Prediction of Putative Epitope Peptides against BaeR Associated with TCS Adaptation in Acinetobacter baumannii Using an In Silico Approach
Abstract
:1. Introduction
2. Materials and Methods
2.1. Selection of BaeR Protein for A. baumannii
2.2. Mapping of B-Cell Epitopes
2.3. Antigenicity Predictions
2.4. Physico-Chemical Property Analysis of the Predicted Proteins
2.5. Allergenicity and Toxigenicity Predictions
2.6. Signal Location of the Epitope Peptides
2.7. Continuous Antibody Epitope Prediction
2.8. T-Cell MHC Class I and MHC Class II Epitope Predictions
2.9. Class I Immunogenicity Predictions and Conservancy Analysis
2.10. Cluster Analysis of the MHC-Restricted Alleles
2.11. Protein–TLR2 Receptor Interactions
3. Results
3.1. BaeR B-Cell Epitope Prediction
3.2. Vaccine Properties
3.2.1. Antigenic Potentials
3.2.2. Allergenic and Toxigenic Properties
3.3. Physico-Chemical Analysis of the Peptides
3.4. Signal Peptide Analysis
3.5. Selection of the Immune-Dominant T-Cell Epitopes
3.6. MHC Restrictions and Cluster Analysis
3.7. Protein–Peptide Interactions
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Rice, L.B. Federal funding for the study of antimicrobial resistance in nosocomial pathogens: No ESKAPE. J. Infect. Dis. 2008, 197, 1079–1081. [Google Scholar] [CrossRef]
- Richards, A.; Abu Kwaik, Y.; Lamont, R. Code blue: A cinetobacter baumannii, a nosocomial pathogen with a role in the oral cavity. Mol. Oral Microbiol. 2015, 30, 2–15. [Google Scholar] [CrossRef] [PubMed]
- Magnan, C.N.; Zeller, M.; Kayala, M.A.; Vigil, A.; Randall, A.; Felgner, P.L.; Baldi, P. High-throughput prediction of protein antigenicity using protein microarray data. Bioinformatics 2010, 26, 2936–2943. [Google Scholar] [CrossRef] [PubMed]
- Smiline, A.; Vijayashree, J.; Paramasivam, A. Molecular characterization of plasmid-encoded blaTEM, blaSHV and blaCTX-M among extended spectrum β-lactamases [ESBLs] producing Acinetobacter baumannii. Br. J. Biomed. Sci. 2018, 75, 200–202. [Google Scholar] [CrossRef] [PubMed]
- Smiline, G.; Vijayashree, P.; Arumugam, P. Plasmid encoded tet-A and tet-B mediated tetracycline, doxycycline and minocycline resistance among Acinetobacter baumannii isolated from urine samples. Rom. Arch. Microbiol. Immunol. 2017, 76, 134–140. [Google Scholar]
- Gasteiger, E.; Hoogland, C.; Gattiker, A.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein Identification and Analysis Tools on the ExPASy Server. In The Proteomics Protocols Handbook; Humana: Totowa, NJ, USA, 2005; pp. 571–607. [Google Scholar]
- Girija, A.S.; Priyadharsini, J.V.; Paramasivam, A. Plasmid-encoded resistance to trimethoprim/sulfamethoxazole mediated by dfrA1, dfrA5, sul1 and sul2 among Acinetobacter baumannii isolated from urine samples of patients with severe urinary tract infection. J. Glob. Antimicrob. Resist. 2019, 17, 145–146. [Google Scholar] [CrossRef]
- Doytchinova, I.A.; Flower, D.R. Identifying candidate subunit vaccines using an alignment-independent method based on principal amino acid properties. Vaccine 2007, 25, 856–866. [Google Scholar] [CrossRef]
- Rajamohan, G.; Srinivasan, V.B.; Gebreyes, W.A. Molecular and functional characterization of a novel efflux pump, AmvA, mediating antimicrobial and disinfectant resistance in Acinetobacter baumannii. J. Antimicrob. Chemother. 2010, 65, 1919–1925. [Google Scholar] [CrossRef]
- De Silva, P.M.; Kumar, A. Signal transduction proteins in Acinetobacter baumannii: Role in antibiotic resistance, virulence, and potential as drug targets. Front. Microbiol. 2019, 10, 49. [Google Scholar] [CrossRef]
- Henry, R.; Vithanage, N.; Harrison, P.; Seemann, T.; Coutts, S.; Moffatt, J.H.; Nation, R.L.; Li, J.; Harper, M.; Adler, B. Colistin-resistant, lipopolysaccharide-deficient Acinetobacter baumannii responds to lipopolysaccharide loss through increased expression of genes involved in the synthesis and transport of lipoproteins, phospholipids, and poly-β-1, 6-N-acetylglucosamine. Antimicrob. Agents Chemother. 2012, 56, 59–69. [Google Scholar] [CrossRef]
- Ahmed, N.; Zeshan, B.; Naveed, M.; Afzal, M.; Mohamed, M. Antibiotic resistance profile in relation to virulence genes fimH, hlyA and usp of uropathogenic E. coli isolates in Lahore, Pakistan. Trop. Biomed. 2019, 36, 559–568. [Google Scholar] [PubMed]
- Zahra, N.; Zeshan, B.; Qadri, M.M.A.; Ishaq, M.; Afzal, M.; Ahmed, N. Phenotypic and genotypic evaluation of antibiotic resistance of Acinetobacter baumannii bacteria isolated from surgical intensive care unit patients in Pakistan. Jundishapur J. Microbiol. 2021, 14, e113008. [Google Scholar] [CrossRef]
- Hussain, S.; Zeshan, B.; Arshad, R.; Kabir, S.; Ahmed, N. MRSA Clinical Isolates Harboring mecC Gene Imply Zoonotic Transmission to Humans and Colonization by Biofilm Formation. Pak. J. Zool. 2022, 55, 999–1002. [Google Scholar] [CrossRef]
- Ahmed, N.; Khalid, H.; Mushtaq, M.; Basha, S.; Rabaan, A.A.; Garout, M.; Halwani, M.A.; Al Mutair, A.; Alhumaid, S.; Al Alawi, Z. The Molecular Characterization of Virulence Determinants and Antibiotic Resistance Patterns in Human Bacterial Uropathogens. Antibiotics 2022, 11, 516. [Google Scholar] [CrossRef] [PubMed]
- Rabaan, A.A.; Alhumaid, S.; Mutair, A.A.; Garout, M.; Abulhamayel, Y.; Halwani, M.A.; Alestad, J.H.; Bshabshe, A.A.; Sulaiman, T.; AlFonaisan, M.K. Application of Artificial Intelligence in Combating High Antimicrobial Resistance Rates. Antibiotics 2022, 11, 784. [Google Scholar] [CrossRef]
- Leblanc, S.K.; Oates, C.W.; Raivio, T.L. Characterization of the induction and cellular role of the BaeSR two-component envelope stress response of Escherichia coli. J. Bacteriol. 2011, 193, 3367–3375. [Google Scholar] [CrossRef]
- Lin, M.-F.; Lin, Y.-Y.; Lan, C.-Y. The role of the two-component system BaeSR in disposing chemicals through regulating transporter systems in Acinetobacter baumannii. PLoS ONE 2015, 10, e0132843. [Google Scholar] [CrossRef]
- Naveed, M.; Bukhari, B.; Afzal, N.; Sadia, H.; Meer, B.; Riaz, T.; Ali, U.; Ahmed, N. Geographical, Molecular, and Computational Analysis of Migraine-Causing Genes. J. Comput. Biophys. Chem. 2021, 20, 391–403. [Google Scholar] [CrossRef]
- Naveed, M.; Jabeen, K.; Naz, R.; Mughal, M.S.; Rabaan, A.A.; Bakhrebah, M.A.; Alhoshani, F.M.; Aljeldah, M.; Shammari, B.R.A.; Alissa, M. Regulation of Host Immune Response against Enterobacter cloacae Proteins via Computational mRNA Vaccine Design through Transcriptional Modification. Microorganisms 2022, 10, 1621. [Google Scholar] [CrossRef]
- Naveed, M.; Ali, U.; Karobari, M.I.; Ahmed, N.; Mohamed, R.N.; Abullais, S.S.; Kader, M.A.; Marya, A.; Messina, P.; Scardina, G.A. A Vaccine Construction against COVID-19-Associated Mucormycosis Contrived with Immunoinformatics-Based Scavenging of Potential Mucoralean Epitopes. Vaccines 2022, 10, 664. [Google Scholar] [CrossRef]
- Saha, S.; Raghava, G.P.S. AlgPred: Prediction of allergenic proteins and mapping of IgE epitopes. Nucleic Acids Res. 2006, 34, W202–W209. [Google Scholar] [CrossRef] [PubMed]
- Naveed, M.; Yaseen, A.R.; Khalid, H.; Ali, U.; Rabaan, A.A.; Garout, M.; Halwani, M.A.; Al Mutair, A.; Alhumaid, S.; Al Alawi, Z. Execution and Design of an Anti HPIV-1 Vaccine with Multiple Epitopes Triggering Innate and Adaptive Immune Responses: An Immunoinformatic Approach. Vaccines 2022, 10, 869. [Google Scholar] [CrossRef] [PubMed]
- Doytchinova, I.A.; Flower, D.R. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007, 8, 4. [Google Scholar] [CrossRef] [PubMed]



| Protein ID | Strain | Start | End | Predicted Peptides | Length |
|---|---|---|---|---|---|
| V5VA19_ACIBA | - | 5 | 13 | MLVEDEVEL | 9 |
| 26 | 100 | FEVSMFHDGQDAYTSFQQRKPNLMILDLMVPRMDGLTICRKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | 75 | ||
| 125 | 133 | PEQNDSFRI | 9 | ||
| 137 | 152 | QQRIWYQQKSLSLTPT | 16 | ||
| 163 | 184 | HVGQVYSRAQLLDHINPDSFDV | 22 | ||
| 201 | 214 | TEVAETGNRHEWIQ | 14 | ||
| B0V538_ACIBY | AYE | 5 | 13 | MLVEDEVEL | 9 |
| 26 | 63 | FEVSMFHDGQDAYTNFQQRKPNLMILDLMVPRMDGLTI | 38 | ||
| 65 | 100 | RKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | 36 | ||
| 125 | 133 | PEQNDSFRI | 9 | ||
| 137 | 152 | QQRIWYQQKSLSLTPT | 16 | ||
| 163 | 184 | HVGQVYSRAQLLDHINPDSFDV | 22 | ||
| 201 | 214 | TEVAETGNRHEWIQ | 14 | ||
| 224 | 224 | E | 1 | ||
| B0VRE0_ACIBS | SDF | 5 | 16 | MLVEDEVELAHL | 12 |
| 18 | 20 | CDY | 3 | ||
| 23 | 23 | A | 1 | ||
| 26 | 100 | FEVSMFHDGQDAYTSFQQRKPNLMILDLMVPRMDGLTICRKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | 75 | ||
| 125 | 133 | PEQNDSFRI | 9 | ||
| 137 | 152 | QQRIWYQQKSLSLTPT | 16 | ||
| 162 | 184 | EHVGQVYSRAQLLDHINPDSFDV | 23 | ||
| 201 | 214 | TEVAETGNRHEWIQ | 14 | ||
| 223 | 224 | FE | 2 | ||
| A0A090B602_ACIBA | - | 5 | 13 | MLVEDEVEL | 9 |
| 26 | 63 | FEVSMFHDGQDAYTNFQQRKPNLMILDLMVPRMDGLTI | 38 | ||
| 65 | 100 | RKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | 36 | ||
| 125 | 133 | PEQNDSFRI | 9 | ||
| 137 | 152 | QQRIWYQQKSLSLTPT | 16 | ||
| 163 | 184 | HVGQVYSRAQLLDHINPDSFDV | 22 | ||
| 201 | 214 | TEVAETGNRHEWIQ | 14 | ||
| 224 | 224 | E | 1 | ||
| A0A0E1PMP7_ACIBA | NCGM 237 | 5 | 13 | MLVEDEVEL | 9 |
| 26 | 100 | FEVSMFHDGQDAYTSFQQRKPNLMILDLMVPRMDGLTICRKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | 75 | ||
| 125 | 133 | PEQNDSFRI | 9 | ||
| 137 | 152 | QQRIWYQQKSLSLTPT | 16 | ||
| 163 | 184 | HVGQVYSRAQLLDHINPDSFDV | 22 | ||
| 201 | 214 | TEVAETGNRHEWIQ | 14 | ||
| 223 | 224 | FE | 2 |
| Peptide | Epitope | Peptide Sequence | VaxiJen | Antigen PRO | SolPro | ||
|---|---|---|---|---|---|---|---|
| Threshold Value (≥0.4) | Threshold Value (≥0.5) | ||||||
| 1 | E1 | RKVREQSDLPIIMVTAR TEEIDRVLGLNMGADDYVC | 0.4706 | Antigen | 0.260702 | 0.897659 | Soluble |
| 2 | E2 | HVGQVYSRAQLLDHINPDSFDV | 0.2225 | Non-Antigen | 0.706722 | 0.931871 | Soluble |
| Peptide | Predicted Antigens | IgE | MAST | SVM-Aa | SVM-dp | BLAST–ARP | Hybrid |
|---|---|---|---|---|---|---|---|
| E1 | RKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | NA | NA | NA | NA | NA | NA |
| E2 | HVGQVYSRAQLLDHINPDSFDV | NA | NA | A | NA | NA | NA |
| Peptide | Predicted Antigens | MW | IP | SI | SL | AI | GRAVY |
|---|---|---|---|---|---|---|---|
| E1 | RKVREQSDLPIIMVTARTEEI DRVLGLNMGADDYVC | 4107.73 | 4.66 | 40.86 (unstable) | 1 h | 102.78 | −0.214 |
| E2 | HVGQVYSRAQLLDHINPDSFDV | 2510.75 | 5.13 | 37.19 (stable) | 3.5 h | 97.27 | −0.341 |
| SignalP 4.0 predictions for the BaeR transmembrane peptides | |||||||
| Peptide | Predicted antigens | Score | Signal TM | ||||
| E1 | RKVREQSDLPIIMVTARTEEI DRVLGLNMGADDYVC | 0.165 | No | ||||
| E2 | HVGQVYSRAQLLDHINPDSFDV | 0.092 | No | ||||
| Predicted Epitopes | T-cell Epitopes Predicted | Peptide Length | Score | Degree of Conservancy |
|---|---|---|---|---|
| E1: RKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVC | TEEIDRVLGL | 10 | 0.28772 | 100% |
| MVTARTEEI | 9 | 0.28191 | 100% | |
| EEIDRVLGL | 9 | 0.16522 | 100% | |
| LPIIMVTAR | 9 | 0.1006 | 100% | |
| REQSDLPII | 9 | −0.12451 | 100% | |
| E2: HVGQVYSRAQLLDHINPDSFDV | LLDHINPDSF | 10 | 0.07467 | 100% |
| LLDHINPDSF | 10 | 0.07467 | 100% | |
| VYSRAQLLDH | 10 | −0.08316 | 100% | |
| VYSRAQLLD | 9 | −0.0884 | 100% | |
| GQVYSRAQL | 9 | −0.13736 | 100% |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Girija, A.S.S.; Gunasekaran, S.; Habib, S.; Aljeldah, M.; Al Shammari, B.R.; Alshehri, A.A.; Alwashmi, A.S.S.; Turkistani, S.A.; Alawfi, A.; Alshengeti, A.; et al. Prediction of Putative Epitope Peptides against BaeR Associated with TCS Adaptation in Acinetobacter baumannii Using an In Silico Approach. Medicina 2023, 59, 343. https://doi.org/10.3390/medicina59020343
Girija ASS, Gunasekaran S, Habib S, Aljeldah M, Al Shammari BR, Alshehri AA, Alwashmi ASS, Turkistani SA, Alawfi A, Alshengeti A, et al. Prediction of Putative Epitope Peptides against BaeR Associated with TCS Adaptation in Acinetobacter baumannii Using an In Silico Approach. Medicina. 2023; 59(2):343. https://doi.org/10.3390/medicina59020343
Chicago/Turabian StyleGirija, A. S. Smiline, Shoba Gunasekaran, Saman Habib, Mohammed Aljeldah, Basim R. Al Shammari, Ahmad A. Alshehri, Ameen S. S. Alwashmi, Safaa A. Turkistani, Abdulsalam Alawfi, Amer Alshengeti, and et al. 2023. "Prediction of Putative Epitope Peptides against BaeR Associated with TCS Adaptation in Acinetobacter baumannii Using an In Silico Approach" Medicina 59, no. 2: 343. https://doi.org/10.3390/medicina59020343
APA StyleGirija, A. S. S., Gunasekaran, S., Habib, S., Aljeldah, M., Al Shammari, B. R., Alshehri, A. A., Alwashmi, A. S. S., Turkistani, S. A., Alawfi, A., Alshengeti, A., Garout, M., Alwarthan, S., Alsubki, R. A., Moustafa, N. M., & Rabaan, A. A. (2023). Prediction of Putative Epitope Peptides against BaeR Associated with TCS Adaptation in Acinetobacter baumannii Using an In Silico Approach. Medicina, 59(2), 343. https://doi.org/10.3390/medicina59020343

