Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens
Abstract
:1. Introduction
2. Results
2.1. Production of the Enterocins
2.2. Antimicrobial Activity of the Enterocins against C. perfringens Isolates
2.3. Whole Genome Sequencing Analysis
2.4. Antimicrobial Activity of the Enterocins against Other Relevant Pathogens
2.5. Synergistic Effects of Different Enterocin Combinations
3. Discussion
4. Materials and Methods
4.1. Strain Collection, Maintenance, and Propagation
4.2. Genome Analysis of C. perfringens Isolates
4.3. Production of Enterocins
4.4. Antimicrobial Activity Assay
4.5. Checkerboard/FIC Assay
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
Correction Statement
References
- Gochez, D.; Moulin, G.; Erlacher-Vindel, E. OIE Annual Report on Antimicrobial Agents Intended for Use in Animals. Better Understanding of the Global Situation; Fifth Report; IOE: Rome, Italy, 2021. [Google Scholar]
- McEwen, S.A.; Collignon, P.J. Antimicrobial Resistance: A One Health Perspective. Microbiol. Spectr. 2018, 6, 521–547. [Google Scholar] [CrossRef]
- García-Vela, S.; Martínez-Sancho, A.; Ben Said, L.; Torres, C.; Fliss, I. Pathogenicity and Antibiotic Resistance Diversity in Clostridium perfringens Isolates from Poultry Affected by Necrotic Enteritis in Canada. Pathogens 2023, 12, 905. [Google Scholar] [CrossRef]
- Mora, Z.V.; Macías-Rodríguez, M.E.; Arratia-Quijada, J.; Gonzalez-Torres, Y.S.; Nuño, K.; Villarruel-López, A. Clostridium perfringens as Foodborne Pathogen in Broiler Production: Pathophysiology and Potential Strategies for Controlling Necrotic Enteritis. Animals 2020, 10, 1718. [Google Scholar] [CrossRef]
- Alizadeh, M.; Shojadoost, B.; Boodhoo, N.; Astill, J.; Taha-Abdelaziz, K.; Hodgins, D.C.; Kulkarni, R.R.; Sharif, S. Necrotic enteritis in chickens: A review of pathogenesis, immune responses and prevention, focusing on probiotics and vaccination. Anim. Health Res. Rev. 2021, 22, 147–162. [Google Scholar] [CrossRef]
- Rahman, R.T.; Fliss, I.; Biron, E. Insights in the Development and Uses of Alternatives to Antibiotic Growth Promoters in Poultry and Swine Production. Antibiotics 2022, 11, 766. [Google Scholar] [CrossRef]
- Gilmore, M.S.; Clewell, D.B.; Ike, Y.; Shankar, N. Enterococci: From Commensals to Leading Causes of Drug Resistant Infection [Internet]; Massachusetts Eye and Ear Infirmary: Boston, MA, USA, 2014. [Google Scholar]
- Silva, C.C.G.; Silva, S.P.M.; Ribeiro, S.C. Application of Bacteriocins and Protective Cultures in Dairy Food Preservation. Front. Microbiol. 2018, 9, 594. [Google Scholar] [CrossRef]
- Hanchi, H.; Mottawea, W.; Sebei, K.; Hammami, R. The Genus Enterococcus: Between Probiotic Potential and Safety Concerns—An Update. Front. Microbiol. 2018, 9, 1791. [Google Scholar] [CrossRef] [PubMed]
- Ben Braïek, O.; Smaoui, S. Enterococci: Between Emerging Pathogens and Potential Probiotics. BioMed Res. Int. 2019, 2019, 5938210. [Google Scholar] [CrossRef]
- Franz, C.M.A.P.; Van Belkum, M.J.; Holzapfel, W.H.; Abriouel, H.; Gálvez, A. Diversity of enterococcal bacteriocins and their grouping in a new classification scheme. FEMS Microbiol. Rev. 2007, 31, 293–310. [Google Scholar] [CrossRef] [PubMed]
- Simons, A.; Alhanout, K.; Duval, R.E. Bacteriocins, Antimicrobial Peptides from Bacterial Origin: Overview of Their Biology and Their Impact against Multidrug-Resistant Bacteria. Microorganisms 2020, 8, 639. [Google Scholar] [CrossRef] [PubMed]
- O’Connor, P.M.; Kuniyoshi, T.M.; Oliveira, R.P.; Hill, C.; Ross, R.P.; Cotter, P.D. Antimicrobials for food and feed; a bacteriocin perspective. Curr. Opin. Biotechnol. 2020, 61, 160–167. [Google Scholar] [CrossRef] [PubMed]
- Bédard, F.; Hammami, R.; Zirah, S.; Rebuffat, S.; Fliss, I.; Biron, E. Synthesis, antimicrobial activity and conformational analysis of the class IIa bacteriocin pediocin PA-1 and analogs thereof. Sci. Rep. 2018, 8, 9029. [Google Scholar] [CrossRef] [PubMed]
- Bédard, F.; Fliss, I.; Biron, E. Structure–Activity Relationships of the Bacteriocin Bactofencin A and Its Interaction with the Bacterial Membrane. ACS Infect. Dis. 2019, 5, 199–207. [Google Scholar] [CrossRef] [PubMed]
- Bédard, F.; Biron, E. Recent Progress in the Chemical Synthesis of Class II and S-Glycosylated Bacteriocins. Front. Microbiol. 2018, 9, 1048. [Google Scholar] [CrossRef] [PubMed]
- Acedo, J.Z.; Chiorean, S.; Vederas, J.C.; van Belkum, M.J. The expanding structural variety among bacteriocins from Gram-positive bacteria. FEMS Microbiol. Rev. 2018, 42, 805–828. [Google Scholar] [CrossRef] [PubMed]
- Kumariya, R.; Garsa, A.K.; Rajput, Y.; Sood, S.; Akhtar, N.; Patel, S. Bacteriocins: Classification, synthesis, mechanism of action and resistance development in food spoilage causing bacteria. Microb. Pathog. 2019, 128, 171–177. [Google Scholar] [CrossRef] [PubMed]
- Tymoszewska, A.; Szylińska, M.; Aleksandrzak-Piekarczyk, T. The LiaFSR-LiaX System Mediates Resistance of Enterococcus faecium to Peptide Antibiotics and to Aureocin A53- and Enterocin L50-Like Bacteriocins. Microbiol. Spectr. 2023, 11, e0034323. [Google Scholar] [CrossRef]
- Perez, R.H.; Zendo, T.; Sonomoto, K. Circular and Leaderless Bacteriocins: Biosynthesis, Mode of Action, Applications, and Prospects. Front. Microbiol. 2018, 9, 2085. [Google Scholar] [CrossRef]
- Zhu, L.; Zeng, J.; Wang, C.; Wang, J. Structural Basis of Pore Formation in the Mannose Phosphotransferase System by Pediocin PA-1. Appl. Environ. Microbiol. 2022, 88, e0199221. [Google Scholar] [CrossRef]
- Wu, Y.; Pang, X.; Wu, Y.; Liu, X.; Zhang, X. Enterocins: Classification, Synthesis, Antibacterial Mechanisms and Food Applications. Molecules 2022, 27, 2258. [Google Scholar] [CrossRef]
- Colombo, N.S.R.; Chalón, M.C.; Navarro, S.A.; Bellomio, A. Pediocin-like bacteriocins: New perspectives on mechanism of action and immunity. Curr. Genet. 2018, 64, 345–351. [Google Scholar] [CrossRef]
- Jeckelmann, J.-M.; Erni, B. The mannose phosphotransferase system (Man-PTS)—Mannose transporter and receptor for bacteriocins and bacteriophages. Biochim. Biophys. Acta (BBA)—Biomembr. 2020, 1862, 183412. [Google Scholar] [CrossRef]
- Aymerich, T.; Holo, H.; Håvarstein, L.S.; Hugas, M.; Garriga, M.; Nes, I.F. Biochemical and genetic characterization of enterocin A from Enterococcus faecium, a new antilisterial bacteriocin in the pediocin family of bacteriocins. Appl. Environ. Microbiol. 1996, 62, 1676–1682. [Google Scholar] [CrossRef]
- Casaus, P.; Nilsen, T.; Cintas, L.M.; Nes, I.F.; Hernández, P.E.; Holo, H. Enterocin B, a new bacteriocin from Enterococcus faecium T136 which can act synergistically with enterocin A. Microbiology 1997, 143 Pt 7, 2287–2294. [Google Scholar] [CrossRef]
- Ankaiah, D.; Palanichamy, E.; Antonyraj, C.B.; Ayyanna, R.; Perumal, V.; Ahamed, S.I.B.; Arul, V. Cloning, overexpression, purification of bacteriocin enterocin-B and structural analysis, interaction determination of enterocin-A, B against pathogenic bacteria and human cancer cells. Int. J. Biol. Macromol. 2018, 116, 502–512. [Google Scholar] [CrossRef]
- Cintas, L.M.; Casaus, P.; Håvarstein, L.S.; Hernández, P.E.; Nes, I.F. Biochemical and genetic characterization of enterocin P, a novel sec-dependent bacteriocin from Enterococcus faecium P13 with a broad antimicrobial spectrum. Appl. Environ. Microbiol. 1997, 63, 4321–4330. [Google Scholar] [CrossRef]
- Eguchi, T.; Kaminaka, K.; Shima, J.; Kawamoto, S.; Mori, K.; Choi, S.-H.; Doi, K.; Ohmomo, S.; Ogata, S. Isolation and characterization of enterocin SE-K4 produced by thermophilic enterococci, Enterococcus faecalis K-4. Biosci. Biotechnol. Biochem. 2001, 65, 247–253. [Google Scholar] [CrossRef]
- Cintas, L.M.; Casaus, P.; Holo, H.; Hernandez, P.E.; Nes, I.F.; Håvarstein, L.S. Enterocins L50A and L50B, two novel bacteriocins from Enterococcus faecium L50, are related to staphylococcal hemolysins. J. Bacteriol. 1998, 180, 1988–1994. [Google Scholar] [CrossRef] [PubMed]
- Ness, I.F.; Diep, D.B.; Ike, Y. Enterococcal Bacteriocins and Antimicrobial Proteins that Contribute to Niche Control. In Enterococci: From Commensals to Leading Causes of Drug Resistant Infection [Internet]; Gilmore, M.S., Clewell, D.B., Ike, Y., Shankar, N., Eds.; Massachusetts Eye and Ear Infirmary: Boston, MA, USA, 2014. [Google Scholar]
- Hanchi, H.; Hammami, R.; Fernandez, B.; Kourda, R.; Ben Hamida, J.; Fliss, I. Simultaneous Production of Formylated and Nonformylated Enterocins L50A and L50B as well as 61A, a New Glycosylated Durancin, by Enterococcus durans 61A, a Strain Isolated from Artisanal Fermented Milk in Tunisia. J. Agric. Food Chem. 2016, 64, 3584–3590. [Google Scholar] [CrossRef]
- Arbulu, S.; Jiménez, J.J.; Gútiez, L.; Feito, J.; Cintas, L.M.; Herranz, C.; Hernández, P.E. Cloning and expression of synthetic genes encoding native, hybrid- and bacteriocin-derived chimeras from mature class IIa bacteriocins, by Pichia pastoris (syn. Komagataella spp.). Food Res. Int. 2019, 121, 888–899. [Google Scholar] [CrossRef]
- Gutiérrez, J.; Criado, R.; Martín, M.; Herranz, C.; Cintas, L.M.; Hernández, P.E. Production of enterocin P, an antilisterial pediocin-like bacteriocin from Enterococcus faecium P13, in Pichia pastoris. Antimicrob. Agents Chemother. 2005, 49, 3004–3008. [Google Scholar] [CrossRef]
- Sánchez, J.; Borrero, J.; Gómez-Sala, B.; Basanta, A.; Herranz, C.; Cintas, L.M.; Hernández, P.E. Cloning and Heterologous production of hiracin JM79, a Sec-dependent bacteriocin produced by Enterococcus hirae DCH5, in lactic acid bacteria and Pichia pastoris. Appl. Environ. Microbiol. 2008, 74, 2471–2479. [Google Scholar] [CrossRef]
- Islam, M.R.; Nagao, J.-I.; Zendo, T.; Sonomoto, K. Antimicrobial mechanism of lantibiotics. Biochem. Soc. Trans. 2012, 40, 1528–1533. [Google Scholar] [CrossRef]
- Bierbaum, G.; Sahl, H.-G. Lantibiotics: Mode of Action, Biosynthesis and Bioengineering. Curr. Pharm. Biotechnol. 2009, 10, 2–18. [Google Scholar] [CrossRef]
- Kaur, G.; Malik, R.K.; Mishra, S.K.; Singh, T.P.; Bhardwaj, A.; Singroha, G.; Vij, S.; Kumar, N. Nisin and class IIa bacteriocin resistance among Listeria and other foodborne pathogens and spoilage bacteria. Microb. Drug Resist. 2011, 17, 197–205. [Google Scholar] [CrossRef] [PubMed]
- Balandin, S.V.; Sheremeteva, E.V.; Ovchinnikova, T.V. Pediocin-Like Antimicrobial Peptides of Bacteria. Biochemistry 2019, 84, 464–478. [Google Scholar] [CrossRef] [PubMed]
- Jung, A.; Chen, L.R.; Suyemoto, M.M.; Barnes, H.J.; Borst, L.B. A Review of Enterococcus cecorum Infection in Poultry. Avian Dis. 2018, 62, 261–271. [Google Scholar] [CrossRef]
- El-Hack, M.E.A.; El-Saadony, M.T.; Elbestawy, A.R.; El-Shall, N.A.; Saad, A.M.; Salem, H.M.; El-Tahan, A.M.; Khafaga, A.F.; Taha, A.E.; AbuQamar, S.F.; et al. Necrotic enteritis in broiler chickens: Disease characteristics and prevention using organic antibiotic alternatives – a comprehensive review. Poult. Sci. 2022, 101, 101590. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.; Zhou, Y.; Chen, Y.; Gu, J. fastp: An ultra-fast all-in-one FASTQ preprocessor. Bioinformatics 2018, 34, i884–i890. [Google Scholar] [CrossRef]
- Bankevich, A.; Nurk, S.; Antipov, D.; Gurevich, A.A.; Dvorkin, M.; Kulikov, A.S.; Lesin, V.M.; Nikolenko, S.I.; Pham, S.; Prjibelski, A.D.; et al. SPAdes: A new genome assembly algorithm and its applications to single-cell sequencing. J. Comput. Biol. 2012, 19, 455–477. [Google Scholar] [CrossRef] [PubMed]
- Gurevich, A.; Saveliev, V.; Vyahhi, N.; Tesler, G. QUAST: Quality assessment tool for genome assemblies. Bioinformatics 2013, 29, 1072–1075. [Google Scholar] [CrossRef] [PubMed]
- Seemann, T. Prokka: Rapid Prokaryotic Genome Annotation. Bioinformatics 2014, 30, 2068–2069. [Google Scholar] [CrossRef] [PubMed]
- Hyatt, D.; Chen, G.-L.; Locascio, P.F.; Land, M.L.; Larimer, F.W.; Hauser, L.J. Prodigal: Prokaryotic gene recognition and translation initiation site identification. BMC Bioinform. 2010, 11, 119. [Google Scholar] [CrossRef] [PubMed]
- Waterhouse, A.M.; Procter, J.B.; Martin, D.M.A.; Clamp, M.; Barton, G.J. Jalview Version 2—A multiple sequence alignment editor and analysis workbench. Bioinformatics 2009, 25, 1189–1191. [Google Scholar] [CrossRef]
- García-Vela, S.; Ben Said, L.; Soltani, S.; Guerbaa, R.; Fernández-Fernández, R.; Ben Yahia, H.; Ben Slama, K.; Torres, C.; Fliss, I. Targeting Enterococci with Antimicrobial Activity against Clostridium perfringens from Poultry. Antibiotics 2023, 12, 231. [Google Scholar] [CrossRef]
- Eliopoulos, G.; Moellering, R. Antimicrobial combinations. In Antibiotics in Laboratory Medicine; Lorian, V., Ed.; The Williams & Wilkins Co.: Baltimore, MD, USA, 1996; pp. 330–396. [Google Scholar]
C. perfringens Isolate | L50A | L50B | EntA | EntB | EntP | EntSEK4 | Nisin |
---|---|---|---|---|---|---|---|
MLG0418 | 6.25 | 12.5 | 25 | 50 | 50 | - b | 1.56 |
MLG0618 | 6.25 | 12.5 | >100 | 100 | >100 | >100 | 0.39 |
MLG0712 | 1.56 | 25 | >100 | 100 | >100 | - | 0.39 |
MLG1108 | 3.12 | 25 | >100 | 25 | >100 | - | 0.78 |
MLG1619 | 12.5 | 50 | >100 | 100 | >100 | - | 0.19 |
MLG1819 | 6.25 | 12.5 | >100 | 25 | 50 | - | 0.39 |
MLG2203 | 12.5 | 25 | >100 | 50 | >100 | - | <0.09 |
MLG2314 | 3.12 | 12.5 | >100 | 50 | 100 | - | 1.56 |
MLG2919 | 6.25 | 12.5 | >100 | >100 | >100 | - | 1.56 |
MLG3111 | 3.12 | 12.5 | 25 | 50 | 50 | - | 0.39 |
MLG3406 | 6.25 | 12.5 | >100 | 50 | >100 | - | 3.12 |
MLG4201 | 6.25 | 25 | 50 | 100 | 100 | - | 0.78 |
MLG4206 | 6.25 | 12.5 | 50 | 50 | >100 | >100 | 1.56 |
MLG5719 | 6.25 | 25 | >100 | >100 | >100 | >100 | 1.56 |
MLG5806 | 6.25 | 25 | >100 | 100 | >100 | >100 | 1.56 |
MLG6907 | 12.5 | 50 | >100 | >100 | >100 | - | 1.56 |
MLG7009 | 6.25 | 25 | >100 | 50 | >100 | - | 1.56 |
MLG7307 | 1.56 | 6.25 | 3.12 | 6.25 | 1.56 | - | 0.78 |
MLG7309 | 6.25 | 50 | >100 | 100 | 100 | - | 0.78 |
MLG7814 | 12.5 | 50 | >100 | >100 | >100 | >100 | 3.12 |
Pathogens | L50A | L50B | EntA | EntB | EntP | EntSEK4 |
---|---|---|---|---|---|---|
Listeria monocytogenes ATCC 1911 | <0.19 | <0.19 | <0.19 | 3.12 | <0.19 | 1.56 |
Enterococcus faecalis ATCC 29212 | 3.12 | 6.25 | 1.56 | 1.56 | - b | - |
Enterococcus cecorum CECO 0009 | 1.56 | 1.56 | - | - | - | - |
Streptococcus suis C2058 | 1.56 | 1.56 | 50 | 1.56 | - | - |
Streptococcus pyogenes ATCC 19615 | 0.78 | 0.78 | - | <0.19 | - | - |
Micrococcus luteus ATCC10240 | 1.56 | 3.12 | - | - | - | - |
Staphylococcus aureus ATCC 6538 | 6.25 | 6.25 | - | - | - | - |
Staphylococcus aureus C411 c | 12.5 | 25 | - | - | - | - |
Pseudomonas aeruginosa ATCC 27855 | 12.5 | 25 | - | - | - | - |
Campylobacter coli ATCC 33559 | 25 | 50 | - | - | - | - |
Combination | FICINDEX | Effect | |
---|---|---|---|
Compound A | Compound B | ||
L50A | L50B | 0.56 | Partial synergy |
EntA | L50A | 0.37 | Synergy |
EntA | L50B | 0.5 | Synergy |
EntA | EntB | 0.56 | Partial synergy |
EntB | L50A | 0.56 | Partial synergy |
EntB | L50B | 0.62 | Partial synergy |
EntP | L50A | 0.05 | Synergy |
EntP | L50B | 0.15 | Synergy |
Enterocin | Class | Length | Amino Acid Sequence |
---|---|---|---|
L50A | IId | 44 AA | MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIIEWIKKHI |
L50B | IId | 43 AA | MGAIAKLVTKEGWPLIKKFYKQIMQFIGQGWTIFQIEKWLKRH |
EntA | IIa | 47 AA | TTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC |
EntB | II | 53 AA | ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN |
EntP | IIa | 44 AA | ATRSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGMGH |
SEK4 | IIa | 43 AA | ATYYGNGVYCNKOKCWVDWSRARSEIIDRGVKAYVNGFTKVLG |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
García-Vela, S.; Guay, L.-D.; Rahman, M.R.T.; Biron, E.; Torres, C.; Fliss, I. Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens. Int. J. Mol. Sci. 2024, 25, 1597. https://doi.org/10.3390/ijms25031597
García-Vela S, Guay L-D, Rahman MRT, Biron E, Torres C, Fliss I. Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens. International Journal of Molecular Sciences. 2024; 25(3):1597. https://doi.org/10.3390/ijms25031597
Chicago/Turabian StyleGarcía-Vela, Sara, Louis-David Guay, Md Ramim Tanver Rahman, Eric Biron, Carmen Torres, and Ismail Fliss. 2024. "Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens" International Journal of Molecular Sciences 25, no. 3: 1597. https://doi.org/10.3390/ijms25031597
APA StyleGarcía-Vela, S., Guay, L.-D., Rahman, M. R. T., Biron, E., Torres, C., & Fliss, I. (2024). Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens. International Journal of Molecular Sciences, 25(3), 1597. https://doi.org/10.3390/ijms25031597