Next Article in Journal
Microbial Metabolites Determine Host Health and the Status of Some Diseases
Next Article in Special Issue
Gender Differences in the Pharmacological Actions of Pegylated Glucagon-Like Peptide-1 on Endothelial Progenitor Cells and Angiogenic Precursor Cells in a Combination of Metabolic Disorders and Lung Emphysema
Previous Article in Journal
Immunobiology of Atherosclerosis: A Complex Net of Interactions
Previous Article in Special Issue
How Oxygen Availability Affects the Antimicrobial Efficacy of Host Defense Peptides: Lessons Learned from Studying the Copper-Binding Peptides Piscidins 1 and 3
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Prolactin-Releasing Peptide: Physiological and Pharmacological Properties

by
Veronika Pražienková
1,
Andrea Popelová
1,
Jaroslav Kuneš
1,2 and
Lenka Maletínská
1,*
1
Biochemistry and Molecular Biology, Institute of Organic Chemistry and Biochemistry of the Czech Academy of Sciences 16610 Prague, Czech Republic
2
Experimental Hypertension, Institute of Physiology of the Czech Academy of Sciences, 14200 Prague, Czech Republic
*
Author to whom correspondence should be addressed.
Int. J. Mol. Sci. 2019, 20(21), 5297; https://doi.org/10.3390/ijms20215297
Submission received: 2 October 2019 / Revised: 21 October 2019 / Accepted: 23 October 2019 / Published: 24 October 2019
(This article belongs to the Special Issue Peptides for Health Benefits 2019)

Abstract

Prolactin-releasing peptide (PrRP) belongs to the large RF-amide neuropeptide family with a conserved Arg-Phe-amide motif at the C-terminus. PrRP plays a main role in the regulation of food intake and energy expenditure. This review focuses not only on the physiological functions of PrRP, but also on its pharmacological properties and the actions of its G-protein coupled receptor, GPR10. Special attention is paid to structure-activity relationship studies on PrRP and its analogs as well as to their effect on different physiological functions, mainly their anorexigenic and neuroprotective features and the regulation of the cardiovascular system, pain, and stress. Additionally, the therapeutic potential of this peptide and its analogs is explored.

1. Introduction

There is no doubt that the function of prolactin-releasing peptide (PrRP) in organisms is quite important as its structure is well conserved within different animal species. PrRP is reported to regulate food intake and energy metabolism, but it could have several other specific functions, such as the regulation of cardiac output, stress response, reproduction, the release of endocrine factors, and recently neuroprotective features. The site of the main action of PrRP is the brain, where its release is regulated by a number of stimuli, including those coming from the periphery.
PrRP binds with high affinity to the GPR10 receptor and also has lesser activity towards the neuropeptide FF (NPFF) receptor type 2 (NPFF-R2). In addition, cooperation with other food intake regulating neuropeptides, especially leptin, cholecystokinin (CCK), or neuropeptide Y (NPY), is very important for the effects of PrRP.
In structure-activity relationship (SAR) studies, novel PrRP analogs with attached fatty acids and changes in the amino acid chain were synthetized to overcome the blood-brain barrier and to improve the stability and bioavailability from the periphery, thus representing interesting targets for therapeutic use.

2. Discovery and Structure of PrRP

PrRP was first isolated in 1998 by Hinuma and colleagues from an extract of bovine hypothalamus and was described as a ligand for the orphan seven-transmembrane-domain receptor (7TM) GPR10 (also known as hGR3 or rat ortholog UHR-1) using reverse pharmacology ([1,2] and reviewed in [3]). The cloned full-length cDNA of the PrRP gene is 435 bp in length and encodes an 87 amino acid long precursor [4]. The PrRP rat gene contains three exons and two introns and spans a region of approximately 2.4 kb [5].
The average precursor length is 105 amino acids with two cleavage sites [6]. From the protein precursors, at least two isoforms of different lengths, PrRP20 and PrRP31 (Table 1), are produced. Shorter PrRP20 shares identical C-termini with the longer form of PrRP31. The fish ortholog of PrRP20, C-RFa, was isolated and described by Fujimoto et al. from the brain of Carassius auratus langsdorfii in the same year that PrRP was discovered [7]. The cloned cDNA of the C-RFa gene is 997 bp in length and encodes a precursor of 108 amino acids [4]. Subsequently, PrRP was identified in amphibians in Xenopus laevis in both isoforms [8]. In birds, specifically in Gallus gallus, PrRP has a similar sequence as in fishes and amphibians and is also expressed in the brain [9]. Moreover, Wang et al. measured the expression of both PrRP and C-RFa in chickens, as well as in Xenopus and zebrafish, suggesting that those peptides are encoded by two separate genes and may play similar yet distinctive roles in nonmammalian vertebrate species [4].
PrRPs in vertebrates share very conserved homology and there is evidence that PrRP evolved from a common ancestry precursor in nonmammalian and mammalian species [10]. The precursor is composed of a hydrophobic N-terminal sequence, paired basic amino acids for the recognition of endopeptidases, and a very conserved C-terminal sequence, where the amino acid glycine is a donor for the amide group. The bovine/human C-terminal octapeptide is Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; in fish C-RFa, isoleucine and valine are swapped (Table 1) [6].
The name of PrRP was suggested on the basis of its prolactin-releasing activity in a rat pituitary adenoma-derived cell line and in pituitary cells obtained from lactating rats [1]. Additionally, another study reported that the injection of PrRP stimulated plasma prolactin levels in female rats in proestrus, estrus, and metestrus, and increased doses of PrRP were necessary to increase plasma prolactin in male rats [11]. Nevertheless, this prolactin-releasing function was later questioned because it did not have typical features for hypophysiotropic hormones [12,13]. Currently, PrRP is considered likely to be an anorexigenic (i.e., food-intake-lowering) neuropeptide, which mainly plays a role in the regulation of food intake and energy expenditure [12,14,15,16], but also regulates stress [17,18], sleep [19,20], and the cardiovascular system [21,22,23]. In addition, its potential neuroprotective properties have been described [24,25,26].

3. GPR10 Discovery and Gene Location

Using polymerase chain reaction (PCR), Marchese et al. discovered genes encoding novel G-protein coupled receptors (GPCRs), including the human gene for GPR10 [27]. GPR10 shares high amino acid identity with NPY receptor 1 (NPY-1R) and orphan receptor induced by glucocorticoids (GIR) [27]. The overall amino acid identity is 31% and 46% in the transmembrane domains for NPY-1R and 30% and 46% in those for GIR. This GPR10 receptor was later confirmed to be identical to orphan hGR3 reported as a receptor for PrRP by Hinuma et al. [1]. Human GPR10 shares high homology (89%) with rat ortholog UHR-1 [2]. The human 1107 bp long gene for GPR10 is located on chromosome 10 q25.3–q26.1 and a related sequence on chromosome 13 q14.3–q21.1, encoding a 370 amino acid long protein [27].
In nonmammalian vertebrates, fish and chicken PrRP receptor genes are located on chromosome 17 and chromosome 5, respectively [27,28]. GPR10 is well conserved in mammals with more than 90% identity, however in chickens, it is only 54% identical compared with the mammalian counterpart, probably because of phylogenetic differences. The most conserved sequence is on the C-terminus of the receptor, particularly the last six amino acid peptides that could interact with a ligand [29,30]. Both isoforms PrRP20 and PrRP31 bind with high affinity to the GPR10 receptor and rat UHR-1 [31].
Later, it was discovered that PrRP has an affinity for NPFF-R2 [32]. Different studies confirmed the molecular and functional identity of the HLWAR77 receptor, which is a common target for NPFF and neuropeptide AF (NPAF), with NPFF-R2 [33]. Human NPFF-R2 shares 89% amino acid identity with its rat ortholog, high homology with NPY receptors [34], and 37% homology with the orexin-A receptor [33].

4. Distribution of PrRP and its Receptor GPR10

4.1. Distribution of PrRP

The highest expression of PrRP mRNA was measured in the brainstem in the nucleus of the solitary tract (NTS) and a moderate level was detected in the dorsomedial hypothalamic nucleus (DMN), ventrolateral reticular nucleus of the thalamus (VRT) (Figure 1), and in the periphery in the intestine both in rats and humans when analyzed with reverse transcription-PCR [31,35,36]. Immunoreactive cell bodies were found mainly in the DMN, ventromedial hypothalamic nucleus (VMN), NTS, and ventrolateral medulla oblongata (ME), and nerve projections were present in the paraventricular hypothalamic nucleus (PVN), supraoptic nucleus (SON), DMN, lateral hypothalamic area (LHA), thalamic nucleus, amygdala, and area postrema (AP) (Figure 1) [31]. Immunoreactive fibers were also detected in high concentrations in the posterior pituitary [37,38]. Using enzyme immunoassay for PrRP distribution, immunoreactive PrRP was widely present in the hypothalamus, midbrain and posterior pituitary, and ME [37]. In mammals, rats, and humans, peripheral tissue PrRP mRNA was found mainly in the adrenal gland, lung, pancreas, liver, kidney, reproductive organs, and gut [35,37,39,40]. Concentration of PrRP in rat plasma was very low (0,13 fmol/mL) [37]. In chicken tissue, C-RFa mRNA was detected in the kidney, lung, reproductive organs, heart, intestine, liver, and pituitary [4]. In the amphibious fish, mudskipper, PrRP mRNA expression was observed in the brain, liver, gut, and ovary, with lower levels detected in the skin and kidney [41].

4.2. Distribution of GPR10

The highest expression of GPR10 mRNA was detected in several parts of the rat brain, mainly in the reticular nucleus of the thalamus (RT), PVN, periventricular hypothalamic nucleus (PEVN) and DMN, AP, and NTS. A moderate level of expression of the receptor was also detected in the anterior pituitary and VMN (Figure 1) [31,42]. Radiolabeled 125I-PrRP31 bound in a specific pattern to the reticular thalamic nucleus and PEVN [31]. GPR10 was also found in the parabrachial nucleus (PB) or nucleus accumbens (NAc), which are areas that are involved in pain processing [31], and in low levels in the hippocampus (stratum lacunosum-moleculare; SLM), which involves areas that are involved in memory [2,26]. In the periphery, GPR10 mRNA was found in the rat adrenal medulla [35,43,44]. Through the detection of mRNA and in situ hybridization or immunohistochemical studies, PrRP and its receptor were found in discrete areas within the brain and periphery. Indeed, PrRP nerve fibers are in close proximity to areas where GPR10 is present, but PrRP still has to be transported to other sites to be released. This fact may also support the hypothesis that PrRP binding and signaling are not restricted to the GPR10 receptor.

5. PrRP Intracellular Signaling Pathways

To explore signal transduction pathways and the potential agonist or antagonist properties of PrRP action at GPR10, several studies have been published. Hinuma et al. first reported that PrRP promoted arachidonic acid metabolite release in Chinese hamster ovary (CHO) cells expressing GPR10 [1]. PrRP was able to dose-dependently stimulate calcium release in cells that were transfected with GPR10 in a calcium mobilization assay (Figure 2) [31].
PrRP rapidly activated extracellular signal-regulated protein kinase (ERK) from the mitogen-activated protein kinase (MAPK) family in GH3 rat pituitary tumor cells and in primary rat anterior pituitary cultures (Figure 2) [45]. Moreover, pertussis toxin (PTX), which inactivates Gi/Go proteins, completely blocked the ERK activation induced by PrRP, suggesting that at least part of the coupling of GPR10 is through Gi/Go proteins [45]. Kimura et al. also demonstrated that PrRP activated c-Jun N-terminal protein kinase (JNK) in a protein kinase C (PKC)-dependent manner in GH3 rat pituitary tumor cells [45].
PrRP20 was then reported not to alter basal levels of intracellular cyclic AMP in human embryonic kidney HEK293 cells that were transfected with GPR10, suggesting that in this system, GPR10 does not couple through Gs protein, which would activate adenylyl cyclase to increase the cyclic AMP concentration [46]. In addition, PrRP20 did not decrease forskolin-stimulated cyclic AMP levels, indicating that GPR10 does not couple via Gi, which would inhibit adenylyl cyclase and decrease cyclic AMP levels [46]. Therefore, the possible involvement of GPR10 signaling through the Gq pathway was proposed.
Engstrom et al. tested the ability of PrRP20 or PrRP31 to stimulate [35S]GTPγS binding to membranes of CHO cells expressing GPR10; more than 80% of the binding of PrRP was prevented by PTX [32]. Taken together, these data suggest that a large part of the GPR10 coupling occurs via Gi/Go proteins, however this depends on the cellular system in which the receptor is expressed [32,45,46]. In the study from Engstrom et al., intracellular calcium assays also confirmed the full agonist properties of both PrRP20 and PrRP31 at GPR10 [46].
PrRP rapidly and transiently stimulated the activation of protein kinase B (Akt) in GH3 cells, and a phosphoinositide 3-kinase-protein kinase (PI3K) inhibitor blocked the PrRP-induced activation of Akt (Figure 2) (reviewed in [47]). Additionally, PTX completely blocked the Akt activation induced by PrRP, suggesting the involvement of Gi/Go proteins [48]. PrRP31 significantly induced an increase in the activity of ERKs and JNK, but not p38 MAPK in the rat PC12 pheochromocytoma cell line [49]. Moreover, PrRP stimulated dopamine release and catecholamine secretion and increased tyrosine hydroxylase levels via the protein kinase A (PKA) and PKC pathway in PC12 cells [49,50]. PrRP has also been shown to stimulate adenylyl cyclase in the PC12 cell line and promote the proliferation of cultured cells [51]. The stimulation of the chicken PrRP receptor expressed in CHO cells by PrRP also leads to the activation of the intracellular PKA signaling pathway [4,52].
PrRP activated the PI3K B/Akt-mammalian target of rapamycin (PI3K-Akt-mTOR) pathways and cell proliferation in primary leiomyoma cells, where GPR10 is aberrantly expressed [53]. Maixnerova et al. showed that both PrRP20 and PrRP31 activated ERK and cAMP response element-binding protein (CREB) signaling and induced prolactin release in the rat pituitary cell line RC-4B/C with equal potency (Figure 2) [54]. Additionally, modified analogs of PrRP20 and PrRP31, either with changes in the amino acids at the C-terminus or with lipidization, strongly induced the phosphorylation of the ERK pathway in CHO cells expressing GPR10 [55].

6. Structure-Activity Relationship Studies

Two isoforms of PrRP with either 20 or 31 amino acids sharing identical C-termini showed comparable in vitro and in vivo activity [1]. Several SAR studies with PrRP analogs were performed [31,56,57,58]. No study about selective antagonists of PrRP has been published yet, but in 2010, Otsuka Pharmaceuticals patented nonpeptide heterocyclic antagonists derived from tetrahydropyridol [4,3-d]pyrimidinone developed for stress-related diseases (reviewed in [59]).
First, Roland et al. demonstrated that N-terminal deletions from PrRP20 slightly decreased the affinity of the PrRP analogs for GPR10 [31]. The shortest analog that was still able to bind to GPR10 was C-terminal heptapeptide PrRP(25–31). However, this fragment displayed a two order of magnitude decrease in binding affinity compared to that of PrRP20 and PrRP31, which exhibited affinity in the nanomolar range. The replacement of the C-terminal amide group with an acid resulted in a complete loss of binding affinity [1,31]. Moreover, an alanine scan through PrRP(25–31) showed that the arginine at positions 26 and 30 is crucial for binding to the receptor, and their change results in a loss of affinity [31]. D’Ursi et al. described a conformational analysis of PrRP20 using circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopies and molecular modeling calculations. The C-terminal region consisted of amphipathic helices with hydrophobic nonpolar side chains of Ala21, Ile25, Val28, and Phe31 and hydrophilic side chains of Arg23, Arg26, and Arg30 [60].
PrRP could be shortened without a loss of in vitro activity to the tridecapeptide PrRP(19–31), H-Trp19-Tyr20-Ala21-Ser22-Arg23-Gly24-Ile25-Arg26-Pro27-Val28-Gly29-Arg30-Phe31-NH2, which has the minimal length for retaining binding affinity and agonist properties [56]. The binding affinity was significantly decreased by further truncation of the peptide; therefore, the active site is located within the C-terminal region. This large SAR study focused on the replacement of amino acids at positions 21 to 31, with a main focus on the phenylalanine at position 31. Nineteen different amino acids were used, but only a bulky side chain His(Bzl), Trp, Cys(Bzl), Glu(Obzl), norleucine (Nle) or a halogenated aromatic ring (Phe(4-Cl)) led to similar or improved binding affinity and good agonist activity [56]. Replacement of Arg23 by Pro significantly decreased the affinity. The results confirmed that the functionally important residues are located within the C-terminal segment with the essential and irretrievable arginine 30 and the high importance of phenylalanine 31.
Based on a previous study by Boyle et al., Maletínská et al. [58] designed PrRP20 analogs with modifications of Phe31 by amino acids with different aromatic rings. Phe31 was replaced by (3,4-dichlor)phenylalanine (PheCl231), (4-nitro)phenylalanine (PheNO231), pentafluoro-phenylalanine (PheF531), napthylalanine (1-Nal31, 2-Nal31), or Tyr31. In addition, the amino acids cyclohexylalanine (Cha31) and phenylglycine (Phg31) were included [58]. This study showed that all analogs except [Cha31]PrRP20 and [Phg31]PrRP20 preserved high binding affinity to rat RC-4B/C pituitary cells and increased the phosphorylation of ERK and CREB in this cell line.
DeLuca et al. performed a structural study based on NMR and CD spectroscopy, where they determined the α-helical conformation in trifluoroethanol of the C-terminal sequence of PrRP20 [57]. Shorter PrRP20 analogs, PrRP(4–20), PrRP13 (PrRP(8–20)), and heptapeptide PrRP(14–20), decreased the stability of the helical segment and their biological activity was reduced. Therefore, this stable C-terminal α-helical structure facilitates ligand recognition by the receptor and enables its activation [57].
The lipidization of peptides (i.e., the attachment of fatty acids to peptides through an ester or amide bond) is a useful strategy for designing new peptide drugs. This modification may enhance potency, selectivity, and therapeutic efficacy because it can increase stability and prolong the half-life in an organism. Moreover, it could enable delivery across the blood-brain barrier (reviewed in [61]). This lipidized peptide is liraglutide, an analog of glucagon-like peptide 1 (GLP-1) that is palmitoylated at position 26 via a γ-glutamyl linker [62], with a strongly prolonged half-life [63]. Therefore, the lipidization of neuropeptides that is involved in food intake regulation might be a new way for the development of drugs for the treatment of obesity (reviewed in [64]).
Maletínská et al. designed novel lipidized PrRP analogs with fatty acids of different lengths attached to the N-terminus [55]. All PrRP20 and PrRP31 analogs lipidized with octanoic, decanoic, dodecanoic, myristic, palmitic, and stearic acid had agonist characteristics and preserved high binding affinity to GPR10 compared to native PrRP20 or PrRP31 [55].
Lipidized PrRP31 analogs with noncoded amino acids 1-Nal, PheCl2, PheNO2, PheF5, or Tyr at position 31 and myristoylated or palmitoylated on the N-terminus revealed high binding potency to GPR10. The original methionine at position 8 was replaced by the more stable Nle to avoid oxidation of Met without any loss of binding and signaling activity [65].
Analogs of PrRP31 where palmitic acid was attached through the γ-glutamyl linker or the short chain of polyethylene glycol at Lys11 or analog with two palmitic acids at Lys11 and at the N-terminus were tested both in in vitro and in vivo studies. Binding and signaling experiments showed preserved binding affinity to GPR10, although the analog with two palmitic acids was less potent. The attachment of the single palmitic acid could be performed on different positions of the chain without the loss of binding affinity [66].
Recently, a new study by Pflimlin et al. was published in which novel long-lasting PrRP analogs with staples incorporating multiple ethylene glycol-fatty acids (MEG-FAs) were synthetized [67]. Crucial arginines at positions 23 and 30 were replaced with homoarginine (hArg), beta-homoarginine (β-hArg), and N-methylarginine (Nme-Arg). All modifications at Arg30 significantly affected the potency. In Arg23, only substitution by Nme-Arg, but not by hArg or β-hArg, decreased the affinity. All synthetized analogs contained dicysteine mutations, the best tolerated of which occurred at positions 6–13, 15–22, and 18–25. As lead compounds, they chose the PrRP analog 18-S4, an analog with Cys6, Cys13, Nle11, and hArg23 and stapled at cysteines by staple featuring four ethylene glycol units attached to octadecanedioic acid via a lysine linker incorporating a carboxylated moiety. They generated analogs with in vitro selective agonist activity towards GPR10 [67]. The structure of all of the mentioned PrRP analogs is described in Figure 3.

7. PrRP in the Regulation of Food Intake and Energy Expenditure

7.1. PrRP Decreases Food Intake and Regulates Energy Homeostasis

First, it was shown that PrRP caused the release of prolactin from cultured pituitary cells [1], but later, other studies showed the main role of PrRP to be in food intake regulation ([12,14,68] and this is reviewed in [64]).
Lawrence et al. suggested an alternative role for PrRP as a regulator of energy homeostasis and food intake [14]. Intracerebroventricular (ICV) injection of PrRP caused a reduction in food intake in fasted and free-fed rats [14]. Moreover, the subsequent decrease in body weight was not only due to the reduction in food intake, which implies an effect on energy expenditure. They supported the findings by measuring PrRP mRNA, which was highly expressed in the hypothalamus, NTS, and ventrolateral ME, and GPR10 mRNA in the RT, PEVN and DMN, and NTS, all areas of which are implicated in the regulation of food intake (reviewed in [69,70,71]).
PrRP also mediated some of the central satiating actions of the gut peptide hormone CCK [12]. The measurement of the induction of c-Fos protein showed that PrRP neurons were strongly activated by the intraperitoneal injection of CCK, and central PrRP administration activated areas of the brain that are common for both PrRP and CCK [12]. Ellacott et al. suggested that the anorexigenic action of PrRP is regulated by the adiposity signal leptin [72]. ICV administration of PrRP and leptin resulted in reduced food intake in rats and an increase in body temperature compared with each peptide alone. Additionally, using in situ hybridization, PrRP mRNA levels were reduced in fasting and obese Zucker rats, indicating that PrRP expression is regulated by leptin [72].
Repeated ICV injection of PrRP strongly reduced food intake and body weight in rats without causing any adverse behavior on locomotor or sensor motor activity [73]. PrRP exerted an effect on energy homeostasis in the short to medium term and increased energy expenditure [74].
Through the generation of GPR10 knockout (KO) mice with targeted deletion of the GPR10 gene, GPR10 was confirmed to be a major receptor for PrRP in the hypothalamus because this deletion completely prevented PrRP binding to hypothalamic cell membranes [75]. GPR10 KO mice become hyperphagic and mildly obese at older ages and develop decreased glucose tolerance with elevated levels of insulin and leptin [75]. Male and female GPR10 KO mice had increased body weight as a consequence of increased fat mass compared to their wild-type (WT) controls [76]. The total levels of plasma leptin and cholesterol were increased, and a decrease in energy expenditure was observed in GPR10 KO mice [76]. In fasted or satiated GPR10 KO mice, ICV administration of PrRP did not reduce food intake in contrast to their WT controls. The administration of CCK did not result in the inhibition of food intake in GPR10 KO mice, suggesting that PrRP is involved in central satiating actions of CCK [77]. PrRP KO mice had higher blood glucose levels and corticosterone levels and became obese with higher amounts of adipose or liver tissue than control WT animals [78]. Under stress conditions, PrRP KO mice showed increased levels of plasma corticosterone compared to WT mice, which might indicate that PrRP regulates glucose metabolism through corticosterone secretion and⁄or catecholamine synthesis [78].
PrRP was also shown to mediate its anorexigenic effect through corticotropin-releasing hormone (CRH) receptors, but not through melanocortin receptors [68]. ICV administration of PrRP elevated adrenocorticotropin (ACTH) levels in plasma, and c-Fos protein was increased in the nuclei of CRH-positive cells in the PVN [79,80]. PrRP-positive neurons have synapse-like contact with CRH cell bodies in the PVN [79]. Furthermore, the injection of PrRP directly into the PVN caused an increase in plasma ACTH [81]. Using hypothalamic explant incubations, researchers showed that PrRP increased hypothalamic CRH release, which is one of the principal ACTH secretagogues, and the subsequent secretion of ACTH. Therefore, an additional potential role of PrRP in the function of the hypothalamic-pituitary-adrenal (HPA) axis and in the cardiovascular system was suggested [23,81].

7.2. Ortholog C-RFa in Food Intake Regulation

Similar to the anorexigenic action of PrRP in mammals, ICV injection of ortholog C-RFa also inhibited food intake in goldfish [82]. However, a completely opposite result was observed in chicks, where ICV injection of rat PrRP31 significantly increased food intake, and the orexigenic effect of NPY was enhanced with the coadministration of PrRP [83]. ICV injection of ortholog C-RFa did not affect food intake in chickens [84].

7.3. PrRP Analogs in the Regulation of Food Intake and Energy Expenditure

The C-terminal 20 amino acids of PrRP (PrRP20) are crucial for preserving the full food-intake-lowering effect. ICV administration of PrRP20 analogs with PheCl231, PheNO231, PheF531, 1-Nal31, 2-Nal31, or Tyr31 resulted in decreased food intake in fasted mice [58]. In particular, [PheNO231]PrRP20, [1-Nal31]PrRP20, [2-Nal31]PrRP20, and [Tyr31]PrRP20 showed the most significant and long-lasting anorexigenic effect after ICV administration in fasted lean mice. This study showed that a bulky aromatic ring, not necessarily phenylalanine at the C-terminus, enabled full anorexigenic activity [58].
PrRP acts centrally; therefore, the potential of PrRP to decrease food intake after peripheral administration depends on reaching the receptors in the brain and enabling the central effect. Of the analogs with different length fatty acids attached at the N-terminus of PrRP, only myristoylated PrRP20 (myr-PrRP20), palmitoylated (palm-PrRP31), and stearoylated PrRP31 significantly lowered food intake in fasted or freely fed lean mice after subcutaneous (SC) administration [55]. Therefore, those analogs were suggested to probably cross the blood-brain barrier because they caused the central effect after peripheral administration. Analogs containing shorter fatty acids had no effect on food intake. Moreover, analogs palm-PrRP31 and myr-PrRP20, but not natural PrRP20 and PrRP31 or octanoylated PrRP31, showed longer stability in rat plasma and significantly increased c-Fos immunoreactivity in hypothalamic and brainstem nuclei that are involved in food intake regulation, such as PVN, ARC, and NTS.
A significant increase in c-Fos was observed in the PVN, ARC, NTS, and DMN after SC administration of palm-PrRP31. Moreover, palm-PrRP31 administration significantly increased c-Fos in the LHA hypocretin neurons and PVN oxytocin neurons [85].
Palmitoylated or myristoylated PrRP31 analogs with C-terminal changes reduced acute food intake after SC administration in fasted lean mice [65] (reviewed in [64]). Of all the lipidized PrRP analogs, [PheCl231]PrRP31 palmitoylated or myristoylated at the N-terminus showed the strongest and long-lasting anorexigenic effect in fasted mice [65]. In free-fed Wistar rats, palm-PrRP31 strongly reduced food intake when injected peripherally. Peripheral injection of palm-PrRP31 induced the increase of c-Fos protein in the PVN, NTS, and ARC, which are specific brain regions that are involved in food intake regulation [86].
In diet-induced obese (DIO) mice, a 2-week-long SC administration of palm-PrRP31 and myr-PrRP20 significantly lowered food intake, decreased body weight, improved metabolic parameters such as plasma insulin and leptin, and attenuated lipogenesis compared to lean controls [55].
Repeated administration of PrRP analogs palmitoylated through different linkers to Lys11 but not analog with two palmitic acids reduced body and liver weights and the levels of plasma insulin, leptin, triglycerides, cholesterol, and free fatty acid in DIO mice. Moreover, the expression of uncoupling protein 1 (UCP-1) was increased in brown adipose tissue (BAT), suggesting an increase in energy expenditure [66]. A single dose of PrRP31 palmitoylated at Lys11 through a γ-glutamyl linker (palm11-PrRP31) again caused neuronal activation and decreased food intake, suggesting its central effect after peripheral administration [66]. This lipidized analog palm11-PrRP31 increased the neural activity, represented by increased FosB immunostaining, only in the DMN and in VMN among the analyzed brain nuclei involved in food intake regulation [87].
The chronic effect of palm-PrRP31 was studied in DIO Sprague-Dawley rats and leptin receptor-deficient Zucker diabetic fatty (ZDF) rats, where palm-PrRP31 was intraperitoneally administered for two weeks. Palm-PrRP31 lowered food intake and body weight, improved glucose tolerance, and tended to decrease leptin levels and adipose tissue in DIO rats [88]. In contrast, the administration of palm-PrRP31 lowered food intake, but it did not significantly affect body weight or glucose tolerance in ZDF rats.
Repeated administration of the lipidized PrRP analog palm11-PrRP31 improved glucose tolerance in Koletsky-spontaneously hypertensive obese (SHROB) rats, which have mutations in their leptin receptor and, therefore, impaired leptin signaling [89]. These findings suggest that the effect of palm11-PrRP31 on glucose metabolism is independent of leptin signaling and body weight lowering. Treatment with palm11-PrRP31 also decreased body weight in control spontaneously hypertensive rats (SHRs), but not in SHROB rats. It seems that the palm11-PrRP anorexigenic effect depends on the proper leptin signaling. Moreover, in SHROB rats, palm11-PrRP31 ameliorated the insulin/glucagon ratio and increased insulin receptor substrate 1 and 2 expression in fat and insulin signaling in the hypothalamus, while it had no effect on blood pressure [89]. An increase in all parameters mentioned pointed to a beneficial effect of palm11-PrRP on the diabetic state. Additionally, in SHRs and normotensive Wistar Kyoto (WKY) rats on a high-fat diet, treatment with palm11-PrRP31 lowered body weight and improved biochemical and biometric parameters. Palm11-PrRP31 also improved glucose tolerance in WKY rats [90].
Novel long-lasting PrRP analogs with cysteine mutations and staples with attached octadecanedioic acid enhanced plasma stability and half-life in mice. In a 12-day SC administration, the 18-S4 analog significantly reduced body weight in DIO mice [67].
Taken together, PrRP and palmitoylated PrRP analogs are anorexigenic peptides that strongly reduce food intake by reducing appetite and impact energy expenditure under the control of leptin. Proper leptin signaling is necessary for the anorexigenic effect of PrRP and its analogs. Palmitoylated PrRP analogs activate c-Fos in specific neuron populations that are connected to the regulation of food intake. Moreover, lipidization prolonged the half-life of PrRP analogs and enabled central action, leading to a strong food-intake-lowering effect after peripheral administration in mice and rats [55,64,66].

8. Neuroprotective Properties of PrRP

Obesity and type 2 diabetes mellitus were recently identified as risk factors for the development of neurological disorders, such as Alzheimer’s disease (AD). Thus, anorexigenic and/or antidiabetic substances began to be examined as compounds with potential neuroprotective properties. This potential is supported by the finding that receptors of anorexigenic peptides, such as GPR10 or the GLP-1 receptor, are expressed in the hippocampus, which is the first brain region affected during AD.
Extracellular senile plaques formed by aggregated β-amyloid protein (Aβ) and intracellular neurofibrillary tangles formed by hyperphosphorylated tau protein are two hallmarks of AD [91,92]. However, other pathological features are observed in AD patients, such as decreased synaptic plasticity and neurogenesis or increased neuroinflammation [93].
The neuroprotective properties of the lipidized PrRP analogs palm-PrRP31 and palm11-PrRP31 were examined in vitro as well as in vivo in several rodent models of neurodegeneration. The results were reviewed in depth by Maletínská et al. [94].
The effect of human PrRP31 and its lipidized analog palm11-PrRP31 on tau hyperphosphorylation was examined in vitro using a model of hypothermia in the neuroblastoma cell line SH-SY5Y and on rat primary cortical neurons. Hypothermic conditions resulted in increased tau hyperphosphorylation at several epitopes, including pThr212 and pSer396/pSer404, in both cellular models. In SH-SY5Y, incubation with palm11-PrRP31, as well as with PrRP31, attenuated tau hyperphosphorylation at pThr212. In primary cortical neurons, palm11-PrRP31 decreased tau hyperphosphorylation at both pThr212 and pSer396/pSer404. On the other hand, human PrRP did not affect phosphorylation at pThr212 or at pSer396/Ser404 in primary cortical neurons [95].
The effect of PrRP on tau hyperphosphorylation was extensively studied in vivo using different mouse models. Mice with obesity induced by monosodium glutamate (MSG mice) [96,97] develop increased tau hyperphosphorylation due to central insulin resistance manifested by decreased activation of the insulin signaling cascade. Palm-PrRP31 ameliorated the activation of the insulin signaling cascade and subsequently decreased tau phosphorylation at several epitopes, such as pThr231 and pSer396 [26]. A similar effect on tau hyperphosphorylation was observed in the THY-Tau22 mouse model, where the intervention with palm11-PrRP31 also improved short-term spatial memory in the Y-maze test and increased synaptic plasticity compared to the vehicle-treated group [25]. The modulation of synaptic transduction was also examined in a study by Lin et al. [30], where they showed that GPR10 modulates the scaffolding and trafficking of the glutamate-gated cation channel α-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor to the postsynaptic membrane, which is necessary to mediate fast excitatory transmission in the brain.
APP/PS1 mice, which are double transgenic mice expressing mutated amyloid precursor protein (APP) (Swedish mutation, K595N/M596L) and mutated presenilin (PS1) (deltaE9 PS1) exon deletion, are one of the most frequently used models to study Aβ pathology [98]. Treatment with the lipidized analog palm11-PrRP31 decreased the amount of senile Aβ plaques in APP/PS1 mice. Moreover, palm11-PrRP31 lowered the markers of neuroinflammation that are colocalized with Aβ plaques—ionized calcium-binding adapter molecule 1 (Iba1), which is a marker of activated microglial cells, and glial fibrillary acidic protein (GFAP), which is a marker of reactive astrocytes. Potential neuroprotective properties are further manifested by increased levels of doublecortin, a marker of neurogenesis, in hippocampi [24].
In conclusion, palmitoylated analogs of PrRP31 seem to be potential tools to treat neurological disorders. However, the mechanism of action remains unclear and must be further studied.

9. Other Physiological Functions of PrRP

PrRP and GPR10 are expressed in many brain regions that control different physiological functions. It seems that PrRP plays an important role in the stress response (reviewed in [99]). PrRP-producing neurons in the ME were activated in response to some stressful stimuli, such as foot shock stress [100]. Moreover, PrRP KO mice were found to react differently to restraint stress than their WT littermates; PrRP KO mice have increased blood glucose and corticosterone levels [78]. This study was supported by the finding that neurons producing noradrenaline, which is known as a stress mediator in the CNS, are colocalized with PrRP neurons in the NTS and ventral and lateral reticular nuclei in the ME, and coadministration of PrRP and noradrenaline synergistically increased the release of pituitary ACTH [18]. In NTS, PrRP immunopositive neurons are located in close proximity to GLP-1 immunopositive neurons and signaling, though GLP-1R modulates the activity of PrRP neurons [101]. Both neuronal populations are activated after exposure to stressors and seem to contribute to the central control of stress. The PrRP neural populations from ME were projected to the PVN in the hypothalamus, where CRH and oxytocin, both of which are modulators of the stress response, are produced [79]. Consistent with this, ICV administration of PrRP increased the level of corticosterone and oxytocin in the blood. In addition, the administration of PrRP antibodies abolishes stress-induced activation of PVN and attenuated oxytocin release to the blood [102]. The coadministration of PrRP and astressin, a CRH receptor antagonist, blocked ACTH release; thus, the CRH receptor is important for PrRP action [68]. The physiological role of PrRP is well reviewed by Lin [29], Dodd et al. [3], and Quillet et al. [103].
The effect of PrRP on CRH release could be responsible for the increased heart rate and blood pressure that was observed after central PrRP administration [23]; thus, PrRP could be involved in the regulation of the cardiovascular system (reviewed by [22]). It seems that the effect of PrRP on the increase in blood pressure is not mediated by GPR10 since PrRP was able to increase blood pressure in Otsuka Long-Evans Tokushima Fatty (OLETF) rats that have mutated GPR10 [104].
A high density of GPR10-producing neurons is observed in the PB, which is responsible for the regulation of nociception. These neurons also produced enkephalins, which are pain suppressors that bind to opioid receptors, which suggests the control of enkephalin production by PrRP [105]. The role of PrRP in nociception is supported by the finding that GPR10 KO mice have a higher nociceptive threshold and increased stress-induced analgesia. Thus, PrRP could act as a potential antagonist of the opioid system [106].
It was also demonstrated that PrRP may affect the function of chromaffin cells because PrRP and its receptor are highly expressed in the adrenal medulla [39,44]. Moreover, PrRP-immunopositive cells were found in the rat adrenal gland [107]. On the basis of these results, it was suggested that PrRP may play an important role in modulating catecholamine secretion [49].
Due to its distribution, PrRP could also be involved in sexual and reproductive function or in sleep and the control of circadian rhythms (in the ME) [19,20]. PrRP is expressed in brain areas that are implicated in reproduction (in the DMN, ME) and also in periphery in rat testis and epididymis [39,59]. Feng et al. suggested that PrRP could be involved in the regulation of the female rat estrous cycle [108]. Brain PrRP mRNA level was higher in the proestrus and estrus in female rats. Moreover, they found colocalization of GPR10 immunoreactive neurons and gonadotropin-releasing hormone in the hypothalamic medial preoptic area. The study by Maruyama et al. showed that ICV administration of PrRP increases plasma oxytocin in rats and they suggested the role of PrRP as a neuromodulator of oxytocin neurons in the brain [109]. There is also some evidence that PrRP is involved in lactation and that PrRP levels are regulated by hormonal changes [100].

10. Conclusions

PrRP, with its conservative RF-amide sequence on the C-terminus, is a potent anorexigenic neuropeptide, decreasing food intake and enhancing energy metabolism. Moreover, it regulates other physiological functions, such as the cardiovascular system, stress, and reproduction, and has neuroprotective properties. These functions are mainly mediated through the receptor GPR10.
The use of specific model systems, particularly PrRP/GPR10 KO animals, can contribute to an understanding of the molecular mechanisms of PrRP action, thereby contributing to a faster use of PrRP analogs for potential therapy. From our several recent studies, it is clear that lipidized PrRP analogs could have therapeutic potential. Further progress in the development of selective PrRP analogs may contribute to their use not only in the treatment of obesity, but also in the treatment of other metabolic or neurodegenerative diseases.

Author Contributions

V.P. collected the bibliography, wrote the manuscript, and prepared the figures; A.P. contributed to the writing; J.K. contributed to the figure design; J.K. and L.M. conceived the topic and revised the review.

Funding

This research was funded by the Grant Agency of the Czech Republic (grant number 18-10591S) and the Academy of Sciences of the Czech Republic (RVO: 61388963).

Conflicts of Interest

The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.

Abbreviations

β-amyloid protein
ACTHAdrenocorticotropin
ADAlzheimer’s disease
AktProtein kinase B
APArea postrema
APPAmyloid precursor protein
BATBrown adipose tissue
β-hArgbeta-homoarginine
CCerebral cortex
CCCorpus callosum
CECerebellum
CCKCholecystokinin
CDCircular dichroism
CHOChinese hamster ovary
ChaCyclohexylalanine
CREBcAMP response element-binding protein
CRHCorticotropin-releasing hormone
Cys(Bzl)Boc-S-benzyl-l-cysteine
DIODiet-induced obese
DMNDorsomedial hypothalamic nucleus
ERKExtracellular signal-regulated protein kinase
GFAPGlial fibrillary acidic protein
GIRReceptor induced by glucocorticoids
Glu(Obzl)Boc-l-glutamic acid 1-benzyl ester
GLP-1Glucagon-like peptide 1
GPCRG-protein coupled receptor
GPR10Receptor for prolactin-releasing peptide (known as hGR3 or rat ortholog UHR-1)
hArgHomoarginine
HBHindbrain
HIPPHippocampus
His(Bzl)Nα-Fmoc-N(im)-benzyl-l-histidine
HPAHypothalamic-pituitary-adrenal
HYPHypothalamus
Iba1Ionized calcium-binding adapter molecule 1
ICVIntracerebroventricular
JNKC-Jun N-terminal protein kinase
KOKnockout
LHALateral hypothalamic area
MAPKMitogen-activated protein kinase
MEMedulla oblongata
MEG-FAMultiple ethylene glycol-fatty acid
MIBMidbrain
MSGMonosodium glutamate
myrMyristic acid
NAcNucleus accumbens
1-Nal1-napthylalanine
2-Nal2-napthylalanine
NleNorleucine
Nme-ArgN-methylarginine
NMRNuclear magnetic resonance
NPAFNeuropeptide AF
NPFFNeuropeptide FF
NPFF-R2Receptor 2 for neuropeptide FF (known as GPR74 or HLWAR77)
NPYNeuropeptide Y
NPY-1RNeuropeptide Y receptor 1
NTSNucleus of the solitary tract
OFOlfactory bulb
OLETFOtsuka Long-Evans Tokushima Fatty
palmPalmitic acid
PPituitary
PBParabrachial nucleus
PCRPolymerase chain reaction
PEVNPeriventricular hypothalamic nucleus
PheCl2(3,4-dichlor)phenylalanine
PheF5pentafluoro-phenylalanine
PheNO2(4-nitro)phenylalanine
PhgPhenylglycine
PI3KPhosphoinositide 3-kinase-protein kinase
PI3K-Akt-mTORPhosphoinositide 3-kinase-protein kinase B/Akt-mammalian target of rapamycin
PKAProtein kinase A
PKCProtein kinase C
PrRPProlactin-releasing peptide
PVNParaventricular hypothalamic nucleus
PS1Presenilin 1
PTXPertussis toxin
RTReticular nucleus of the thalamus
SARStructure-activity relationship
SCSubcutaneous
SHRSpontaneously hypertensive rats
SHROBSpontaneously hypertensive obese rats
SLMStratum lacunosum-moleculare
SONSupraoptic nucleus
THThalamus
TTDS1,13-diamino-4,7,10-trioxadecan-succinamic acid
UCP-1Uncoupling-protein 1
UHR-1Rat ortholog of GPR10
VMNVentromedial hypothalamic nucleus
VRTVentrolateral reticular nucleus of the thalamus
WKYWistar Kyoto
WTWild-type
ZDFZucker diabetic fatty
7TMSeven-transmembrane-domain receptor

References

  1. Hinuma, S.; Habata, Y.; Fujii, R.; Kawamata, Y.; Hosoya, M.; Fukusumi, S.; Kitada, C.; Masuo, Y.; Asano, T.; Matsumoto, H.; et al. A prolactin-releasing peptide in the brain. Nature 1998, 393, 272–276. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. Welch, S.K.; O’Hara, B.F.; Kilduff, T.S.; Heller, H.C. Sequence and tissue distribution of a candidate G-coupled receptor cloned from rat hypothalamus. Biochem. Biophys. Res. Commun. 1995, 209, 606–613. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Dodd, G.T.; Luckman, S.M. Physiological Roles of GPR10 and PrRP Signaling. Front. Endocrinol. 2013, 4, 20–28. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Wang, Y.; Wang, C.Y.; Wu, Y.; Huang, G.; Li, J.; Leung, F.C. Identification of the receptors for prolactin-releasing peptide (PrRP) and Carassius RFamide peptide (C-RFa) in chickens. Endocrinology 2012, 153, 1861–1874. [Google Scholar] [CrossRef] [Scilit]
  5. Yamada, M.; Ozawa, A.; Ishii, S.; Shibusawa, N.; Hashida, T.; Ishizuka, T.; Hosoya, T.; Monden, T.; Satoh, T.; Mori, M. Isolation and characterization of the rat prolactin-releasing peptide gene: Multiple TATA boxes in the promoter region. Biochem. Biophys. Res. Commun. 2001, 281, 53–56. [Google Scholar] [CrossRef] [Scilit]
  6. Southey, B.R.; Rodriguez-Zas, S.L.; Sweedler, J.V. Prediction of neuropeptide prohormone cleavages with application to RFamides. Peptides 2006, 27, 1087–1098. [Google Scholar] [CrossRef] [Scilit]
  7. Fujimoto, M.; Takeshita, K.; Wang, X.; Takabatake, I.; Fujisawa, Y.; Teranishi, H.; Ohtani, M.; Muneoka, Y.; Ohta, S. Isolation and characterization of a novel bioactive peptide, Carassius RFamide (C-RFa), from the brain of the Japanese crucian carp. Biochem. Biophys. Res. Commun. 1998, 242, 436–440. [Google Scholar] [CrossRef] [Scilit]
  8. Sakamoto, T.; Oda, A.; Yamamoto, K.; Kaneko, M.; Kikuyama, S.; Nishikawa, A.; Takahashi, A.; Kawauchi, H.; Tsutsui, K.; Fujimoto, M. Molecular cloning and functional characterization of a prolactin-releasing peptide homolog from Xenopus laevis. Peptides 2006, 27, 3347–3351. [Google Scholar] [CrossRef] [Scilit]
  9. Tachibana, T.; Moriyama, S.; Takahashi, A.; Tsukada, A.; Oda, A.; Takeuchi, S.; Sakamoto, T. Isolation and characterisation of prolactin-releasing peptide in chicks and its effect on prolactin release and feeding behaviour. J. Neuroendocrinol. 2011, 23, 74–81. [Google Scholar] [CrossRef] [Scilit]
  10. Lagerstrom, M.C.; Fredriksson, R.; Bjarnadottir, T.K.; Schioth, H.B. The ancestry of the prolactin-releasing hormone precursor. Ann. N. Y. Acad. Sci. 2005, 1040, 368–370. [Google Scholar] [CrossRef] [Scilit]
  11. Matsumoto, H.; Noguchi, J.; Horikoshi, Y.; Kawamata, Y.; Kitada, C.; Hinuma, S.; Onda, H.; Nishimura, O.; Fujino, M. Stimulation of prolactin release by prolactin-releasing peptide in rats. Biochem. Biophys. Res. Commun. 1999, 259, 321–324. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Lawrence, C.B.; Ellacott, K.L.; Luckman, S.M. PRL-releasing peptide reduces food intake and may mediate satiety signaling. Endocrinology 2002, 143, 360–367. [Google Scholar] [CrossRef] [PubMed]
  13. Samson, W.K.; Resch, Z.T.; Murphy, T.C.; Chang, J.K. Gender-biased activity of the novel prolactin releasing peptides: Comparison with thyrotropin releasing hormone reveals only pharmacologic effects. Endocrine 1998, 9, 289–291. [Google Scholar] [CrossRef] [Scilit]
  14. Lawrence, C.B.; Celsi, F.; Brennand, J.; Luckman, S.M. Alternative role for prolactin-releasing peptide in the regulation of food intake. Nat. Neurosci. 2000, 3, 645–646. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Seal, L.J.; Small, C.J.; Dhillo, W.S.; Stanley, S.A.; Abbott, C.R.; Ghatei, M.A.; Bloom, S.R. PRL-releasing peptide inhibits food intake in male rats via the dorsomedial hypothalamic nucleus and not the paraventricular hypothalamic nucleus. Endocrinology 2001, 142, 4236–4243. [Google Scholar] [CrossRef] [PubMed]
  16. Takayanagi, Y.; Matsumoto, H.; Nakata, M.; Mera, T.; Fukusumi, S.; Hinuma, S.; Ueta, Y.; Yada, T.; Leng, G.; Onaka, T. Endogenous prolactin-releasing peptide regulates food intake in rodents. J. Clin. Investig. 2008, 118, 4014–4024. [Google Scholar] [CrossRef] [Scilit]
  17. Onaka, T.; Takayanagi, Y.; Leng, G. Metabolic and stress-related roles of prolactin-releasing peptide. Trends Endocrinol. Metab. 2010, 21, 287–293. [Google Scholar] [CrossRef] [Scilit]
  18. Maruyama, M.; Matsumoto, H.; Fujiwara, K.; Noguchi, J.; Kitada, C.; Fujino, M.; Inoue, K. Prolactin-releasing peptide as a novel stress mediator in the central nervous system. Endocrinology 2001, 142, 2032–2038. [Google Scholar] [CrossRef]
  19. Zhang, S.Q.; Inoue, S.; Kimura, M. Sleep-promoting activity of prolactin-releasing peptide (PrRP) in the rat. Neuroreport 2001, 12, 3173–3176. [Google Scholar] [CrossRef] [Scilit]
  20. Zhang, S.Q.; Kimura, M.; Inoue, S. Effects of prolactin-releasing peptide (PrRP) on sleep regulation in rats. Psychiatry Clin. Neurosci. 2000, 54, 262–264. [Google Scholar] [CrossRef] [Scilit]
  21. Samson, W.K.; Resch, Z.T.; Murphy, T.C. A novel action of the newly described prolactin-releasing peptides: Cardiovascular regulation. Brain Res. 2000, 858, 19–25. [Google Scholar] [CrossRef] [Scilit]
  22. Mikulaskova, B.; Maletinska, L.; Zicha, J.; Kunes, J. The role of food intake regulating peptides in cardiovascular regulation. Mol. Cell. Endocrinol. 2016, 436, 78–92. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Yamada, T.; Mochiduki, A.; Sugimoto, Y.; Suzuki, Y.; Itoi, K.; Inoue, K. Prolactin-releasing peptide regulates the cardiovascular system via corticotrophin-releasing hormone. J. Neuroendocrinol. 2009, 21, 586–593. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Holubova, M.; Hruba, L.; Popelova, A.; Bencze, M.; Prazienkova, V.; Gengler, S.; Kratochvilova, H.; Haluzik, M.; Zelezna, B.; Kunes, J.; et al. Liraglutide and a lipidized analog of prolactin-releasing peptide show neuroprotective effects in a mouse model of beta-amyloid pathology. Neuropharmacology 2019, 144, 377–387. [Google Scholar] [CrossRef] [Scilit]
  25. Popelova, A.; Prazienkova, V.; Neprasova, B.; Kasperova, B.J.; Hruba, L.; Holubova, M.; Zemenova, J.; Blum, D.; Zelezna, B.; Galas, M.C.; et al. Novel Lipidized Analog of Prolactin-Releasing Peptide Improves Memory Impairment and Attenuates Hyperphosphorylation of Tau Protein in a Mouse Model of Tauopathy. J. Alzheimers Dis. 2018, 62, 1725–1736. [Google Scholar] [CrossRef] [Scilit]
  26. Spolcova, A.; Mikulaskova, B.; Holubova, M.; Nagelova, V.; Pirnik, Z.; Zemenova, J.; Haluzik, M.; Zelezna, B.; Galas, M.C.; Maletinska, L. Anorexigenic lipopeptides ameliorate central insulin signaling and attenuate tau phosphorylation in hippocampi of mice with monosodium glutamate-induced obesity. J. Alzheimers Dis. 2015, 45, 823–835. [Google Scholar] [CrossRef] [Scilit]
  27. Marchese, A.; Heiber, M.; Nguyen, T.; Heng, H.H.; Saldivia, V.R.; Cheng, R.; Murphy, P.M.; Tsui, L.C.; Shi, X.; Gregor, P.; et al. Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors. Genomics 1995, 29, 335–344. [Google Scholar] [CrossRef] [Scilit]
  28. Lagerstrom, M.C.; Fredriksson, R.; Bjarnadottir, T.K.; Fridmanis, D.; Holmquist, T.; Andersson, J.; Yan, Y.L.; Raudsepp, T.; Zoorob, R.; Kukkonen, J.P.; et al. Origin of the prolactin-releasing hormone (PRLH) receptors: Evidence of coevolution between PRLH and a redundant neuropeptide Y receptor during vertebrate evolution. Genomics 2005, 85, 688–703. [Google Scholar] [CrossRef] [Scilit]
  29. Lin, S.H. Prolactin-releasing peptide. In Results and Problems in Cell Differentiation; Springer: Berlin/Heidelberg, Germany, 2008; Volume 46, pp. 57–88. [Google Scholar] [CrossRef] [Scilit]
  30. Lin, S.H.; Arai, A.C.; Wang, Z.; Nothacker, H.P.; Civelli, O. The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering. Mol. Pharmacol. 2001, 60, 916–923. [Google Scholar] [CrossRef] [Scilit]
  31. Roland, B.L.; Sutton, S.W.; Wilson, S.J.; Luo, L.; Pyati, J.; Huvar, R.; Erlander, M.G.; Lovenberg, T.W. Anatomical distribution of prolactin-releasing peptide and its receptor suggests additional functions in the central nervous system and periphery. Endocrinology 1999, 140, 5736–5745. [Google Scholar] [CrossRef]
  32. Engstrom, M.; Brandt, A.; Wurster, S.; Savola, J.M.; Panula, P. Prolactin releasing peptide has high affinity and efficacy at neuropeptide FF2 receptors. J. Pharmacol. Exp. Ther. 2003, 305, 825–832. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Elshourbagy, N.A.; Ames, R.S.; Fitzgerald, L.R.; Foley, J.J.; Chambers, J.K.; Szekeres, P.G.; Evans, N.A.; Schmidt, D.B.; Buckley, P.T.; Dytko, G.M.; et al. Receptor for the pain modulatory neuropeptides FF and AF is an orphan G protein-coupled receptor. J. Biol. Chem. 2000, 275, 25965–25971. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Bonini, J.A.; Jones, K.A.; Adham, N.; Forray, C.; Artymyshyn, R.; Durkin, M.M.; Smith, K.E.; Tamm, J.A.; Boteju, L.W.; Lakhlani, P.P.; et al. Identification and characterization of two G protein-coupled receptors for neuropeptide FF. J. Biol. Chem. 2000, 275, 39324–39331. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Fujii, R.; Fukusumi, S.; Hosoya, M.; Kawamata, Y.; Habata, Y.; Hinuma, S.; Sekiguchi, M.; Kitada, C.; Kurokawa, T.; Nishimura, O.; et al. Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor. Regul. Pept. 1999, 83, 1–10. [Google Scholar] [CrossRef] [Scilit]
  36. Morales, T.; Hinuma, S.; Sawchenko, P.E. Prolactin-releasing peptide is expressed in afferents to the endocrine hypothalamus, but not in neurosecretory neurones. J. Neuroendocrinol. 2000, 12, 131–140. [Google Scholar] [CrossRef] [Scilit]
  37. Matsumoto, H.; Murakami, Y.; Horikoshi, Y.; Noguchi, J.; Habata, Y.; Kitada, C.; Hinuma, S.; Onda, H.; Fujino, M. Distribution and characterization of immunoreactive prolactin-releasing peptide (PrRP) in rat tissue and plasma. Biochem. Biophys. Res. Commun. 1999, 257, 264–268. [Google Scholar] [CrossRef] [Scilit]
  38. Maruyama, M.; Matsumoto, H.; Fujiwara, K.; Kitada, C.; Hinuma, S.; Onda, H.; Fujino, M.; Inoue, K. Immunocytochemical localization of prolactin-releasing peptide in the rat brain. Endocrinology 1999, 140, 2326–2333. [Google Scholar] [CrossRef]
  39. Nieminen, M.L.; Brandt, A.; Pietila, P.; Panula, P. Expression of mammalian RF-amide peptides neuropeptide FF (NPFF), prolactin-releasing peptide (PrRP) and the PrRP receptor in the peripheral tissues of the rat. Peptides 2000, 21, 1695–1701. [Google Scholar] [CrossRef] [Scilit]
  40. Reis, F.M.; Vigano, P.; Arnaboldi, E.; Spritzer, P.M.; Petraglia, F.; Di Blasio, A.M. Expression of prolactin-releasing peptide and its receptor in the human decidua. Mol. Hum. Reprod. 2002, 8, 356–362. [Google Scholar] [CrossRef] [Scilit]
  41. Sakamoto, T.; Amano, M.; Hyodo, S.; Moriyama, S.; Takahashi, A.; Kawauchi, H.; Ando, M. Expression of prolactin-releasing peptide and prolactin in the euryhaline mudskippers (Periophthalmus modestus): Prolactin-releasing peptide as a primary regulator of prolactin. J. Mol. Endocrinol. 2005, 34, 825–834. [Google Scholar] [CrossRef] [Scilit]
  42. Ibata, Y.; Iijima, N.; Kataoka, Y.; Kakihara, K.; Tanaka, M.; Hosoya, M.; Hinuma, S. Morphological survey of prolactin-releasing peptide and its receptor with special reference to their functional roles in the brain. Neurosci. Res. 2000, 38, 223–230. [Google Scholar] [CrossRef] [Scilit]
  43. Nieminen, M.L.; Nystedt, J.; Panula, P. Expression of neuropeptide FF, prolactin-releasing peptide, and the receptor UHR1/GPR10 genes during embryogenesis in the rat. Dev. Dyn. 2003, 226, 561–569. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Takahashi, K.; Totsune, K.; Murakami, O.; Sone, M.; Noshiro, T.; Hayashi, Y.; Sasano, H.; Shibahara, S. Expression of prolactin-releasing peptide and its receptor in the human adrenal glands and tumor tissues of adrenocortical tumors, pheochromocytomas and neuroblastomas. Peptides 2002, 23, 1135–1140. [Google Scholar] [CrossRef] [Scilit]
  45. Kimura, A.; Ohmichi, M.; Tasaka, K.; Kanda, Y.; Ikegami, H.; Hayakawa, J.; Hisamoto, K.; Morishige, K.; Hinuma, S.; Kurachi, H.; et al. Prolactin-releasing peptide activation of the prolactin promoter is differentially mediated by extracellular signal-regulated protein kinase and c-Jun N-terminal protein kinase. J. Biol. Chem. 2000, 275, 3667–3674. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Langmead, C.J.; Szekeres, P.G.; Chambers, J.K.; Ratcliffe, S.J.; Jones, D.N.; Hirst, W.D.; Price, G.W.; Herdon, H.J. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Br. J. Pharmacol. 2000, 131, 683–688. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Duval, D.L.; Gutierrez-Hartmann, A. PRL-releasing peptide stimulation of PRL gene transcription--enter AKT. Endocrinology 2002, 143, 11–12. [Google Scholar] [CrossRef] [PubMed]
  48. Hayakawa, J.; Ohmichi, M.; Tasaka, K.; Kanda, Y.; Adachi, K.; Nishio, Y.; Hisamoto, K.; Mabuchi, S.; Hinuma, S.; Murata, Y. Regulation of the PRL promoter by Akt through cAMP response element binding protein. Endocrinology 2002, 143, 13–22. [Google Scholar] [CrossRef]
  49. Nanmoku, T.; Takekoshi, K.; Fukuda, T.; Ishii, K.; Isobe, K.; Kawakami, Y. Stimulation of catecholamine biosynthesis via the PKC pathway by prolactin-releasing peptide in PC12 rat pheochromocytoma cells. J. Endocrinol. 2005, 186, 233–239. [Google Scholar] [CrossRef] [Scilit]
  50. Nanmoku, T.; Takekoshi, K.; Isobe, K.; Kawakami, Y.; Nakai, T.; Okuda, Y. Prolactin-releasing peptide stimulates catecholamine release but not proliferation in rat pheochromocytoma PC12 cells. Neurosci. Lett. 2003, 350, 33–36. [Google Scholar] [CrossRef] [Scilit]
  51. Samson, W.K.; Taylor, M.M. Prolactin releasing peptide (PrRP): An endogenous regulator of cell growth. Peptides 2006, 27, 1099–1103. [Google Scholar] [CrossRef] [Scilit]
  52. Tachibana, T.; Sakamoto, T. Functions of two distinct “prolactin-releasing peptides” evolved from a common ancestral gene. Front. Endocrinol. 2014, 5, 170. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Varghese, B.V.; Koohestani, F.; McWilliams, M.; Colvin, A.; Gunewardena, S.; Kinsey, W.H.; Nowak, R.A.; Nothnick, W.B.; Chennathukuzhi, V.M. Loss of the repressor REST in uterine fibroids promotes aberrant G protein-coupled receptor 10 expression and activates mammalian target of rapamycin pathway. Proc. Natl. Acad. Sci. USA 2013, 110, 2187–2192. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Maixnerova, J.; Spolcova, A.; Pychova, M.; Blechova, M.; Elbert, T.; Rezacova, M.; Zelezna, B.; Maletinska, L. Characterization of prolactin-releasing peptide: Binding, signaling and hormone secretion in rodent pituitary cell lines endogenously expressing its receptor. Peptides 2011, 32, 811–817. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Maletinska, L.; Nagelova, V.; Ticha, A.; Zemenova, J.; Pirnik, Z.; Holubova, M.; Spolcova, A.; Mikulaskova, B.; Blechova, M.; Sykora, D.; et al. Novel lipidized analogs of prolactin-releasing peptide have prolonged half-lives and exert anti-obesity effects after peripheral administration. Int. J. Obes. (Lond.) 2015, 39, 986–993. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Boyle, R.G.; Downham, R.; Ganguly, T.; Humphries, J.; Smith, J.; Travers, S. Structure-activity studies on prolactin-releasing peptide (PrRP). Analogues of PrRP-(19-31)-peptide. J. Pept. Sci. Off. Publ. Eur. Pept. Soc. 2005, 11, 161–165. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Deluca, S.H.; Rathmann, D.; Beck-Sickinger, A.G.; Meiler, J. The activity of prolactin releasing peptide correlates with its helicity. Biopolymers 2013, 99, 314–325. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Maletinska, L.; Spolcova, A.; Maixnerova, J.; Blechova, M.; Zelezna, B. Biological properties of prolactin-releasing peptide analogs with a modified aromatic ring of a C-terminal phenylalanine amide. Peptides 2011, 32, 1887–1892. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Quillet, R.; Ayachi, S.; Bihel, F.; Elhabazi, K.; Ilien, B.; Simonin, F. RF-amide neuropeptides and their receptors in Mammals: Pharmacological properties, drug development and main physiological functions. Pharmacol. Ther. 2016, 160, 84–132. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. D’Ursi, A.M.; Albrizio, S.; Di Fenza, A.; Crescenzi, O.; Carotenuto, A.; Picone, D.; Novellino, E.; Rovero, P. Structural studies on Hgr3 orphan receptor ligand prolactin-releasing peptide. J. Med. Chem. 2002, 45, 5483–5491. [Google Scholar] [CrossRef] [Scilit]
  61. Brasnjevic, I.; Steinbusch, H.W.; Schmitz, C.; Martinez-Martinez, P.; European NanoBioPharmaceutics Research, I. Delivery of peptide and protein drugs over the blood-brain barrier. Prog. Neurobiol. 2009, 87, 212–251. [Google Scholar] [CrossRef] [Scilit]
  62. Knudsen, L.B.; Nielsen, P.F.; Huusfeldt, P.O.; Johansen, N.L.; Madsen, K.; Pedersen, F.Z.; Thogersen, H.; Wilken, M.; Agerso, H. Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration. J. Med. Chem. 2000, 43, 1664–1669. [Google Scholar] [CrossRef] [Scilit]
  63. Gault, V.A.; Kerr, B.D.; Harriott, P.; Flatt, P.R. Administration of an acylated GLP-1 and GIP preparation provides added beneficial glucose-lowering and insulinotropic actions over single incretins in mice with Type 2 diabetes and obesity. Clin. Sci. (Lond.) 2011, 121, 107–117. [Google Scholar] [CrossRef] [Scilit]
  64. Kunes, J.; Prazienkova, V.; Popelova, A.; Mikulaskova, B.; Zemenova, J.; Maletinska, L. Prolactin-releasing peptide: A new tool for obesity treatment. J. Endocrinol. 2016, 230, R51–R58. [Google Scholar] [CrossRef] [Scilit]
  65. Prazienkova, V.; Ticha, A.; Blechova, M.; Spolcova, A.; Zelezna, B.; Maletinska, L. Pharmacological characterization of lipidized analogs of prolactin-releasing peptide with a modified C- terminal aromatic ring. J. Physiol. Pharmacol. Off. J. Pol. Physiol. Soc. 2016, 67, 121–128. [Google Scholar]
  66. Prazienkova, V.; Holubova, M.; Pelantova, H.; Buganova, M.; Pirnik, Z.; Mikulaskova, B.; Popelova, A.; Blechova, M.; Haluzik, M.; Zelezna, B.; et al. Impact of novel palmitoylated prolactin-releasing peptide analogs on metabolic changes in mice with diet-induced obesity. PLoS ONE 2017, 12, e0183449. [Google Scholar] [CrossRef] [Scilit]
  67. Pflimlin, E.; Lear, S.; Lee, C.; Yu, S.; Zou, H.; To, A.; Joseph, S.; Nguyen-Tran, V.; Tremblay, M.S.; Shen, W. Design of a Long-Acting and Selective MEG-Fatty Acid Stapled Prolactin-Releasing Peptide Analog. ACS Med. Chem. Lett. 2019, 10, 1166–1172. [Google Scholar] [CrossRef] [Scilit]
  68. Lawrence, C.B.; Liu, Y.L.; Stock, M.J.; Luckman, S.M. Anorectic actions of prolactin-releasing peptide are mediated by corticotropin-releasing hormone receptors. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2004, 286, R101–R107. [Google Scholar] [CrossRef] [Scilit]
  69. Arora, S.; Anubhuti. Role of neuropeptides in appetite regulation and obesity—A review. Neuropeptides 2006, 40, 375–401. [Google Scholar] [CrossRef] [Scilit]
  70. Sohn, J.W. Network of hypothalamic neurons that control appetite. BMB Rep. 2015, 48, 229–233. [Google Scholar] [CrossRef] [Scilit]
  71. Schwartz, M.W.; Woods, S.C.; Porte, D., Jr.; Seeley, R.J.; Baskin, D.G. Central nervous system control of food intake. Nature 2000, 404, 661–671. [Google Scholar] [CrossRef] [Scilit]
  72. Ellacott, K.L.; Lawrence, C.B.; Rothwell, N.J.; Luckman, S.M. PRL-releasing peptide interacts with leptin to reduce food intake and body weight. Endocrinology 2002, 143, 368–374. [Google Scholar] [CrossRef] [PubMed]
  73. Vergoni, A.V.; Watanobe, H.; Guidetti, G.; Savino, G.; Bertolini, A.; Schioth, H.B. Effect of repeated administration of prolactin releasing peptide on feeding behavior in rats. Brain Res. 2002, 955, 207–213. [Google Scholar] [CrossRef] [Scilit]
  74. Ellacott, K.L.; Lawrence, C.B.; Pritchard, L.E.; Luckman, S.M. Repeated administration of the anorectic factor prolactin-releasing peptide leads to tolerance to its effects on energy homeostasis. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2003, 285, R1005–R1010. [Google Scholar] [CrossRef] [Scilit]
  75. Gu, W.; Geddes, B.J.; Zhang, C.; Foley, K.P.; Stricker-Krongrad, A. The prolactin-releasing peptide receptor (GPR10) regulates body weight homeostasis in mice. J. Mol. Neurosci. 2004, 22, 93–103. [Google Scholar] [CrossRef] [Scilit]
  76. Bjursell, M.; Lenneras, M.; Goransson, M.; Elmgren, A.; Bohlooly, Y.M. GPR10 deficiency in mice results in altered energy expenditure and obesity. Biochem. Biophys. Res. Commun. 2007, 363, 633–638. [Google Scholar] [CrossRef] [Scilit]
  77. Bechtold, D.A.; Luckman, S.M. Prolactin-releasing Peptide mediates cholecystokinin-induced satiety in mice. Endocrinology 2006, 147, 4723–4729. [Google Scholar] [CrossRef] [Scilit]
  78. Mochiduki, A.; Takeda, T.; Kaga, S.; Inoue, K. Stress response of prolactin-releasing peptide knockout mice as to glucocorticoid secretion. J. Neuroendocrinol. 2010, 22, 576–584. [Google Scholar] [CrossRef] [Scilit]
  79. Matsumoto, H.; Maruyama, M.; Noguchi, J.; Horikoshi, Y.; Fujiwara, K.; Kitada, C.; Hinuma, S.; Onda, H.; Nishimura, O.; Inoue, K.; et al. Stimulation of corticotropin-releasing hormone-mediated adrenocorticotropin secretion by central administration of prolactin-releasing peptide in rats. Neurosci. Lett. 2000, 285, 234–238. [Google Scholar] [CrossRef] [Scilit]
  80. Mera, T.; Fujihara, H.; Kawasaki, M.; Hashimoto, H.; Saito, T.; Shibata, M.; Saito, J.; Oka, T.; Tsuji, S.; Onaka, T.; et al. Prolactin-releasing peptide is a potent mediator of stress responses in the brain through the hypothalamic paraventricular nucleus. Neuroscience 2006, 141, 1069–1086. [Google Scholar] [CrossRef] [Scilit]
  81. Seal, L.J.; Small, C.J.; Dhillo, W.S.; Kennedy, A.R.; Ghatei, M.A.; Bloom, S.R. Prolactin-releasing peptide releases corticotropin-releasing hormone and increases plasma adrenocorticotropin via the paraventricular nucleus of the hypothalamus. Neuroendocrinology 2002, 76, 70–78. [Google Scholar] [CrossRef] [Scilit]
  82. Kelly, S.P.; Peter, R.E. Prolactin-releasing peptide, food intake, and hydromineral balance in goldfish. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2006, 291, R1474–R1481. [Google Scholar] [CrossRef] [Scilit]
  83. Tachibana, T.; Saito, S.; Tomonaga, S.; Takagi, T.; Saito, E.S.; Nakanishi, T.; Koutoku, T.; Tsukada, A.; Ohkubo, T.; Boswell, T.; et al. Effect of central administration of prolactin-releasing peptide on feeding in chicks. Physiol. Behav. 2004, 80, 713–719. [Google Scholar] [CrossRef] [Scilit]
  84. Tachibana, T.; Tsukada, A.; Fujimoto, M.; Takahashi, H.; Ohkubo, T.; Boswell, T.; Furuse, M. Comparison of mammalian prolactin-releasing peptide and Carassius RFamide for feeding behavior and prolactin secretion in chicks. Gen. Comp. Endocrinol. 2005, 144, 264–269. [Google Scholar] [CrossRef] [Scilit]
  85. Pirnik, Z.; Zelezna, B.; Kiss, A.; Maletinska, L. Peripheral administration of palmitoylated prolactin-releasing peptide induces Fos expression in hypothalamic neurons involved in energy homeostasis in NMRI male mice. Brain Res. 2015, 1625, 151–158. [Google Scholar] [CrossRef] [Scilit]
  86. Mikulaskova, B.; Zemenova, J.; Pirnik, Z.; Prazienkova, V.; Bednarova, L.; Zelezna, B.; Maletinska, L.; Kunes, J. Effect of palmitoylated prolactin-releasing peptide on food intake and neural activation after different routes of peripheral administration in rats. Peptides 2016, 75, 109–117. [Google Scholar] [CrossRef] [Scilit]
  87. Pirnik, Z.; Kolesarova, M.; Zelezna, B.; Maletinska, L. Repeated peripheral administration of lipidized prolactin-releasing peptide analog induces c-fos and FosB expression in neurons of dorsomedial hypothalamic nucleus in male C57 mice. Neurochem. Int. 2018, 116, 77–84. [Google Scholar] [CrossRef] [Scilit]
  88. Holubova, M.; Zemenova, J.; Mikulaskova, B.; Panajotova, V.; Stohr, J.; Haluzik, M.; Kunes, J.; Zelezna, B.; Maletinska, L. Palmitoylated PrRP analog decreases body weight in rats with DIO but not in ZDF rats. J. Endocrinol. 2016. [Google Scholar] [CrossRef] [Scilit]
  89. Mikulaskova, B.; Holubova, M.; Prazienkova, V.; Zemenova, J.; Hruba, L.; Haluzik, M.; Zelezna, B.; Kunes, J.; Maletinska, L. Lipidized prolactin-releasing peptide improved glucose tolerance in metabolic syndrome: Koletsky and spontaneously hypertensive rat study. Nutr. Diabetes 2018, 8, 5. [Google Scholar] [CrossRef] [Scilit]
  90. Cermakova, M.; Pelantova, H.; Neprasova, B.; Sediva, B.; Maletinska, L.; Kunes, J.; Tomasova, P.; Zelezna, B.; Kuzma, M. Metabolomic Study of Obesity and Its Treatment with Palmitoylated Prolactin-Releasing Peptide Analog in Spontaneously Hypertensive and Normotensive Rats. J. Proteome Res. 2019, 18, 1735–1750. [Google Scholar] [CrossRef] [Scilit]
  91. Hassing, L.B.; Dahl, A.K.; Thorvaldsson, V.; Berg, S.; Gatz, M.; Pedersen, N.L.; Johansson, B. Overweight in midlife and risk of dementia: A 40-year follow-up study. Int. J. Obes. (Lond.) 2009, 33, 893–898. [Google Scholar] [CrossRef] [Scilit]
  92. Kadohara, K.; Sato, I.; Kawakami, K. Diabetes mellitus and risk of early-onset Alzheimer’s disease: A population-based case-control study. Eur. J. Neurol. 2017, 24, 944–949. [Google Scholar] [CrossRef] [Scilit]
  93. Serrano-Pozo, A.; Frosch, M.P.; Masliah, E.; Hyman, B.T. Neuropathological alterations in Alzheimer disease. Cold Spring Harb. Perspect. Med. 2011, 1, a006189. [Google Scholar] [CrossRef] [Scilit]
  94. Maletinska, L.; Popelova, A.; Zelezna, B.; Bencze, M.; Kunes, J. The impact of anorexigenic peptides in experimental models of Alzheimer’s disease pathology. J. Endocrinol. 2019, 240, R47–R72. [Google Scholar] [CrossRef] [Scilit]
  95. Prazienkova, V.; Schirmer, C.; Holubova, M.; Zelezna, B.; Kunes, J.; Galas, M.C.; Maletinska, L. Lipidized Prolactin-Releasing Peptide Agonist Attenuates Hypothermia-Induced Tau Hyperphosphorylation in Neurons. J. Alzheimers Dis. 2019, 67, 1187–1200. [Google Scholar] [CrossRef] [Scilit]
  96. Hirata, A.E.; Andrade, I.S.; Vaskevicius, P.; Dolnikoff, M.S. Monosodium glutamate (MSG)-obese rats develop glucose intolerance and insulin resistance to peripheral glucose uptake. Braz. J. Med Biol. Res. Rev. Bras. Pesqui. Med. Biol. Soc. Bras. Biofisica 1997, 30, 671–674. [Google Scholar] [CrossRef] [Scilit]
  97. Matyskova, R.; Maletinska, L.; Maixnerova, J.; Pirnik, Z.; Kiss, A.; Zelezna, B. Comparison of the obesity phenotypes related to monosodium glutamate effect on arcuate nucleus and/or the high fat diet feeding in C57BL/6 and NMRI mice. Physiol. Res. 2008, 57, 727–734. [Google Scholar]
  98. Jankowsky, J.L.; Slunt, H.H.; Ratovitski, T.; Jenkins, N.A.; Copeland, N.G.; Borchelt, D.R. Co-expression of multiple transgenes in mouse CNS: A comparison of strategies. Biomol. Eng. 2001, 17, 157–165. [Google Scholar] [CrossRef] [Scilit]
  99. Maniscalco, J.W.; Rinaman, L. Interoceptive modulation of neuroendocrine, emotional, and hypophagic responses to stress. Physiol. Behav. 2017, 176, 195–206. [Google Scholar] [CrossRef] [Scilit]
  100. Morales, T.; Sawchenko, P.E. Brainstem prolactin-releasing peptide neurons are sensitive to stress and lactation. Neuroscience 2003, 121, 771–778. [Google Scholar] [CrossRef] [Scilit]
  101. Card, J.P.; Johnson, A.L.; Llewellyn-Smith, I.J.; Zheng, H.; Anand, R.; Brierley, D.I.; Trapp, S.; Rinaman, L. GLP-1 neurons form a local synaptic circuit within the rodent nucleus of the solitary tract. J. Comp. Neurol. 2018, 526, 2149–2164. [Google Scholar] [CrossRef] [Scilit]
  102. Zhu, L.L.; Onaka, T. Facilitative role of prolactin-releasing peptide neurons in oxytocin cell activation after conditioned-fear stimuli. Neuroscience 2003, 118, 1045–1053. [Google Scholar] [CrossRef] [Scilit]
  103. Quillet, R.; Simonin, F. The neuropeptide FF: A signal for M1 to M2 type switching in macrophages from the adipose tissue. Med. Sci. (Paris) 2018, 34, 27–29. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. Ma, L.; MacTavish, D.; Simonin, F.; Bourguignon, J.J.; Watanabe, T.; Jhamandas, J.H. Prolactin-releasing peptide effects in the rat brain are mediated through the Neuropeptide FF receptor. Eur. J. Neurosci. 2009, 30, 1585–1593. [Google Scholar] [CrossRef] [Scilit]
  105. Lin, S.H.; Leslie, F.M.; Civelli, O. Neurochemical properties of the prolactin releasing peptide (PrRP) receptor expressing neurons: Evidence for a role of PrRP as a regulator of stress and nociception. Brain Res. 2002, 952, 15–30. [Google Scholar] [CrossRef] [Scilit]
  106. Laurent, P.; Becker, J.A.; Valverde, O.; Ledent, C.; de Kerchove d’Exaerde, A.; Schiffmann, S.N.; Maldonado, R.; Vassart, G.; Parmentier, M. The prolactin-releasing peptide antagonizes the opioid system through its receptor GPR10. Nat. Neurosci. 2005, 8, 1735–1741. [Google Scholar] [CrossRef] [Scilit]
  107. Fujiwara, K.; Matsumoto, H.; Yada, T.; Inoue, K. Identification of the prolactin-releasing peptide-producing cell in the rat adrenal gland. Regul. Pept. 2005, 126, 97–102. [Google Scholar] [CrossRef] [Scilit]
  108. Feng, Y.; Zhao, H.; An, X.F.; Ma, S.L.; Chen, B.Y. Expression of brain prolactin releasing peptide (PrRP) changes in the estrous cycle of female rats. Neurosci. Lett. 2007, 419, 38–42. [Google Scholar] [CrossRef] [Scilit]
  109. Maruyama, M.; Matsumoto, H.; Fujiwara, K.; Noguchi, J.; Kitada, C.; Hinuma, S.; Onda, H.; Nishimura, O.; Fujino, M.; Higuchi, T.; et al. Central administration of prolactin-releasing peptide stimulates oxytocin release in rats. Neurosci. Lett. 1999, 276, 193–196. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Distribution of PrRP and GPR10. Ellipses represent distinct brain areas (blue—nucleus accumbens, grey—corpus callosum, green—hippocampus, red—thalamus, orange—hypothalamus, yellow—pituitary, violet—parabrachial nucleus, light green—medulla oblongata). Stars mark the expression of mRNA (red star—PrRP, black star—GPR10). Spots represent the distribution of PrRP (red), GPR10 (black) cell bodies and fibers. AP: area postrema, C: cerebral cortex, CC: corpus callosum, CE: cerebellum, DMN: dorsomedial hypothalamic nucleus, HB: hindbrain, HIPP: hippocampus, HYP: hypothalamus, LHA: lateral hypothalamic area, ME: medulla oblongata, MIB: midbrain, NAc: nucleus accumbens, NTS: nucleus of the solitary tract, OF: olfactory bulb, P: pituitary, PB: parabrachial nucleus, PEVN: periventricular hypothalamic nucleus, PVN: paraventricular hypothalamic nucleus, RT: reticular nucleus of the thalamus, SON: supraoptic nucleus, SLM: stratum lacunosum-moleculare, TH: thalamus, VMN: ventromedial hypothalamic nucleus, VRT: ventrolateral reticular nucleus of the thalamus.
Figure 1. Distribution of PrRP and GPR10. Ellipses represent distinct brain areas (blue—nucleus accumbens, grey—corpus callosum, green—hippocampus, red—thalamus, orange—hypothalamus, yellow—pituitary, violet—parabrachial nucleus, light green—medulla oblongata). Stars mark the expression of mRNA (red star—PrRP, black star—GPR10). Spots represent the distribution of PrRP (red), GPR10 (black) cell bodies and fibers. AP: area postrema, C: cerebral cortex, CC: corpus callosum, CE: cerebellum, DMN: dorsomedial hypothalamic nucleus, HB: hindbrain, HIPP: hippocampus, HYP: hypothalamus, LHA: lateral hypothalamic area, ME: medulla oblongata, MIB: midbrain, NAc: nucleus accumbens, NTS: nucleus of the solitary tract, OF: olfactory bulb, P: pituitary, PB: parabrachial nucleus, PEVN: periventricular hypothalamic nucleus, PVN: paraventricular hypothalamic nucleus, RT: reticular nucleus of the thalamus, SON: supraoptic nucleus, SLM: stratum lacunosum-moleculare, TH: thalamus, VMN: ventromedial hypothalamic nucleus, VRT: ventrolateral reticular nucleus of the thalamus.
Ijms 20 05297 g001
Figure 2. PrRP physiological functions and signaling—summary. PrRP and its agonist exerts its effect through GPR10. Blue arrow represents activation of the signaling pathway, T-bar represents blocking of the signaling pathway. PrRP stimulated calcium release (Ca2+) in calcium mobilization assay and rapidly activated extracellular signal-regulated protein kinase (ERK – blue). It also activated c-Jun N-terminal protein kinase (JNK—light blue) and phosphorylated cAMP response element-binding protein (CREB—grey). Pertussis toxin (PTX—black) blocked the ERK and Akt activation induced by PrRP. PrRP activated the PI3K B/Akt-mammalian target of rapamycin (PI3K-Akt-mTOR) pathways in leiomyoma cells (PI3K—pink, PKB/Akt—green,.mTOR—yellow). PrRP significantly stimulated both the PKA (dark green) and PKC (orange) pathways.
Figure 2. PrRP physiological functions and signaling—summary. PrRP and its agonist exerts its effect through GPR10. Blue arrow represents activation of the signaling pathway, T-bar represents blocking of the signaling pathway. PrRP stimulated calcium release (Ca2+) in calcium mobilization assay and rapidly activated extracellular signal-regulated protein kinase (ERK – blue). It also activated c-Jun N-terminal protein kinase (JNK—light blue) and phosphorylated cAMP response element-binding protein (CREB—grey). Pertussis toxin (PTX—black) blocked the ERK and Akt activation induced by PrRP. PrRP activated the PI3K B/Akt-mammalian target of rapamycin (PI3K-Akt-mTOR) pathways in leiomyoma cells (PI3K—pink, PKB/Akt—green,.mTOR—yellow). PrRP significantly stimulated both the PKA (dark green) and PKC (orange) pathways.
Ijms 20 05297 g002
Figure 3. Structure of PrRP20 and PrRP31 and its analogs [31,55,56,58,65,67]. Blue amino acid Ser1 marks the beginning of PrRP31 from the N-terminus. Blue amino acid Thr12 marks the beginning of shorter isoform PrRP20 (also known as PrRP(12–31)). Blue amino acid Trp19 marks tridecapeptide PrRP(19–31) and blue Ile25 marks the shortest fragment heptapeptide PrRP(25–31). Green amide group NH2 and green Arg23, Arg26, Arg30, and Phe31 amino acids are essential for the functionality of the peptide. Light grey amino acids mark changes of amino acids that preserved good functional activity. Dark grey Arg11 could be substituted by Lys11 and its secondary amino group, fatty acids, were attached through different linkers. γ-E: γ-glutamic acid, MEG-FA: multiple ethylene glycol-fatty acid (four ethylene glycol units attached to octadecanedioic acid via lysine linker incorporating carboxylated moiety), PheCl2: (3,4-dichlor)phenylalanine, PheNO2: (4-nitro)phenylalanine, PheF5: pentafluoro-phenylalanine, 1-Nal, 2-Nal: napthylalanine, Phg: phenylglycine, TTDS: short chain of polyethylene glycol (1,13-diamino-4,7,10-trioxadecan-succinamic acid).
Figure 3. Structure of PrRP20 and PrRP31 and its analogs [31,55,56,58,65,67]. Blue amino acid Ser1 marks the beginning of PrRP31 from the N-terminus. Blue amino acid Thr12 marks the beginning of shorter isoform PrRP20 (also known as PrRP(12–31)). Blue amino acid Trp19 marks tridecapeptide PrRP(19–31) and blue Ile25 marks the shortest fragment heptapeptide PrRP(25–31). Green amide group NH2 and green Arg23, Arg26, Arg30, and Phe31 amino acids are essential for the functionality of the peptide. Light grey amino acids mark changes of amino acids that preserved good functional activity. Dark grey Arg11 could be substituted by Lys11 and its secondary amino group, fatty acids, were attached through different linkers. γ-E: γ-glutamic acid, MEG-FA: multiple ethylene glycol-fatty acid (four ethylene glycol units attached to octadecanedioic acid via lysine linker incorporating carboxylated moiety), PheCl2: (3,4-dichlor)phenylalanine, PheNO2: (4-nitro)phenylalanine, PheF5: pentafluoro-phenylalanine, 1-Nal, 2-Nal: napthylalanine, Phg: phenylglycine, TTDS: short chain of polyethylene glycol (1,13-diamino-4,7,10-trioxadecan-succinamic acid).
Ijms 20 05297 g003
Table 1. Sequences of prolactin-releasing peptide (PrRP): PrRP20 and PrRP31 in different animal species [1,4,7].
Table 1. Sequences of prolactin-releasing peptide (PrRP): PrRP20 and PrRP31 in different animal species [1,4,7].
PeptideSpeciesSequence
PrRP20carp SPEIDPFWYVGRGVRPIGRF-NH2
chicken SPEIDPFWYVGRGVRPIGRF-NH2
rat TPDINPAWYTGRGIRPVGRF-NH2
bovine TPDINPAWYAGRGIRPVGRF-NH2
human TPDINPAWYASRGIRPVGRF-NH2
PrRP31carpGTTVEHDLHIVHNVDNRSPEIDPFWYVGRGVRPIGRF-NH2
chicken SRPFKHQIDNRSPEIDPFWYVGRGVRPIGRF-NH2
rat SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
bovine SRAHRHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
human SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Grey color marks same amino acids.

Share and Cite

MDPI and ACS Style

Pražienková, V.; Popelová, A.; Kuneš, J.; Maletínská, L. Prolactin-Releasing Peptide: Physiological and Pharmacological Properties. Int. J. Mol. Sci. 2019, 20, 5297. https://doi.org/10.3390/ijms20215297

AMA Style

Pražienková V, Popelová A, Kuneš J, Maletínská L. Prolactin-Releasing Peptide: Physiological and Pharmacological Properties. International Journal of Molecular Sciences. 2019; 20(21):5297. https://doi.org/10.3390/ijms20215297

Chicago/Turabian Style

Pražienková, Veronika, Andrea Popelová, Jaroslav Kuneš, and Lenka Maletínská. 2019. "Prolactin-Releasing Peptide: Physiological and Pharmacological Properties" International Journal of Molecular Sciences 20, no. 21: 5297. https://doi.org/10.3390/ijms20215297

APA Style

Pražienková, V., Popelová, A., Kuneš, J., & Maletínská, L. (2019). Prolactin-Releasing Peptide: Physiological and Pharmacological Properties. International Journal of Molecular Sciences, 20(21), 5297. https://doi.org/10.3390/ijms20215297

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop