Next Article in Journal
The Anaphase-Promoting Complex/Cyclosome Is a Cellular Ageing Regulator
Previous Article in Journal
The Soluble Guanylate Cyclase Stimulator BAY 41-2272 Attenuates Transforming Growth Factor β1-Induced Myofibroblast Differentiation of Human Corneal Keratocytes
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Comprehensive Analysis of Betula platyphylla Suk. PIF Gene Family and Their Potential Functions in Growth and Development

1
College of Life Science, Northeast Forestry University, Harbin 150040, China
2
Key Laboratory of Non-Wood Forest Product Research and Development, Mudanjiang Branch of Heilongjiang Academy of Forestry, 16 Diming Street, Mudanjiang 157011, China
3
Key Laboratory of Saline-Alkali Vegetation Ecology Restoration, Ministry of Education, Northeast Forestry University, Harbin 150040, China
*
Authors to whom correspondence should be addressed.
Current Address: Ecology College, Lishui University, Lishui 323060, China.
Int. J. Mol. Sci. 2022, 23(23), 15326; https://doi.org/10.3390/ijms232315326
Submission received: 26 September 2022 / Revised: 26 October 2022 / Accepted: 21 November 2022 / Published: 5 December 2022
(This article belongs to the Section Molecular Genetics and Genomics)

Abstract

Phytochrome-interacting factors (PIFs) are transcription factors with the basic helix–loop–helix (bHLH) domain. As integration factors between different signal pathways, members of the PIF protein family regulate many aspects of plant growth and development, such as seed germination, photomorphogenesis, thermomorphogenesis, rhythm regulation, flowering response, stomatal development, and stress responses. Our previous studies have shown that the BpSPL2 gene may regulate plants’ adventitious root development through PIF genes. Within the Betula platyphylla genome, we identified eight PIF (BpPIFs) genes. We analysed and named them based on a phylogenetic tree, gene structures, and conserved motifs. Synteny analysis indicated that transposition or segmental duplication events played a minor role in the expansion of BpPIFs. The comparative syntenic analysis combined with phylogenetic analysis provided a deep insight into the phylogenetic relationships of BpPIF genes, suggesting that BpPIF proteins are closer to PtPIF than to AtPIF. The analysis of cis-acting elements in promoter regions of BpPIF genes indicated that various elements were related to light, abiotic stress, and plant hormone responsiveness. In addition, we found that these promoters have the transcription factor of B. platyphylla SPL2 (BpSPL2) binding motif GTAC. Expression analysis demonstrated that BpPIF genes, especially BpPIF4, BpPIF9b, and BpPIF10, might be the potential target genes of BpSPL2 in the process of adventitious root formation. Besides providing a comprehensive understanding of the BpPIF family, we propose a hypothetical gene network regulatory model for adventitious root formation.

1. Introduction

Transcription factors (TFs) play a crucial role in responses to environmental cues through self-regulation and the regulation of downstream target gene expression, forming a complex network of signal transduction pathways [1]. For example, light is an essential environmental signal in plant growth and development. Plants can perceive the intensity, length, and direction of the light through the photoreceptors in their structures, including cryptochrome (Cry) and phototropin (Phot) for sensing blue light, phytochrome (PhyA-E) for sensing red and far-red light, and UV for sensing ultraviolet-blue light-B receptor (UV-B receptor) [2,3]. Plant phytochromes can occur either in the biologically active far-red light absorbing form (Pfr) or in the non-biologically active red-absorbing form (Pr). These two photosensitive pigments can be converted into each other after absorbing red and far-red light, triggering plants’ morphogenesis [4].
Like phytochromes, their primary signalling partners (PHYTOCHROME-INTERACTING FACTORs-PIFs) have been discovered from bryophytes to angiosperms. PIFs, which belong to the 15th subfamily of the bHLH gene family, are one of the downstream elements co-regulated by photoreceptors that directly interact with phytochrome B (phyB) [5,6]. In addition, PIFs have been shown to mediate metabolic signals to the circadian clock, thermomorphogenesis, hormone signalling, biotic and abiotic responses.
In Arabidopsis thaliana, eight PIFs were found and named PIF1-PIF8. All these PIFs have an APB motif, while only PIF1 and PIF3 have both an APB and an APA motif. PIF1/PIF3-LIKE 5 (PIL5), PIF3, PIF4, PIF5/PIL6, PIF6/PIL2 and PIF7 combine with phyB through the N-terminal conserved domain to form a complex [7,8,9]. After binding to phyB, PIFs are rapidly phosphorylated and then degraded by the proteasome through ubiquitination. PIFs have been found to bind sequence-specifically to a DNA G-box core motif (CACGTG). Moreover, PIFs can form homodimers or heterodimers to enhance DNA binding, suggesting a direct signalling pathway to regulate the expression of their target genes by enhancing or inhibiting the DNA-binding activity [9].
PIFs function primarily as negative regulators of photomorphogenesis. In Arabidopsis, PIF1 is known to repress seed germination in darkness [10,11]. PhyA/PhyB is deactivated under far-red light, causing PIF1 to accumulate and thus induce SOMNUS (SOM) expression, which promotes the expression of the MOTHER OF FT AND TFL1 (MFT) gene, a germination inhibitor. Then, abscisic acid (ABA) and gibberellin (GA) accumulation reach a dynamic balance, leading to the repression of seed germination through a mechanism involving ABI5 and DELLA proteins [12,13,14,15,16]. CTG10 interacts with PIF1, forming a feedback loop of CTG10/PIF1, which can also participate in light-dependent seed germination [17].
PIF3-LIKE1 (PIL1), renamed PIF2 later, interacts with HFR1 and PIFs (PIF1, PIF3, PIF4, and PIF5) and coordinates with HFR1 to suppress the transcriptional activity of PIFs, thus promoting photomorphogenesis [18]. PIF3 was the first identified gene in the PIF family by a yeast two-hybrid screen for phyB-interacting proteins [19]. PIF3 participate in light-responsive transcriptional network genes in coordination with the plant hormones and the circadian clock, modulating plant growth and development [20,21]. PIF3 can also enhance the freezing tolerance of plants by a regulatory module CBFs-PIF3-phyB [22].
PIF4 acts as a hub integrating light and temperature cues, inducing endogenous hormonal signalling and driving skotomorphogenesis, photomorphogenesis and thermomorphogenesis [23]. Arabidopsis controls shade avoidance syndrome (SAS) to mediate the hypocotyl elongation by PIF4-SHY2 modules [24]. PIF4 participates in dark-triggered and brassinosteroid-induced leaf senescence [25]. ZTL induces the expression of YUC8 in upper aerial parts and promotes hypocotyl elongation via PIF4 [26]. PIF5 often cooperates with PIF4 to perform its functions, such as regulating axillary branching via stem auxin signalling and bud abscisic acid [27]. Anthocyanin accumulation is a striking symptom of plant environmental response and plays a key role in plant adaptation to adverse stimuli [28]. Elevated temperature activates PIF4 to stimulate auxin signalling, which causes hypocotyl elongation and leaf hyponasty [29]. COR27 up-regulates its expression in a circadian clock-dependent manner and controls hypocotyl elongation [30]. In Arabidopsis seedlings, PIF4 positively regulates the development of stomata and negatively regulates anthocyanin accumulation [31]. PIF4, PIF5, and PIF7 regulate shade avoidance, affecting the elongation of hypocotyls by controlling photoperiod [32,33].
PIF6 produces two splice variants, α and β, of which the β-form regulates seed dormancy. As it is ectopically overexpressed and under continuous red light, PIF6 inhibits hypocotyl elongation [34]. The function of PIF7 is similar to that of PIF4, acting in the shade response [35,36,37,38,39]. PIF7 and PIF3, together with PIF4, function additively to promote hypocotyl elongation under continuous red light by suppressing phyB levels [40]. Under shade conditions, PIF7 also regulates shade avoidance responses by directly controlling auxin biosynthetic genes [41]. Like PIF4 [42], PIF7 is also involved in the flowering of Arabidopsis thaliana [43]. In rose flowers, the PIF8-BBX28 module can regulate petal senescence by governing mitochondrial ROS homeostasis at night [44]. In addition, the Populus homolog PIF8 plays a major role as a suppressor of seasonal growth [45].
Recently, studies have revealed that bHLH transcription factors (PFA and PFB proteins) participate in the formation of lateral root primordia [46] and that the bHLH transcription factor PIF4 controls the flowering time by activating FT under increasing temperature [44].
The SPL gene family and the PIF gene family interact with each other to regulate the growth and development of plants. In Arabidopsis, we found that PIF4 interacts with SPL9 to inhibit shoot branching [47]. The transcription factors PIF/PIL interact with SPLs and play a conserved role in repressing tillering/branching in wheat, rice, and Arabidopsis [47]. However, the functional significance of the phytochrome–PIF relationship is not fully understood in birch, especially in the process of adventitious root development. Therefore, in this study, we identified eight BpPIF genes in B. platyphylla and analysed them comprehensively, including the gene structure and motif compositions, synteny analysis and gene duplications, phylogenetic relationship, conserved promoter motifs and candidate transcription factors which might directly bind the promoter of BpPIFs, which were further investigated. In addition, based on RNA-seq data, the BpPIF gene expression profiles in the adventitious root occurrence of B. platyphylla transgenic BpSPL2 lines and male flower development were determined. Furthermore, the expression levels of PIF gene family members during the development of adventitious roots were studied by RT-PCR. Finally, we obtained candidate target BpPIF genes of BpSPL2 during the adventitious root formation of B. platyphylla and developed a hypothetical network regulation model.

2. Results

2.1. Genome-Wide Identification and Analysis of PIF Genes in Betula platyphylla Suk

To identify PIF family genes in the B. platyphylla genome, we downloaded the Arabidopsis, Populus and Betula genome data from the Phytozome database [48]. We employed eight Arabidopsis thaliana PIF proteins (Table S1), ten putative Populus trichocarpa PIF proteins [49] (Table S2) and the consensus protein sequences of bHLH (PF00010: TEVHNRSERKRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYMKSLQL) as a query to search against the B. platyphylla genome databases using the BlastP program. After removing redundant proteins, 31 candidate proteins were obtained (Table S3). To confirm the presence of the bHLH domain in those putative B. platyphylla PIF proteins (BpPIFs), their amino acid sequences were searched using Pfam and Web CD-search Tool (Table S4). Based on the Betula database from Phytozome, we infer that the B. platyphylla PIF gene family contains seven members: BPChr06G16498, BPChr05G27408, BPChr11G17797, BPChr04G09407, BPChr12G25898, BPChr08G16198, and BPChr13G16040. Nevertheless, in our transcriptome sequencing data, we identified eight BpPIF family members (Table 1): Bpev01.c0015.g0022.mRNA1, Bpev01.c1527.g0004.mRNA2, Bpev01.c1708.g0006.mRNA1, Bpev01.c0349.g0043.mRNA1, Bpev01.c0555.g0004.mRNA1, Bpev01.c0918.g0013.mRNA1, Bpev01.c1013.g0001.mRNA1, and Bpev01.c0000.g0060.mRNA1. We then analysed these members’ molecular weights (MWs) and isoelectric points. The MWs of these BpPIF proteins ranged from 39.40 kDa (BpPIF9a) to 79.48 kDa (BpPIF3), and their PIs ranged from 5.01 (BpPIF9a) to 9.25 (BpPIF7).

2.2. Phylogenetic Analysis of the BpPIF Gene Family

In order to better understand the evolutionary relationship between Betula (B. platyphylla and B. pendula), Arabidopsis, and Poplar, the evolutionary tree was inferred using the neighbour-joining method using bootstrap analysis (1000 replicates) from alignments of the PIF complete protein sequences from BpPIFs, 8 AtPIFs and 10 PtPIFs (Figure 1, Table 1). Based on these evolutionary relationships, we renamed these genes as BpPIF1, BpPIF3, BpPIF4, BpPIF7, BpPIF8, BpPIF9a, BpPIF9b, and BpPIF10. Compared with the members of the three species PIF gene family, BpPIF1, BpPIF3, BpPIF4, BpPIF7, and BpPIF8, they are evolutionarily conserved and closely related. Interestingly, in poplar and birch, a common branch different from Arabidopsis appeared, which we named BpPIF9a, BpPIF9b, and BpPIF10. Thus, the BpPIF family of birch is more closely related to the PtPIF family of poplar.

2.3. Gene Structure and Conserved Motif Analysis of BpPIF Gene Family

To support the phylogenetic analysis, we performed a gene structure analysis of BpPIF family members from Betula platyphylla, Arabidopsis thaliana, and Populus trichocarpa. As shown in Figure 2C, the numbers of exons in BpPIF, AtPIF and PtPIF genes were conserved, ranging from five to eight exons. The number of exons of the birch PIF genes was precisely the same as the corresponding poplar PIF genes. We found that the gene structures of putative BpPIF members were highly conserved in all three species. The number of introns contained in their bHLH domains was also determined. There were two introns in the bHLH domain in all of the PIF7 and PIF8 homologous genes from B. platyphylla, A. thaliana, and P. trichocarpa, and three in the bHLH domain of the other genes except AtPIF4 (only one intron) and AtPIF5 (two introns). This result indicated that the PIFs’ gene structure is very conservative, while the birch PIF gene is highly consistent with the poplar PIF gene.
We used the Multiple Em for Motif Elicitation (MEME) motif search tool to investigate the motifs shared among related proteins within the same subfamily and identified ten distinct motifs (Figure 2B). Motif 1, the representative bHLH domain, and Motif 3 were identified in all three PIF proteins. Motif 2 and Motif 7 were also identified in all three PIF proteins except PtPIF9a/9b, BpPIF9a/9b. Motifs 1, 3, and 5 were identified in all BpPIF proteins. Motifs 7 and 8 were generally located in the N-terminus of PIF proteins, but motif 9 was in the C-terminus. Interestingly, only AtPIF2 did not contain Motif 5.
Some of the specific motifs were absent in most PIF proteins. For example, Motif 10 only existed in PtPIF10, AtPIF3, BpPIF3, PtPIF3a, and PtPIF3b. Therefore, these motifs’ functions concerning these proteins need further investigation. In summary, the results of gene structure and conserved motif analyses additionally support the results of phylogenetic analysis, illustrating that the evolution of each subfamily was well conserved in three different species.

2.4. Synteny Analysis of the PIF Genes in B. platyphylla., Arabidopsis and P. trichocarpa

Gene duplication is an important mechanism for acquiring new genes and creating genetic novelty in organisms. Many new gene functions have evolved through gene duplication, which has contributed tremendously to the evolution of developmental programmes in various organisms. Gene duplication can result from unequal crossing over, retroposition, or chromosomal (or genome) duplication [34]. According to the previous results, seven genes were located on the chromosome except for BpPIF1, which may be an artefact of the assembly technology. To verify the duplication of these seven BpPIF genes, we analysed the syntenic regions using MCscanX software. As shown in Table S5, a total of 2845 tandem duplication gene pairs and 215 segmental duplication blocks (Table S6) were identified in the Betula platyphylla genome, respectively. In addition, one segmental duplication event (BPChr12G25898 and BPChr06G16498) was also identified in the B. platyphylla PIF gene family (Figure 3A, Table S2). This shows that the Asian birch has experienced at least one whole-genome duplication event during evolution.
Our statistical analyses of all 33,966 genes of B. platyphylla allowed us to divide their origins into five types: dispersed duplication (DD), whole genome (WGD) or segmental duplication (SD), tandem duplication (TD), proximal duplication (PD), and singleton genes. As shown in Figure S1, 52% of the genes may have arisen from transposition (either replicative, non-replicative, or conservative), 16% from WGD or SD, 13% from TD, 10% were singleton, and 9% were from transposition (replicative, non-replicative or conservative).
To further expound on the genomic mechanisms underlying the BpPIF family, comparative syntenic maps of B. platyphylla associated with Arabidopsis and Populus were constructed (Figure 3B). Four (BpPIF7, BpPIF9a, BpPIF9b, and BpPIF10) and six (BpPIF3, BpPIF4, BpPIF8, BpPIF9a, BpPIF9b, and BpPIF10) BpPIF genes showed syntenic relationships with those in Arabidopsis and Populus, respectively. Unexpectedly, BpPIF10 has been associated with AtPIF2, a syntenic gene pair from Arabidopsis. BpPIF9b has collinearity with SPATULA (AT4G36930.1.) and ALC (AT5G67110.1) genes, which also belong to the bHLH gene family in Arabidopsis. BpPIF9a and BpPIF9b have collinearity with the ALC gene (AT5G67110.1).
BpPIF genes were associated with at least two syntenic gene pairs between B. platyphylla and P. trichocarpa, indicating that these genes may have played an essential role in the PIF gene family during the evolution of woody plants. However, these orthologous pairs may have already existed before the ancestral divergence. The exception is BpPIF7, a gene that is missing in Populus trichocarpa. It is speculated that this gene may either be redundant with other genes or have evolved a unique function.

2.5. Conserved Motif and Transcription Factor Binding Site Analysis in the Promoter of the BpPIFs

To analyse conserved sequences potentially involved in regulating BpPIF genes, we selected a 2.0 kb upstream region from the start codon of each BpPIF gene. The MEME suite identified three conserved motifs in the promoters of all BpPIFs (Figure 4). To know if these motifs were potential TF binding sites, we scanned the promoters of BpPIFs using the regulation prediction tool in PlantRegMap. Many TFs possess over-represented targets in the input gene set under cutoff p-value ≤ 0.05. Among these TFs, all BpPIF genes were candidate targets of BBR/BPC TF (BPChr01G22857 and BPChr03G04964). Interestingly, the positions of BBR/BPC binding sites were consistent with those of three conserved motifs identified by MEME. Furthermore, the three binding motifs were found in promoters of all seven BpPIF genes, indicating that BBR/BPC and GRAS TFs may directly bind the one or more conserved motifs in the promoters of BpPIFs to regulate their expression.
Cis-Element analysis in the PIF gene promoters and functional prediction of PIFs were performed in PlantCARE (Table S7). We counted the number of three types of cis-acting elements: light-responsive, stress-responsive, and hormone-responsive. The predicted cis-elements differed among different genes, but the cis-elements related to photoreaction were the most abundant (3-AF1 binding site, AE-box, AT1-motif, Box 4, G-Box, GATA-motif, GT1-motif, Sp1, TCT-motif, and as-1), which had the largest number in all species (Figure 5). Among them, BpPIF4 contains the majority of light- and hormone-responsive elements. In addition, we scanned the binding motif of the BpPIF promoters and found that there are more than two BpSPL2 binding motifs GTAC.

2.6. Expression Patterns of PIF Genes during Adventitious Root Induction of Transgenic BpSPL2 B. platyphylla and Flower of Naturally Mutated B. platyphylla Based on RNA-Seq

In previous research, we obtained the overexpressed (35S::BpSPL2) and suppressed BpSPL2 (35S::BpSPL2-SRDX) transgenic lines. Compared with wild-type (WT) plants, BpSPL2-suppressed plants showed root emergence earlier, and the number of ARs and total root length significantly increased (unpublished data). The transcriptomes of wild-type, 35S::BpSPL2-overexpressed, and 35S::BpSPL2-SRDX-inhibited expression were sequenced by high-throughput technology at 0, 24, and 96 h after rooting induction with three biological replicates.
In our RNA-seq, the transcript abundance of one gene (BpPIF7) was very low (FPKM < 2.0 in all three stages). The other six BpPIF genes (BpPIF10, BpPIF9b, BpPIF3, BpPIF4, BpPIF9a, and BpPIF8) showed high levels of transcript abundance (FPKM > 2.0) during rooting induction. (Figure 6A). It is worth noting that BpPIF3 and BpPIF4 showed the highest expression in all lines at the same time compared to other BpPIF genes (Figure 6A).
In addition, we obtained transcriptome data of birch fertile male flowers (NM1, NM2, and NM4) and sterile male flowers (MM1, MM2, and MM4) in different developmental stages. NLM1, NLM2, and NLM4 are semi-sterile inflorescences of different developmental stages on mutant trees. From Figure 6B, we found that in the mature microspore stage, the expression of three BpPIF genes (BpPIF4, BpPIF9a, and BpPIF10) was significantly down-regulated in the sterile inflorescence. On the other hand, in the spore mother cell and tetrad stage, the expression level did not change significantly. This result shows that these genes are indispensable in the normal development of male flowers.

2.7. The Expression Patterns of Key BpPIF Genes during Root Induction Based on qRT-PCR

To study whether BpPIFs correspond to the expression of BpSPL2 in B. platyphylla transgenic lines, we performed RT-qPCR on the BpPIFs in the three lines during the adventitious root induction of B. platyphylla. From Figure 7, we can see that these genes respond to the expression of BpSPL2 at different times. The most obvious were BpPIF3, BpPIF4, BpPIF7, and BpPIF8. The results showed that BpPIF3, BpPIF4, BpPIF7, and BpPIF8 had an opposite expression regulation pattern with BpSPL2 at a certain time of adventitious root occurrence. The phenotype of more adventitious roots in BpSPL2 inhibited transgenic lines, and less adventitious roots in overexpressed transgenic lines were consistent. This showed that BpSPL2 strongly inhibited the expression of these genes. The expression level of BpPIF7 increased in the BpSPL2-suppressed-expression lines and decreased in the BpSPL2-overexpression lines. It is speculated that BpPIF7 may be the target gene of BpSPL2.
In contrast, the expression of BpPIF9a and BpPIF9b was up-regulated by BpSPL2 at 24 h and 48 h after adventitious root induction. In summary, we can confirm that BpPIF3, BpPIF4, BpPIF7, BpPIF8, BpPIF9a, and BpPIF9b play an essential role in the formation of birch adventitious roots. However, it is speculated that BpSPL2 directly or indirectly regulates the expression of these genes; this requires further experimental verification.

3. Discussion

The PIF genes belong to a subfamily of the bHLH superfamily. There are 126 bHLH genes in Arabidopsis, divided into 26 different subfamilies. The PIF gene family belong to the fifteenth subfamily [49]. The evolutionary analysis suggests that there are only a few bHLH genes from land plants, chlorophytes, and red alga [5,50]. The expansion of modern plant gene families occurred by genome/segment and tandem duplications [51]. With the development of genomics, the PIF homologous gene family has been found in many plants. The present work found eight BpPIF genes in the B. platyphylla genome. Among these BpPIFs, BpPIF9b has collinearity with SPATULA and ALC genes (Figure 3B), while BpPIF9a and BpPIF9b have collinearity with ALC. Previous research described that all modern plant bHLH proteins have evolved from these predecessors through many gene duplications. Additionally, BpPIF9a, BpPIF9b, and BpPIF10 formed homologous gene pairs with PIF genes in Arabidopsis and Populus, indicating that they may have played a pivotal role in evolution.
SPATULA (SPT), a PIF homolog, is one of the first bHLH transcription factors identified to control plant morphogenesis. ALC is also one of the bHLH transcription factors. It is widely expressed and has considerable overlap with SPT in Arabidopsis [52], considered a multifunctional gene [53]. In addition to affecting the development of pistils and fruits, it also regulates the growth of vegetative organs [53]. SPT is also involved in root growth. As homologous genes, SPT and PIF share similar functions to a certain extent. It is speculated that PIF genes may also be involved in regulating plant root development. Therefore, later experimental verification is required to ascertain the exact roles of those genes. Notwithstanding, phylogenetic data indicate that they may share a common ancestor.
Studies have shown that the PIF genes are mainly involved in photomorphogenesis and thermomorphogenesis in plants. AR formation could be initiated by multiple pathways [54], but the function of PIFs in root development remains unclear. From the data of the B. platyphylla transcriptome with overexpressed or suppressed BpSPL2 (Figure 6), we could infer that the expression of BpPIF9a/b positively correlates with BpSPL2, while other BpPIFs were negatively correlated with its expression. Furthermore, in the promoter analysis, we found that the promoters of three genes (BpPIF4, BpPIF9b, and BpPIF10) have BpSPL2 binding motifs (GTACAA/GTACGG). Therefore, BpPIF4, BpPIF9b, and BpPIF10 may be the candidate target genes involved in the AR formation caused by cutting. Although there have been many achievements in regulating the formation of adventitious roots by protein interaction modules [55,56], the role BpPIFs play in forming birch adventitious roots needs further study.
Due to the evolutionary similarity between birch and poplar, using the regulation prediction tool in PlantRegMap, we speculate that BBR/BPC TF (BPChr01G22857 and BPChr03G04964) may bind to the BpPIF promoters. However, whether these two transcription factors can directly interact with BpPIFs still needs to be verified.
In the sterile male flowers of B. platyphylla, the expression of BpPIF4, BpPIF9a, and BpPIF10 in the mature pollen stage of male flower development was down-regulated. Therefore, these genes may be involved in male flower development. However, in Arabidopsis, PIF4 is involved in regulating the flowering time, so the specific role these three genes play in birch male sterility is an open question.
In Arabidopsis, the PIF gene family is essential in shading response, stress resistance, and flower development, but the BpPIFs’ function and relationship should be further studied.

4. Materials and Methods

4.1. Identification of PIF Genes in Betula platyphylla Suk

We downloaded the Betula platyphylla genome data at Phytozome (available online: https://phytozome.jgi.doe.gov/pz/portal.html, accessed on 27 August 2021. PIF proteins of Arabidopsis thaliana and Populus trichocarpa were downloaded from The Arabidopsis Information Resource (TAIR) database (available online: https://www.arabidopsis.org, accessed on 14 July 2021) and Phytozome. Eight Arabidopsis thaliana and ten Populus trichocarpa PIF proteins were used as query sequences and Blastp searches against the predicted B. platyphylla proteins, and the E-value was set to less than 1 × 10−7. All candidate genes were further examined by confirming the existence of bHLH domains using the Pfam and Batch CD-Search program. Basic information (PIs, MWs) was predicted through the ExPASy website (https://web.expasy.org/protparam/, accessed on 29 August 2021).

4.2. Phylogenetic Analysis

Multiple sequence alignments were performed by Muscle with default parameters. The phylogenetic trees were constructed with the full protein sequences of PIFs using MEGA7.0 (available online: https://www.megasoftware.net/, accessed on 29 August 2021) [57]. The neighbour-joining (NJ) method was used with the following parameters: Poisson correction, pairwise deletion, and bootstrap (1000 replicates; random seed).

4.3. Gene Structure Analysis, Conserved Motif Recognition, and Transcription Binding Site Analysis

The DNA and cDNA sequences corresponding to each predicted gene from the Local Database and the gene structures were analysed using the web-based bioinformatics tool GSDS (available online: http://gsds.cbi.pku.edu.cn/, accessed on 30 August 2021) [58]. MEME (Multiple Expectation Maximisation for Motif Elicitation) was used to identify conserved motif structures of BpPIF protein and promoter sequences [59]. PlantCARE webtool (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/, accessed on 30 August 2021) was used to predict the cis-acting elements within 2000 bp upstream of all BpPIF genes.

4.4. Chromosomal Distribution and Gene Duplication

Only seven BpPIF genes were mapped to Betula pendula chromosomes based on physical location information from the database of Betula pendula genome using Tbtools (available online: https://github.com/CJChen/TBtools, accessed on 27 August 2021) [60]. The Multiple Collinearity Scan toolkit (MCScanX) was adopted to analyse the gene duplication events with the default parameters [61]. To exhibit the synteny relationship of the orthologous BpPIF genes obtained from Betula pendula, Arabidopsis, and rice, we constructed syntenic analysis maps using TBtools.

4.5. Plant Materials, Treatment, Sample Collection, and RNA-Seq

Four-week-old wild-type (WT), 35S::BpSPL2 (OE), and 35S::BpSPL2-SRDX (R) tissue culture seedlings of B. pendula had stem segments with apical buds cut at the second internode (about 2.5 cm long), without adding hormones. These cuttings were cultivated in WPM solid medium for 0.5 h, 24 h, and 96 h. The sampling site was about 0.4 cm from the base of the stem. Three biological replicates were set for each processing time point, totalling 27 library sequencing samples, 40 seedlings per repetition and three biological replicates for each treatment. Gene expression levels were analysed by employing the fragments per kilobase of exon per million mapped fragments (FPKM) algorithm (unpublished data). Root Transcriptome sequencing was performed by Suzhou GENEWIZ Biotechnology (https://www.genewiz.com.cn/, accessed on 6 November 2021).
All plant material was derived from 5-year-old B. platyphylla growing in the birch forest yard of Northeast Forestry University, Heilongjiang, China. Three types of inflorescences, normal male inflorescences (NM), female inflorescences (F), and mutant male inflorescences (MM), were used to establish transcriptomes. MMs are sterile and appear later in development than NMs since microspore development is aborted at the late mononucleate microspore stage [62]. We obtained the transcriptomes of the NM, F, and MM using high-throughput sequencing with a quality assessment of Q20 = 100%. After assembling into contigs with clean reads, we built a unigene library containing the three transcriptomes. The heatmaps were generated using TBtools.

Supplementary Materials

The following are available online at: https://www.mdpi.com/article/10.3390/ijms232315326/s1.

Author Contributions

X.H. and X.L. conceived and designed the experiments; A.C. carried out the bioinformatics analyses and the experiments, wrote the manuscript; P.H. reviewed the manuscript and submitted it; S.G. and S.L. helped proofread the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the National Natural Science Foundation of China (NSFC; No. 32171738), the National Key Research and Development Program of China (No. 2021YFD2200304), and the Heilongjiang Touyan Innovat (Tree Genetics and Breeding Innovation Team).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

All relevant data are included within this article.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Wang, Z.; Tang, J.; Hu, R.; Wu, P.; Hou, X.L.; Song, X.M.; Xiong, A.S. Genome-wide analysis of the R2R3-MYB transcription factor genes in Chinese cabbage (Brassica rapa ssp. pekinensis) reveals their stress and hormone responsive patterns. BMC Genom 2015, 16, 17–38. [Google Scholar] [CrossRef] [PubMed]
  2. Casal, J.J. Shade Avoidance. Arab. Book 2012, 10, e0157. [Google Scholar] [CrossRef] [PubMed]
  3. Ceriani, M.F.; Darlington, T.K.; Staknis, D.; Más, P.; Petti, A.A.; Weitz, C.J.; Kay, S.A. Light-dependent sequestration of TIMELESS by CRYPTOCHROME. Science 1999, 285, 553–556. [Google Scholar] [CrossRef] [PubMed]
  4. Pedmale, U.V.; Huang, S.C.; Zander, M.; Cole, B.J.; Hetzel, J.; Ljung, K.; Reis, P.A.B.; Sridevi, P.; Nito, K.; Nery, J.R.; et al. Cryptochromes Interact Directly with PIFs to Control Plant Growth in Limiting Blue Light. Cell 2016, 164, 233–245. [Google Scholar] [CrossRef] [PubMed]
  5. Carretero-Paulet, L.; Galstyan, A.; Roig-Villanova, I.; Martinez-Garcia, J.F.; Bilbao-Castro, J.R.; Robertson, D.L. Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae. Plant Physiol. 2010, 153, 1398–1412. [Google Scholar] [CrossRef]
  6. Bailey, P.C.; Martin, C.; Toledo-Ortiz, G.; Quail, P.H.; Huq, E.; Heim, M.A.; Jakoby, M.; Werber, M.; Weisshaar, B. Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana. Plant Cell 2003, 15, 2497–2502. [Google Scholar] [CrossRef]
  7. Leivar, P.; Quail, P.H. PIFs. pivotal components in a cellular signaling hub. Trends Plant Sci. 2011, 16, 19–28. [Google Scholar] [CrossRef]
  8. Pham, V.N.; Kathare, P.K.; Huq, E. Phytochromes and Phytochrome Interacting Factors. Plant Physiol. 2018, 176, 1025–1038. [Google Scholar] [CrossRef]
  9. Lee, N.; Choi, G. Phytochrome-interacting factor from Arabidopsis to liverwort. Curr. Opin. Plant Biol. 2017, 35, 54–60. [Google Scholar] [CrossRef]
  10. Huq, E.; Al-Sady, B.; Hudson, M.; Kim, C.; Apel, K.; Quail, P.H. Phytochrome-interacting factor 1 is a critical bHLH regulator of chlorophyll biosynthesis. Science 2004, 305, 1937–1941. [Google Scholar] [CrossRef]
  11. Zhang, Y.; Mayba, O.; Pfeiffer, A.; Shi, H.; Tepperman, J.M.; Speed, T.P.; Quail, P.H. A quartet of PIF bHLH factors provides a transcriptionally centered signaling hub that regulates seedling morphogenesis through differential expression-patterning of shared target genes in Arabidopsis. PLoS Genet. 2013, 9, e1003244. [Google Scholar] [CrossRef] [PubMed]
  12. Cao, D.; Hussain, A.; Cheng, H.; Peng, J. Loss of function of four DELLA genes leads to light- and gibberellin-independent seed germination in Arabidopsis. Planta 2005, 223, 105–113. [Google Scholar] [CrossRef] [PubMed]
  13. Finkelstein, R.R.; Lynch, T.J. The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor. Plant Cell 2000, 12, 599–609. [Google Scholar] [CrossRef]
  14. Oh, E.; Yamaguchi, S.; Kamiya, Y.; Bae, G.; Chung, W.I.; Choi, G. Light activates the degradation of PIL5 protein to promote seed germination through gibberellin in Arabidopsis. Plant J. 2006, 47, 124–139. [Google Scholar] [CrossRef] [PubMed]
  15. Kim, D.H.; Yamaguchi, S.; Lim, S.; Oh, E.; Park, J.; Hanada, A.; Kamiya, Y.; Choi, G. SOMNUS, a CCCH-type zinc finger protein in Arabidopsis, negatively regulates light-dependent seed germination downstream of PIL5. Plant Cell 2008, 20, 1260–1277. [Google Scholar] [CrossRef]
  16. Dirk, L.; Kumar, S.; Majee, M.; Downie, A.B. Phytochrome interacting factor1 interactions leading to the completion or prolongation of seed germination. Plant Signal. Behav. 2018, 13, e1525999. [Google Scholar] [CrossRef]
  17. Majee, M.; Kumar, S.; Kathare, P.K.; Wu, S.; Gingerich, D.; Nayak, N.R.; Salaita, L.; Dinkins, R.; Martin, K.; Goodin, M.; et al. KELCH F-BOX protein positively influences Arabidopsis seed germination by targeting phytochrome-interacting factor1. Proc. Natl. Acad. Sci. USA 2018, 115, E4120–E4129. [Google Scholar] [CrossRef]
  18. Luo, Q.; Lian, H.L.; He, S.B.; Li, L.; Jia, K.P.; Yang, H.Q. COP1 and phyB Physically Interact with PIL1 to Regulate Its Stability and Photomorphogenic Development in Arabidopsis. Plant Cell 2014, 26, 2441–2456. [Google Scholar] [CrossRef]
  19. Shimizu-Sato, S.; Huq, E.; Tepperman, J.M.; Quail, P.H. A light-switchable gene promoter system. Nat. Biotechnol. 2002, 20, 1041–1044. [Google Scholar] [CrossRef]
  20. Monte, E.; Tepperman, J.M.; Al-Sady, B.; Kaczorowski, K.A.; Alonso, J.M.; Ecker, J.R.; Li, X.; Zhang, Y.; Quail, P.H. The phytochrome-interacting transcription factor, PIF3, acts early, selectively, and positively in light-induced chloroplast development. Proc. Natl. Acad. Sci. USA 2004, 101, 16091–16098. [Google Scholar] [CrossRef]
  21. Pacin, M.; Semmoloni, M.; Legris, M.; Finlayson, S.A.; Casal, J.J. Convergence of constitutive photomorphogenesis 1 and phytochrome interacting factor signalling during shade avoidance. New Phytol. 2016, 211, 967–979. [Google Scholar] [CrossRef] [PubMed]
  22. Jiang, B.; Shi, Y.; Peng, Y.; Jia, Y.; Yan, Y.; Dong, X.; Li, H.; Dong, J.; Li, J.; Gong, Z.; et al. Cold-Induced CBF-PIF3 Interaction Enhances Freezing Tolerance by Stabilizing the phyB Thermosensor in Arabidopsis. Mol. Plant 2020, 13, 894–906. [Google Scholar] [CrossRef] [PubMed]
  23. Xu, Y.; Zhu, Z. PIF4 and PIF4-Interacting Proteins. At the Nexus of Plant Light, Temperature and Hormone Signal Integrations. Int. J. Mol. Sci. 2021, 22, 10304. [Google Scholar] [CrossRef] [PubMed]
  24. Li, T.; Li, B.; Wang, L.; Xie, Z.; Wang, X.; Zou, L.; Zhang, D.; Lin, H. Phytochrome-interacting factor 4 (PIF4) inhibits expression of short hypocotyl 2 (SHY2) to promote hypocotyl growth during shade avoidance in Arabidopsis. Biochem. Biophys Res. Commun. 2021, 534, 857–863. [Google Scholar] [CrossRef] [PubMed]
  25. Kim, Y.; Park, S.U.; Shin, D.M.; Pham, G.; Jeong, Y.S.; Kim, S.H. ATBS1-INTERACTING FACTOR 2 negatively regulates dark- and brassinosteroid-induced leaf senescence through interactions with INDUCER OF CBF EXPRESSION 1. J. Exp. Bot. 2020, 71, 1475–1490. [Google Scholar] [CrossRef] [PubMed]
  26. Saitoh, A.; Takase, T.; Abe, H.; Watahiki, M.; Hirakawa, Y.; Kiyosue, T. ZEITLUPE enhances expression of PIF4 and YUC8 in the upper aerial parts of Arabidopsis seedlings to positively regulate hypocotyl elongation. Plant Cell Rep. 2021, 40, 479–489. [Google Scholar] [CrossRef] [PubMed]
  27. Holalu, S.V.; Reddy, S.K.; Blackman, B.K.; Finlayson, S.A. Phytochrome interacting factors 4 and 5 regulate axillary branching via bud abscisic acid and stem auxin signalling. Plant Cell Environ. 2020, 43, 2224–2238. [Google Scholar] [CrossRef] [PubMed]
  28. Liu, Z.; Wang, Y.; Fan, K.; Li, Z.; Jia, Q.; Lin, W.; Zhang, Y. Phytochrome-interacting factor 4 (PIF4) negatively regulates anthocyanin accumulation by inhibiting PAP1 transcription in Arabidopsis seedlings. Plant Sci. 2021, 303, 110788. [Google Scholar] [CrossRef]
  29. Jin, H.; Lin, J.; Zhu, Z. PIF4 and HOOKLESS1 Impinge on Common Transcriptome and Isoform Regulation in Thermomorphogenesis. Plant Commun. 2020, 1, 100034. [Google Scholar] [CrossRef]
  30. Yusuke, N.; Takafumi, Y.; Takeshi, M. The circadian clock regulates the photoperiodic response of hypocotyl elongation through a coincidence mechanism in Arabidopsis thaliana. Plant Cell Physiol. 2009, 50, 838–854. [Google Scholar]
  31. Huq, E.; Quail, P.H. PIF4, a phytochrome-interacting bHLH factor, functions as a negative regulator of phytochrome B signaling in Arabidopsis. EMBO J. 2002, 21, 2441–2450. [Google Scholar] [CrossRef] [PubMed]
  32. Tavridou, E.; Pireyre, M.; Ulm, R. Degradation of the transcription factors PIF4 and PIF5 under UV-B promotes UVR8-mediated inhibition of hypocotyl growth in Arabidopsis. Plant J. 2020, 101, 507–517. [Google Scholar] [CrossRef] [PubMed]
  33. Li, N.; Bo, C.; Zhang, Y.; Wang, L. PHYTOCHROME INTERACTING FACTORS PIF4 and PIF5 promote heat stress induced leaf senescence in Arabidopsis. J. Exp. Bot. 2021, 72, 4577–4589. [Google Scholar] [CrossRef] [PubMed]
  34. Ruhl, C.; Stauffer, E.; Kahles, A.; Wagner, G.; Drechsel, G.; Ratsch, G.; Wachter, A. Polypyrimidine tract binding protein homologs from Arabidopsis are key regulators of alternative splicing with implications in fundamental developmental processes. Plant Cell 2012, 24, 4360–4375. [Google Scholar] [CrossRef]
  35. Paulisic, S.; Qin, W.; Arora, V.H.; Then, C.; Alary, B.; Nogue, F.; Tsiantis, M.; Hothorn, M.; Martinez-Garcia, J.F. Adjustment of the PIF7-HFR1 transcriptional module activity controls plant shade adaptation. EMBO J. 2021, 40, e104273. [Google Scholar] [CrossRef]
  36. Pantazopoulou, C.K.; Bongers, F.J.; Pierik, R. Reducing shade avoidance can improve Arabidopsis canopy performance against competitors. Plant Cell Environ. 2021, 44, 1130–1141. [Google Scholar] [CrossRef]
  37. Fiorucci, A.S.; Galvao, V.C.; Ince, Y.C.; Boccaccini, A.; Goyal, A.; Allenbach, P.L.; Trevisan, M.; Fankhauser, C. Phytochrome INTERACTING FACTOR 7 is important for early responses to elevated temperature in Arabidopsis seedlings. New Phytol. 2020, 226, 50–58. [Google Scholar] [CrossRef] [PubMed]
  38. Huang, X.; Zhang, Q.; Jiang, Y.; Yang, C.; Wang, Q.; Li, L. Shade-induced nuclear localization of PIF7 is regulated by phosphorylation and 14-3-3 proteins in Arabidopsis. Elife 2018, 7, e31636. [Google Scholar] [CrossRef]
  39. Kidokoro, S.; Maruyama, K.; Nakashima, K.; Imura, Y.; Narusaka, Y.; Shinwari, Z.K.; Osakabe, Y.; Fujita, Y.; Mizoi, J.; Shinozaki, K.; et al. The phytochrome-interacting factor PIF7 negatively regulates DREB1 expression under circadian control in Arabidopsis. Plant Physiol. 2009, 151, 2046–2057. [Google Scholar] [CrossRef]
  40. Leivar, P.; Monte, E.; Al-Sady, B.; Carle, C.; Storer, A.; Alonso, J.M.; Ecker, J.R.; Quail, P.H. The Arabidopsis phytochrome-interacting factor PIF7, together with PIF3 and PIF4, regulates responses to prolonged red light by modulating phyB levels. Plant Cell 2008, 20, 337–352. [Google Scholar] [CrossRef]
  41. Leivar, P.; Martin, G.; Soy, J.; Dalton-Roesler, J.; Quail, P.H.; Monte, E. Phytochrome-imposed inhibition of PIF7 activity shapes photoperiodic growth in Arabidopsis together with PIF1, 3, 4 and 5. Physiol. Plant 2020, 169, 452–466. [Google Scholar] [CrossRef] [PubMed]
  42. Kumar, S.V.; Lucyshyn, D.; Jaeger, K.E.; Alos, E.; Alvey, E.; Harberd, N.P.; Wigge, P.A. Transcription factor PIF4 controls the thermosensory activation of flowering. Nature 2012, 484, 242–245. [Google Scholar] [CrossRef]
  43. Zhang, R.; Yang, C.; Jiang, Y.; Li, L. A PIF7-CONSTANS-Centered Molecular Regulatory Network Underlying Shade-Accelerated Flowering. Mol. Plant 2019, 12, 1587–1597. [Google Scholar] [CrossRef] [PubMed]
  44. Zhang, Y.; Wu, Z.; Feng, M.; Chen, J.; Qin, M.; Wang, W.; Bao, Y.; Xu, Q.; Ye, Y.; Ma, C.; et al. The circadian-controlled PIF8-BBX28 module regulates petal senescence in rose flowers by governing mitochondrial ROS homeostasis at night. Plant Cell 2021, 33, 2716–2735. [Google Scholar] [CrossRef] [PubMed]
  45. Ding, J.; Zhang, B.; Li, Y.; Andre, D.; Nilsson, O. Phytochrome B and phytochrome interacting factor8 modulate seasonal growth in trees. New Phytol. 2021, 232, 2339–2352. [Google Scholar] [CrossRef] [PubMed]
  46. Zhang, Y.; Mitsuda, N.; Yoshizumi, T.; Horii, Y.; Oshima, Y.; Ohme-Takagi, M.; Matsui, M.; Kakimoto, T. Two types of bHLH transcription factor determine the competence of the pericycle for lateral root initiation. Nat. Plants 2021, 7, 633–643. [Google Scholar] [CrossRef]
  47. Zhang, L.; He, G.; Li, Y.; Yang, Z.; Liu, T.; Xie, X.; Kong, X.; Sun, J. PIL transcription factors directly interact with SPLs and repress tillering/branching in plants. New Phytol. 2022, 233, 1414–1425. [Google Scholar] [CrossRef]
  48. Chen, S.; Wang, Y.; Yu, L.; Zheng, T.; Wang, S.; Yue, Z.; Jiang, J.; Kumari, S.; Zheng, C.; Tang, H.; et al. Genome sequence and evolution of Betula platyphylla. Hortic Res. 2021, 8, 37. [Google Scholar] [CrossRef]
  49. Li, X.; Duan, X.; Jiang, H.; Sun, Y.; Tang, Y.; Yuan, Z.; Guo, J.; Liang, W.; Chen, L.; Yin, J.; et al. Genome-wide analysis of basic/helix-loop-helix transcription factor family in rice and Arabidopsis. Plant Physiol. 2006, 141, 1167–1184. [Google Scholar] [CrossRef]
  50. Pires, N.; Dolan, L. Origin and diversification of basic-helix-loop-helix proteins in plants. Mol. Biol. Evol. 2010, 27, 862–874. [Google Scholar] [CrossRef]
  51. Leister, D. Tandem and segmental gene duplication and recombination in the evolution of plant disease resistance gene. Trends Genet. 2004, 20, 116–122. [Google Scholar] [CrossRef] [PubMed]
  52. Penfield, S.; Josse, E.M.; Kannangara, R.; Gilday, A.D.; Halliday, K.J.; Graham, I.A. Cold and light control seed germination through the bHLH transcription factor SPATULA. Curr. Biol. 2005, 15, 1998–2006. [Google Scholar] [CrossRef] [PubMed]
  53. Makkena, S.; Lamb, R.S. The bHLH transcription factor SPATULA regulates root growth by controlling the size of the root meristem. BMC Plant Biol. 2013, 13, 1. [Google Scholar] [CrossRef]
  54. Guan, L.; Murphy, A.S.; Peer, W.A.; Gan, L.; Li, Y.; Cheng, Z.M. Physiological and Molecular Regulation of Adventitious Root Formation. Crit. Rev. Plant Sci. 2015, 34, 506–521. [Google Scholar] [CrossRef]
  55. Lee, H.W.; Cho, C.; Pandey, S.K.; Park, Y.; Kim, M.J.; Kim, J. LBD16 and LBD18 acting downstream of ARF7 and ARF19 are involved in adventitious root formation in Arabidopsis. BMC Plant Biol. 2019, 19, 46. [Google Scholar] [CrossRef]
  56. Li, Q.Q.; Zhang, Z.; Wang, Y.L.; Zhong, L.Y.; Chao, Z.F.; Gao, Y.Q.; Han, M.L.; Xu, L.; Chao, D.Y. Phytochrome B inhibits darkness-induced hypocotyl adventitious root formation by stabilizing IAA14 and suppressing ARF7 and ARF19. Plant J. 2021, 105, 1689–1702. [Google Scholar] [CrossRef]
  57. Kumar, S.; Stecher, G.; Tamura, K. MEGA7. Molecular Evolutionary Genetics Analysis Version 7.0 for Bigger Datasets. Mol. Biol. Evol. 2016, 33, 1870–1874. [Google Scholar] [CrossRef]
  58. Guo, A.Y.; Zhu, Q.H.; Chen, X.; Luo, J.C. GSDS. a gene structure display server. Yi Chuan = Hered. 2007, 29, 1023–1026. [Google Scholar] [CrossRef]
  59. Bailey, T.L.; Williams, N.; Misleh, C.; Li, W.W. MEME. discovering and analyzing DNA and protein sequence motifs. Nucleic Acids Res. 2006, 34, W369–W373. [Google Scholar] [CrossRef]
  60. Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools. An Integrative Toolkit Developed for Interactive Analyses of Big Biological Data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar]
  61. Wang, Y.; Tang, H.; Debarry, J.D.; Tan, X.; Li, J.; Wang, X.; Lee, T.H.; Jin, H.; Marler, B.; Guo, H.; et al. A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, e49. [Google Scholar] [CrossRef] [PubMed]
  62. Xin, Q.; Hu, X.; Zhang, Y.; Li, D.; Xu, B.; Liu, X. Expression pattern analysis of key genes related to anther development in a mutant of male-sterile Betula platyphylla Suk. Tree Genet. Genomes 2020, 16, 33. [Google Scholar] [CrossRef]
Figure 1. The evolutionary history was inferred using the neighbour-joining method. Then, the phylogenetic tree was constructed based on the full-length protein sequences of BpPIFs, 8 AtPIF, and 10 PtPIF proteins using MEGA 7.0 software (available online: https://www.megasoftware.net/, accessed on 29 August 2021).
Figure 1. The evolutionary history was inferred using the neighbour-joining method. Then, the phylogenetic tree was constructed based on the full-length protein sequences of BpPIFs, 8 AtPIF, and 10 PtPIF proteins using MEGA 7.0 software (available online: https://www.megasoftware.net/, accessed on 29 August 2021).
Ijms 23 15326 g001
Figure 2. Phylogenetic relationships, conserved protein motifs, and gene structure in PIF genes from Betula platyphylla Suk. (A) The phylogenetic tree of Betula platyphylla Suk., Arabidopsis thaliana, and Populus trichocarpa PIFs were exhibited. (B) The motif composition of BpPIF proteins. The motifs are displayed in different coloured boxes. B1 is the legend of Figure B (C) The exon–intron structure of BpPIF genes. Exons and UTRs are represented as dark yellow and green boxes, respectively, while black lines indicate introns. Pink boxes highlight the bHLH-AtPIF-like domain. C1 is the legend of figure C.
Figure 2. Phylogenetic relationships, conserved protein motifs, and gene structure in PIF genes from Betula platyphylla Suk. (A) The phylogenetic tree of Betula platyphylla Suk., Arabidopsis thaliana, and Populus trichocarpa PIFs were exhibited. (B) The motif composition of BpPIF proteins. The motifs are displayed in different coloured boxes. B1 is the legend of Figure B (C) The exon–intron structure of BpPIF genes. Exons and UTRs are represented as dark yellow and green boxes, respectively, while black lines indicate introns. Pink boxes highlight the bHLH-AtPIF-like domain. C1 is the legend of figure C.
Ijms 23 15326 g002
Figure 3. Gene duplication and synteny analysis of BpPIF genes. (A) Schematic representations for the chromosomal distribution and interchromosomal relationships of BpPIF genes. Grey lines indicate all synteny blocks in the Betula platyphylla Suk. Genome, and the red lines indicate segmental duplicated BpPIF gene pairs. (B) Synteny analysis of BpPIF genes between Betula platyphylla, Arabidopsis thaliana, and Populus trichocarpa. Grey lines in the background indicate the collinear blocks within Betula, Arabidopsis, and Populus genomes, while the red lines highlight the syntenic BpPIF gene pairs. Lines with different colours highlight different gene pairs.
Figure 3. Gene duplication and synteny analysis of BpPIF genes. (A) Schematic representations for the chromosomal distribution and interchromosomal relationships of BpPIF genes. Grey lines indicate all synteny blocks in the Betula platyphylla Suk. Genome, and the red lines indicate segmental duplicated BpPIF gene pairs. (B) Synteny analysis of BpPIF genes between Betula platyphylla, Arabidopsis thaliana, and Populus trichocarpa. Grey lines in the background indicate the collinear blocks within Betula, Arabidopsis, and Populus genomes, while the red lines highlight the syntenic BpPIF gene pairs. Lines with different colours highlight different gene pairs.
Ijms 23 15326 g003aIjms 23 15326 g003b
Figure 4. Putative conserved motifs in the promoters of BpPIFs according to the phylogenetic relationship. The three motifs were identified online using the MEME with a 2.0 kb upstream region of the start codon of all BpPIF genes. The following parameters “nmotifs 3, minw 6, maxw 20, minsites 30, maxsites 100” were used in MEME. Different colours indicate different motifs. The logos of three conserved domain sequences, shown in the top right corner, were obtained from the MEME Suite website.
Figure 4. Putative conserved motifs in the promoters of BpPIFs according to the phylogenetic relationship. The three motifs were identified online using the MEME with a 2.0 kb upstream region of the start codon of all BpPIF genes. The following parameters “nmotifs 3, minw 6, maxw 20, minsites 30, maxsites 100” were used in MEME. Different colours indicate different motifs. The logos of three conserved domain sequences, shown in the top right corner, were obtained from the MEME Suite website.
Ijms 23 15326 g004
Figure 5. Cis-elements in the promoter of BpPIF genes that are related to stress responses and plant development. The X-axis represents the number of cis-acting elements.
Figure 5. Cis-elements in the promoter of BpPIF genes that are related to stress responses and plant development. The X-axis represents the number of cis-acting elements.
Ijms 23 15326 g005
Figure 6. Heatmap of the expression profiles of BpPIF family genes (A) The developmental expression pattern analysis of BpPIF family genes at three developmental stages during rooting induction. The 0.5, 24, and 96 represent 0.5, 24, and 96 h after cutting shoots cultivating in WPM medium; OE-, R-, and WT- represent overexpression lines, suppressed expression lines and wild-type birch, respectively. Clustering was based on log2-transformed FPKM values of seven BpPIF genes. (B) Expression pattern analysis of four family genes in fertile male flowers and sterile male flowers in different developmental stages of birch. The expression data were acquired from the RNA-seq data with three biological replicates. Values shown on the heatmaps represent the average FPKM value of three biological replicates.
Figure 6. Heatmap of the expression profiles of BpPIF family genes (A) The developmental expression pattern analysis of BpPIF family genes at three developmental stages during rooting induction. The 0.5, 24, and 96 represent 0.5, 24, and 96 h after cutting shoots cultivating in WPM medium; OE-, R-, and WT- represent overexpression lines, suppressed expression lines and wild-type birch, respectively. Clustering was based on log2-transformed FPKM values of seven BpPIF genes. (B) Expression pattern analysis of four family genes in fertile male flowers and sterile male flowers in different developmental stages of birch. The expression data were acquired from the RNA-seq data with three biological replicates. Values shown on the heatmaps represent the average FPKM value of three biological replicates.
Ijms 23 15326 g006
Figure 7. Relative expression levels of BpPIFs in adventitious root formation. The number on the X axis indicates the time of rooting induction (hour), The different colours of the lines represent different birch lines. Stars indicate significant differences between OE-, SRDX-, and WT (p < 0.05) according to Duncan’s multiple range test, while the equals sign means non-specific difference. Expression levels were calculated based on the 2−ΔΔCt method, with the zero-hour sample chosen as a reference.
Figure 7. Relative expression levels of BpPIFs in adventitious root formation. The number on the X axis indicates the time of rooting induction (hour), The different colours of the lines represent different birch lines. Stars indicate significant differences between OE-, SRDX-, and WT (p < 0.05) according to Duncan’s multiple range test, while the equals sign means non-specific difference. Expression levels were calculated based on the 2−ΔΔCt method, with the zero-hour sample chosen as a reference.
Ijms 23 15326 g007
Table 1. Putative members of the BpPIF gene family of Betula platyphylla Suk.
Table 1. Putative members of the BpPIF gene family of Betula platyphylla Suk.
Gene ID (RNA-Seq Data)Gene ID (Downloaded Data)Putative PIF NameLocationProteinLength/aaPIMW (kDa)Domain
Bpev01.c0000.g0060.mRNA1---BpPIF1---5425.6559.38bHLH_AtPIF_like
Bpev01.c0918.g0013.mRNA1BPChr08G16198BpPIF3Chr08:33527696:33532250:−7425.8779.48bHLH_AtPIF_like
Bpev01.c1708.g0006.mRNA1BPChr11G17797BpPIF4Chr11:26928610:26931540:+4875.9153.71bHLH_AtPIF_like
Bpev01.c0349.g0043.mRNA1BPChr04G09407BpPIF7Chr04:1830185:1835072:−4549.2549.70bHLH_AtPIF_like
Bpev01.c1013.g0001.mRNA1BPChr13G16040BpPIF8Chr13:16435535:16440667:−5588.3660.92bHLH_AtPIF_like
Bpev01.c0015.g0022.mRNA1BPChr12G25898BpPIF9aChr12:3852366:3859065:−3625.0139.40bHLH_AtPIF_like
Bpev01.c0555.g0004.mRNA1BPChr06G16498BpPIF9bChr06:4115462:4119588:−4405.3848.32bHLH_AtPIF_like
Bpev01.c1527.g0004.mRNA2BPChr05G27408BpPIF10Chr05:1125580:1127552:−4638.850.94bHLH_AtPIF_like
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Chen, A.; Huang, P.; Guo, S.; Liu, S.; Hu, X.; Liu, X. Comprehensive Analysis of Betula platyphylla Suk. PIF Gene Family and Their Potential Functions in Growth and Development. Int. J. Mol. Sci. 2022, 23, 15326. https://doi.org/10.3390/ijms232315326

AMA Style

Chen A, Huang P, Guo S, Liu S, Hu X, Liu X. Comprehensive Analysis of Betula platyphylla Suk. PIF Gene Family and Their Potential Functions in Growth and Development. International Journal of Molecular Sciences. 2022; 23(23):15326. https://doi.org/10.3390/ijms232315326

Chicago/Turabian Style

Chen, Aihua, Peng Huang, Shanshan Guo, Sige Liu, Xiaoqing Hu, and Xuemei Liu. 2022. "Comprehensive Analysis of Betula platyphylla Suk. PIF Gene Family and Their Potential Functions in Growth and Development" International Journal of Molecular Sciences 23, no. 23: 15326. https://doi.org/10.3390/ijms232315326

APA Style

Chen, A., Huang, P., Guo, S., Liu, S., Hu, X., & Liu, X. (2022). Comprehensive Analysis of Betula platyphylla Suk. PIF Gene Family and Their Potential Functions in Growth and Development. International Journal of Molecular Sciences, 23(23), 15326. https://doi.org/10.3390/ijms232315326

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop