD and CESD in humans.

Supplementary Materials

The following are available online at https://www.mdpi.com/1660-3397/19/2/70/s1, Table S1 Templates used for 3D model generation.

Author Contributions

Conceptualization, H.B.H. and A.K.; methodology, H.B.H. and M.D. (Mouna Dammak); software, H.B.H.; validation, S.A., I.F. and P.M.; formal analysis, H.B.H., A.K., M.D. (Maroua Drira) and M.D. (Mouna Dammak); investigation, H.B.H., M.D. (Mouna Dammak), A.K. and M.D. (Maroua Drira); resources, S.A.; data curation, M.D. (Maroua Drira) and M.D. (Mouna Dammak); writing—original draft preparation, H.B.H.; writing—review and editing, H.B.H., S.A., M.D. (Mouna Dammak) and A.K.; visualization, S.A., P.M. and I.F.; supervision, S.A.; project administration, H.B.H. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Not applicable.

Acknowledgments

The authors are grateful to the Tunisian Ministry of Higher Education and Scientific Research for financial assistance.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Market, M.N. Enzymes Market. 2020. Available online: https://www.marketsandmarkets.com.Market-Reports/enzymes-market-46202020.html (accessed on 22 June 2020).
  2. Prakash, D.; Nawani, N.; Prakash, M.; Bodas, M.; Mandal, A.; Khetmalas, M.; Kapadnis, B. Actinomycetes: A Repertory of Green Catalysts with a Potential Revenue Resource. BioMed Res. Int. 2013, 2013, 1–8. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Hasan, F.; Shah, A.A.; Hameed, A. Industrial applications of microbial lipases. Enzym. Microb. Technol. 2006, 39, 235–251. [Google Scholar] [CrossRef] [Scilit]
  4. Andualema, B.; Gessesse, A. Microbial Lipases and Their Industrial Applications: Review. Biotechnology 2012, 11, 100–118. [Google Scholar] [CrossRef] [Scilit]
  5. Fendri, I.; Chaari, A.; Dhouib, A.; Jlassi, B.; Abousalham, A.; Carriere, F.; Sayadi, S.; Abdelkafi, S. Isolation, identification and characterization of a new lipolytic Pseudomonas sp., strain AHD-1, from Tunisian soil. Environ. Technol. 2010, 31, 87–95. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Barouh, N.; Abdelkafi, S.; Fouquet, B.; Pina, M.; Scheirlinckx, F.; Carrière, F.; Villeneuve, P. Neutral Lipid Characterization of Non-Water-Soluble Fractions of Carica Papaya Latex. J. Am. Oil Chem. Soc. 2010, 87, 987–995. [Google Scholar] [CrossRef] [Scilit]
  7. Khannous, L.; Mouna, J.; Dammak, M.; Miladi, R.; Chaaben, N.; Khemakhem, B.; Gharsallah, N.; Fendri, I. Isolation of a novel amylase and lipase-producing Pseudomonas luteola strain: Study of amylase production conditions. Lipids Health Dis. 2014, 13, 9. [Google Scholar] [CrossRef] [Scilit]
  8. Navvabi, A.; Razzaghi, M.; Fernandes, P.; Karami, L.; Homaei, A. Novel lipases discovery specifically from marine organisms for industrial production and practical applications. Process. Biochem. 2018, 70, 61–70. [Google Scholar] [CrossRef] [Scilit]
  9. Demir, B.S.; Tükel, S.S. Purification and characterization of lipase from Spirulina platensis. J. Mol. Catal. B Enzym. 2010, 64, 123–128. [Google Scholar] [CrossRef] [Scilit]
  10. Godet, S.; Hérault, J.; Pencreac’H, G.; Ergan, F.; Loiseau, C. Isolation and analysis of a gene from the marine microalga Isochrysis galbana that encodes a lipase-like protein. Environ. Boil. Fishes 2012, 24, 1547–1553. [Google Scholar] [CrossRef] [Scilit]
  11. Ben Hlima, H.; Dammak, M.; Karkouch, N.; Hentati, F.; Laroche, C.; Michaud, P.; Fendri, I.; Abdelkafi, S. Optimal cultivation towards enhanced biomass and floridean starch production by Porphyridium marinum. Int. J. Biol. Macromol. 2019, 129, 152–161. [Google Scholar] [CrossRef] [Scilit]
  12. Talebi, A.F.; Tohidfar, M.; Tabatabaei, M.; Bagheri, A.; Mohsenpor, M.; Mohtashami, S.K. Genetic manipulation, a feasible tool to enhance unique characteristic of Chlorella vulgaris as a feedstock for biodiesel production. Mol. Biol. Rep. 2013, 40, 4421–4428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Guarnieri, M.T.; Levering, J.; Henard, C.A.; Boore, J.L.; Betenbaugh, M.J.; Zengler, K.; Knoshaug, E.P. Genome Sequence of the Oleaginous Green Alga, Chlorella vulgaris UTEX 395. Front. Bioeng. Biotechnol. 2018, 6, 37. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Cecchin, M.; Marcolungo, L.; Rossato, M.; Girolomoni, L.; Cosentino, E.; Cuine, S.; Li-Beisson, Y.; Delledonne, M.; Ballottari, M. Chlorella vulgaris genome assembly and annotation reveals the molecular basis for metabolic acclimation to high light conditions. Plant J. 2019, 100, 1289–1305. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Lodish, H.; Berk, A.; Kaiser, C.; Krieger, M.; Bretscher, A.; Ploegh, H.; Amon, A.; Scott, M. Genes, genomics, and chromosomes. In Molecular Cell Biology, 7th ed.; W.H. Freeman Company: New York, NY, USA, 2013; pp. 227–230. [Google Scholar]
  16. Schatz, G.; Dobberstein, B. Common Principles of Protein Translocation across Membranes. Science 1996, 271, 1519–1526. [Google Scholar] [CrossRef] [Scilit]
  17. Bruce, B.D. Chloroplast transit peptides: Structure, function and evolution. Trends Cell Biol. 2000, 10, 440–447. [Google Scholar] [CrossRef] [Scilit]
  18. Ursu, A.-V.; Marcati, A.; Sayd, T.; Sante-Lhoutellier, V.; Djelveh, G.; Michaud, P. Extraction, fractionation and functional properties of proteins from the microalgae Chlorella vulgaris. Bioresour. Technol. 2014, 157, 134–139. [Google Scholar] [CrossRef] [Scilit]
  19. Lenfant, N.; Hotelier, T.; Velluet, E.; Bourne, Y.; Marchot, P.; Chatonnet, A. ESTHER, the database of the α/β-hydrolase fold superfamily of proteins: Tools to explore diversity of functions. Nucleic Acids Res. 2012, 41, D423–D429. [Google Scholar] [CrossRef] [Scilit]
  20. Janssen, B.J.; Snowden, K.C. Strigolactone and karrikin signal perception: Receptors, enzymes, or both? Front. Plant Sci. 2012, 3, 296. [Google Scholar] [CrossRef] [Scilit]
  21. Savvidou, M.G.; Katsabea, A.; Kotidis, P.; Mamma, D.; Lymperopoulou, T.V.; Kekos, D.; Kolisis, F.N. Studies on the catalytic behavior of a membrane-bound lipolytic enzyme from the microalgae Nannochloropsis oceanica CCMP1779. Enzym. Microb. Technol. 2018, 116, 64–71. [Google Scholar] [CrossRef] [Scilit]
  22. Khan, F.I.; Lan, D.; Durrani, R.; Huan, W.; Zhao, Z.; Wang, Y. The Lid Domain in Lipases: Structural and Functional Determinant of Enzymatic Properties. Front. Bioeng. Biotechnol. 2017, 5, 16. [Google Scholar] [CrossRef] [Scilit]
  23. Ramnath, L.; Sithole, B.; Govinden, R. Classification of lipolytic enzymes and their biotechnological applications in the pulping industry. Can. J. Microbiol. 2017, 63, 179–192. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Bauer, T.L.; Buchholz, P.C.; Pleiss, J. The modular structure of α/β-hydrolases. FEBS J. 2020, 287, 1035–1053. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Nomaguchi, T.; Maeda, Y.; Liang, Y.; Yoshino, T.; Asahi, T.; Tanaka, T. Comprehensive analysis of triacylglycerol lipases in the oleaginous diatom Fistulifera solaris JPCC DA0580 with transcriptomics under lipid degradation. J. Biosci. Bioeng. 2018, 126, 258–265. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Zimmermann, R.; Strauss, J.G.; Haemmerle, G.; Schoiswohl, G.; Birner-Gruenberger, R.; Riederer, M.; Lass, A.; Neuberger, G.; Eisenhaber, F.; Hermetter, A.; et al. Fat Mobilization in Adipose Tissue Is Promoted by Adipose Triglyceride Lipase. Science 2004, 306, 1383–1386. [Google Scholar] [CrossRef] [Scilit]
  27. Leyland, B.; Boussiba, S.; Khozin-Goldberg, I. A Review of Diatom Lipid Droplets. Biology 2020, 9, 38. [Google Scholar] [CrossRef] [Scilit]
  28. Gupta, R.; Kumari, A.; Syal, P.; Singh, Y. Molecular and functional diversity of yeast and fungal lipases: Their role in biotechnology and cellular physiology. Prog. Lipid Res. 2015, 57, 40–54. [Google Scholar] [CrossRef] [Scilit]
  29. Pleiss, J.; Fischer, M.; Peiker, M.; Thiele, C.; Schmid, R.D. Lipase engineering database: Understanding and exploiting sequence-structure-function relationships. J. Mol. Cat. B Enzym. 2000, 10, 491–508. [Google Scholar] [CrossRef] [Scilit]
  30. Abdelkafi, S.; Ogata, H.; Barouh, N.; Fouquet, B.; Lebrun, R.; Pina, M.; Scheirlinckx, F.; Villeneuve, P.; Carrière, F. Identification and biochemical characterization of a GDSL-motif carboxylester hydrolase from Carica papaya latex. Biochim. Biophys. Acta-(BBA) Mol. Cell Biol. Lipids 2009, 1791, 1048–1056. [Google Scholar] [CrossRef] [Scilit]
  31. Martínez-Corona, R.; Marrufo, G.V.; Penagos, C.C.; Madrigal-Perez, L.A.; González-Hernández, J.C. Bioinformatic characterization of the extracellular lipases from Kluyveromyces marxianus. Yeast 2020, 37, 149–162. [Google Scholar] [CrossRef] [Scilit]
  32. Hitch, T.C.A.; Clavel, T. A proposed update for the classification and description of bacterial lipolytic enzymes. PeerJ 2019, 7, e7249. [Google Scholar] [CrossRef] [Scilit]
  33. Barriuso, J.; Vaquero, M.E.; Prieto, A.; Martínez, M.J. Structural traits and catalytic versatility of the lipases from the Candida rugosa-like family: A review. Biotechnol. Adv. 2016, 34, 874–885. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Pleiss, J.; Fischer, M.; Schmid, R.D. Anatomy of lipase binding sites: The scissile fatty acid binding site. Chem. Phys. Lipids 1998, 93, 67–80. [Google Scholar] [CrossRef] [Scilit]
  35. Settembre, C.; Ballabio, A. Lysosome: Regulator of lipid degradation pathways. Trends Cell Biol. 2014, 24, 743–750. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Lübke, T.; Lobel, P.; Sleat, D.E. Proteomics of the lysosome. Biochim. Biophys. Acta (BBA)-Mol. Cell Res. 2009, 1793, 625–635. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Rismani-Yazdi, H.; Haznedaroglu, B.Z.; Hsin, C.; Peccia, J. Transcriptomic analysis of the oleaginous microalga Neochloris oleoabundans reveals metabolic insights into triacylglyceride accumulation. Biotechnol. Biofuels 2012, 5, 74. [Google Scholar] [CrossRef] [Scilit]
  38. Anderson, R.A.; Bryson, G.M.; Parks, J.S. Lysosomal acid lipase mutations that determine phenotype in Wolman and choles-terol ester storage disease. Mol. Gene. Metab. 1999, 68, 345–346. [Google Scholar]
  39. Ries, S.; Aslanidis, C.; Fehringer, P.; Carel, J.C.; Gendrel, D.; Schmitz, G. A new mutation in the gene for lysosomal acid li-pase leads to Wolman disease in an African kindred. J. Lipid Res. 1996, 37, 1761–1765. [Google Scholar] [CrossRef] [Scilit]
  40. Frampton, J.E. Sebelipase Alfa: A Review in Lysosomal Acid Lipase Deficiency. Am. J. Cardiovasc. Drugs 2016, 16, 461–468. [Google Scholar] [CrossRef] [Scilit]
  41. Gomaraschi, M.; Bonacina, F.; Norata, G.D. Lysosomal Acid Lipase: From Cellular Lipid Handler to Immunometabolic Target. Trends Pharmacol. Sci. 2019, 40, 104–115. [Google Scholar] [CrossRef] [Scilit]
  42. Rombel, I.T.; Sykes, K.F.; Rayner, S.; Johnston, S.A. ORF-FINDER: A vector for high-throughput gene identification. Gene 2002, 282, 33–41. [Google Scholar] [CrossRef] [Scilit]
  43. Hoff, K.J.; Stanke, M. WebAUGUSTUS—A web service for training AUGUSTUS and predicting genes in eukaryotes. Nucleic Acids Res. 2013, 41, W123–W128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Gouet, P.; Robert, X.; Courcelle, E. ESPript/ENDscript: Extracting and rendering sequence and 3D information from atomic structures of proteins. Nucleic Acids Res. 2003, 31, 3320–3323. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Finn, R.D.; Attwood, T.K.; Babbitt, P.C.; Bateman, A.; Bork, P.; Bridge, A.J.; Chang, H.-Y.; Dosztányi, Z.; El-Gebali, S.; Fraser, M.; et al. InterPro in 2017—Beyond protein family and domain annotations. Nucleic Acids Res. 2017, 45, D190–D199. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Savojardo, C.; Bruciaferri, N.; Tartari, G.; Martelli, P.L.; Casadio, R. DeepMito: Accurate prediction of protein sub-mitochondrial localization using convolutional neural networks. Bioinformatics 2020, 36, 56–64. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Claros, M.G.; Vincens, P. Computational Method to Predict Mitochondrially Imported Proteins and their Targeting Sequences. JBIC J. Biol. Inorg. Chem. 1996, 241, 779–786. [Google Scholar] [CrossRef] [Scilit]
  48. Gschloessl, B.; Guermeur, Y.; Cock, J.M. HECTAR: A method to predict subcellular targeting in heterokonts. BMC Bioinform. 2008, 9, 393. [Google Scholar] [CrossRef] [Scilit]
  49. Krogh, A.; Larsson, B.; Von Heijne, G.; Sonnhammer, E.L.L. Predicting transmembrane protein topology with a hidden Markov model: Application to complete genomes. J. Mol. Biol. 2001, 305, 567–580. [Google Scholar] [CrossRef] [Scilit]
  50. Petersen, T.N.; Brunak, S.; Von Heijne, G.; Nielsen, H. SignalP 4.0: Discriminating signal peptides from transmembrane regions. Nat. Methods 2011, 8, 785–786. [Google Scholar] [CrossRef] [Scilit]
  51. Wang, S.; Mao, Y.; Narimatsu, Y.; Ye, Z.; Tian, W.; Goth, C.K.; Lira-Navarrete, E.; Pedersen, N.B.; Benito-Vicente, A.; Martin, C.; et al. Site-specific O-glycosylation of members of the low-density lipoprotein receptor superfamily enhances ligand interactions. EMBO J. 2013, 32, 1478–1488. [Google Scholar] [CrossRef] [Scilit]
  52. Eisenberg, D.; Lüthy, R.; Bowie, J.U. VERIFY3D: Assessment of protein models with three-dimensional profiles. Methods Enzymol. 1997, 277, 396–404. [Google Scholar]
  53. Wiederstein, M.; Sippl, M.J. ProSA-web: Interactive web servicefor the recognition of errors in three-dimensional structures ofproteins. Nucleic Acids Res. 2007, 35, 407–410. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Kuriata, A.; Gierut, A.M.; Oleniecki, T.; Ciemny, M.P.; Kolinski, A.; Kurcinski, M.; Kmiecik, S. CABS-flex 2.0: A web server for fast simulations of flexibility of protein structures. Nucleic Acids Res. 2018, 46, W338–W343. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Tan, K.P.; Nguyen, T.B.; Patel, S.; Varadarajan, R.; Madhusudhan, M.S. Depth: A web server to compute depth, cavity sizes, detect potential small-molecule ligand-binding cavities and predict the pKa of ionizable residues in proteins. Nucleic Acids Res. 2013, 41, W314–W321. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. 3D models of seven putative lipases without transmembrane domains. Four of them (Lip_1704, Lip_1795, Lip_4364, Lip_6297) display only the core module with a Rossman Fold architecture. Lip_3448 presents a C2 N-terminal domain, while Lip_5800 and Lip_5999 present a C-terminal alpha helices module. Lids are shown in dark blue and active site serine in yellow sticks.
Figure 1. 3D models of seven putative lipases without transmembrane domains. Four of them (Lip_1704, Lip_1795, Lip_4364, Lip_6297) display only the core module with a Rossman Fold architecture. Lip_3448 presents a C2 N-terminal domain, while Lip_5800 and Lip_5999 present a C-terminal alpha helices module. Lids are shown in dark blue and active site serine in yellow sticks.
Marinedrugs 19 00070 g001
Figure 2. (a) Three predicted membrane-associated lipases with a transmembrane module shown in lilac; lids are shown in dark blue and active site serine in yellow sticks. (b) Gene annotation and domain boundaries of Lip_4551 (left panel), Qmeanbrane result for transmembrane localization for Lip_4551 (right panel).
Figure 2. (a) Three predicted membrane-associated lipases with a transmembrane module shown in lilac; lids are shown in dark blue and active site serine in yellow sticks. (b) Gene annotation and domain boundaries of Lip_4551 (left panel), Qmeanbrane result for transmembrane localization for Lip_4551 (right panel).
Marinedrugs 19 00070 g002
Figure 3. Multiple sequence alignment of putative lipases showing the conserved lipase 3 motif GXSXG and the conserved G residue for GX classification highlighted with orange star.
Figure 3. Multiple sequence alignment of putative lipases showing the conserved lipase 3 motif GXSXG and the conserved G residue for GX classification highlighted with orange star.
Marinedrugs 19 00070 g003
Figure 4. (a) Slabbed close up view of the active site cavity for Lip_1704 showing a crevice-like shape (b) A surface top view with DEPTH showing the shape of substrate entrance in the same protein.
Figure 4. (a) Slabbed close up view of the active site cavity for Lip_1704 showing a crevice-like shape (b) A surface top view with DEPTH showing the shape of substrate entrance in the same protein.
Marinedrugs 19 00070 g004
Figure 5. (a) 3D model of putative Lysosomal acid lipase Lip_5462 lid is shown in dark blue and catalytic serine in yellow sticks. (b) Crystal structure of human Lysosomal acid lipase PDB ID: 6V7N. Lid is shown in orange and catalytic serine in yellow sticks. (c) The overlay of the two aforementioned structures showing high structure similarities and lid differences. (d) A close up view of the three helices lid of Lip_5462 showing conserved cysteine residues in red sticks.
Figure 5. (a) 3D model of putative Lysosomal acid lipase Lip_5462 lid is shown in dark blue and catalytic serine in yellow sticks. (b) Crystal structure of human Lysosomal acid lipase PDB ID: 6V7N. Lid is shown in orange and catalytic serine in yellow sticks. (c) The overlay of the two aforementioned structures showing high structure similarities and lid differences. (d) A close up view of the three helices lid of Lip_5462 showing conserved cysteine residues in red sticks.
Marinedrugs 19 00070 g005
Table 1. Putative TAG lipases in C. vulgaris with their sequence-based motif and family search.
Table 1. Putative TAG lipases in C. vulgaris with their sequence-based motif and family search.
TSA IDFamily
InterPro
Family
Pfam
Acyl Hydrolase Motif (GXSXG)Highest Identity in ESTHER DatabaseAccession Number ESTHER Database
GHLX01005462.1IPR029058, AB_hydrolasePF04083, Abhydro_lipaseGHSQG62.2% Lipase (M. conductrix)A0A2P6V8F3
GHLX01003448.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG46.6% Phospholipase A(1) chloroplastic (M. conductrix)A0A2P6VDJ3
GHLX01004364.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG79.9% Lipase_3 domain-containing protein (C. variabilis)E1ZB31
GHLX01003076.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG41.5% Lipase_3 domain-containing protein (C. variabilis)E1ZMR0
GHLX01002999.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG56.8% Lipase_3 domain-containing protein (C. variabilis)E1Z559
GHLX01001704.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG56.1%Lipase_3 domain-containing protein (C. variabilis)E1ZAU0
GHLX01004551.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG53.5% Lipase_3 domain-containing protein (C. variabilis)E1Z6D5
GHLX01003928.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG54.5% Lipase_3 domain-containing protein (C. variabilis)E1ZMR0
GHLX01006297.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG61.7% Lipase_3 domain-containing protein (C. variabilis)E1Z6D6
GHLX01001795.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GFSLG60.8% Lipase_3 domain-containing protein (C.a variabilis)E1Z814
GHLX01004575.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG55.3% Lipase_3 domain-containing protein (C. variabilis)E1Z559
GHLX01004232.1IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG52.4% Alpha beta-hydrolase (C. sorokiniana)A0A2P6TJS1
GHLX01005999IPR029058, AB_hydrolase
IPR002921, Fungal_lipase-like
PF01764, Lipase_3GHSLG62.2% sn1-specific diacylglycerol lipase alpha (Auxenochlorella protothecoides)A0A087SMB1
GHLX01005800IPR029058, AB_hydrolaseIPR002921, Fungal_lipase-likePF01764, Lipase_3GHSLG44.5% sn1-specific diacylglycerol lipase alpha (M. conductrix)A0A2P6V840
Table 2. Genes annotation of the putative TAG predicted lipases.
Table 2. Genes annotation of the putative TAG predicted lipases.
Transcriptome Shotgun Assembly IDGenome Survey Sequences IDStartEndGene LengthStrand5′ UTR3′ UTRStartCodonStopCodonExon Number
GHLX01005462.1VATW01000002.11,249,7091,253,3603651+1,249,7091,253,1811,249,8771,253,1788
GHLX01003448.1VATW01000019.1480,480486,4715991+480,893485,948480,896485,94715
GHLX01004364.1VATW01000012.1444,856447,9813125447,981444,884447,869444,8859
GHLX01003076.1VATW01000017.1300,534306,5996065306,599300,680306,266300,68116
GHLX01002999.1VATW01000004.1234,154243,3899235243,389235,621243,213235,62223
GHLX01001704.1VATW01000077.153,96657,5373571+54,32457,53754,48557,50312
GHLX01004551.1VATW01000014.1391,368400,3699001+391,465400,369391,466399,48818
GHLX01003928.1VATW01000021.1364,412371,7837371+364,615371,704364,616371,70117
GHLX01006297.1VATW01000014.1387,248391,3564108+387,638391,356387,830391,20010
GHLX01001795.1VATW01000003.11,009,2321,012,9633731+1,009,4371,012,9631,009,5591,012,7859
GHLX01004575.1VATW01000004.1243,414249,1695755248,807243,564248,803243,56519
GHLX01004232.1VATW01000004.1387,912396,8338921+388,099393,753388,100393,62216
GHLX01005999.1VATW01000002.1467,247474,4117164474,331467,332474,153467,33316
GHLX01005800.1VATW01000021.156,13659,6013465+56,23359,49256,23459,4898
Table 3. ProtParam parameters of the predicted lipases.
Table 3. ProtParam parameters of the predicted lipases.
Protein NameLength (Amino Acids)Molecular Mass (Da)Theoretical IpTotal Number of Negatively Charged Residues (Asp + Glu)Total Number of Positively Charged Residues
(Arg + Lys)
Molar
Extinction
(M−1 cm−1)
Half-LifeGrand Average of Hydropathicity
Index (GRAVY)
Lip_546246950,526.706.94353458,830
58,330
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.056
Lip_344881087,834.984.5012555113,955
113,330
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.223
Lip_436443347,169.736.083528105,475
104,850
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.083
Lip_3076966104,984.878.788091164,875
163,750
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.086
Lip_29991104121,199.698.6798110193,210
191,710
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.125
Lip_170442144,824.888.57293547,050
46,300
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.057
Lip_45511145124,302.957.43103103157,425
156,300
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.057
Lip_3928934100,739.178.928093132,905
131,780
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.013
Lip_629753056,818.326.12514769,940
69,440
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.101
Lip_179555759,817.514.09672397,330
96,830
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.110
Lip_457572681,163.189.266728162,885
162,260
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.117
Lip_423277985,389.089.346283107,675
106,800
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).0.082
Lip_59991003102,522.285.311128685,425
84,800
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.143
Lip_580062967,075.994.98986658,160
57,410
30 h (mammalian reticulocytes, in vitro), >20 h (yeast, in vivo), >10 h (Escherichia coli, in vivo).−0.307
Table 4. Predicted repeats, motifs and localization of putative lipases.
Table 4. Predicted repeats, motifs and localization of putative lipases.
Protein NamePredicted LocalizationSignal Peptide SequenceMembrane HelixN Glycosylation Sites
Lip_5462Ps (extracellular space)MNVGRVAALFACLLQGACLALAVQ-325
Lip_3448Mito--170
Lip_4364Ps (extracellular space)MRPAITEALLAVLVCLVVGANGA-134/180/273/280
Lip_3076Chloro (membrane)-42–64/84–106/129–151/161–183/266–288/314–336/348–3708/676
Lip_2999Chloro (membrane)-120–142/162–184/203–225/245–267/293–315/341–363/400–422187/349/383/1030
Lip_1704ChloroMKLGLPLLLAALLLAAAAPATAR-230/260/305/369
Lip_4551Chloro (membrane)-139–161/176–198/222–244/254–276/313–330/362–384/411–433/453–475/482–504279/946
Lip_3928plasma membrane-62–84/174–196/220–242/254–276-
Lip_6297Ps (extracellular space)MFIRVQSRVVSAVFTAIIFSLLFMSLVPTLQGN 392
Lip_1795cyto--19/53/307
Lip_4575plasma membraneMYIANTSVGGVLTLASFAMLAHGL6–28/48–70/80–102/115–137/170–189/196–2185
Lip_4232plasma membrane-31–53/66–88/108–130/145–167/202–224/251–273/300–322475
Lip_5999chloro---
Lip_5800chloro--487
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Ben Hlima, H.; Dammak, M.; Karray, A.; Drira, M.; Michaud, P.; Fendri, I.; Abdelkafi, S. Molecular and Structural Characterizations of Lipases from Chlorella by Functional Genomics. Mar. Drugs 2021, 19, 70. https://doi.org/10.3390/md19020070

AMA Style

Ben Hlima H, Dammak M, Karray A, Drira M, Michaud P, Fendri I, Abdelkafi S. Molecular and Structural Characterizations of Lipases from Chlorella by Functional Genomics. Marine Drugs. 2021; 19(2):70. https://doi.org/10.3390/md19020070

Chicago/Turabian Style

Ben Hlima, Hajer, Mouna Dammak, Aida Karray, Maroua Drira, Philippe Michaud, Imen Fendri, and Slim Abdelkafi. 2021. "Molecular and Structural Characterizations of Lipases from Chlorella by Functional Genomics" Marine Drugs 19, no. 2: 70. https://doi.org/10.3390/md19020070

APA Style

Ben Hlima, H., Dammak, M., Karray, A., Drira, M., Michaud, P., Fendri, I., & Abdelkafi, S. (2021). Molecular and Structural Characterizations of Lipases from Chlorella by Functional Genomics. Marine Drugs, 19(2), 70. https://doi.org/10.3390/md19020070

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop