Genome-Wide Identification, Classification, and Expression Analysis of the Hsf Gene Family in Carnation (Dianthus caryophyllus)
Abstract
:1. Introduction
2. Results
2.1. Identification of DcaHsfs in Carnation
2.2. Phylogenetic and Sequence Conservation Analysis of DcaHsfs
2.3. Structural and Motif Analysis of DcaHsfs
2.4. Cis-Acting Element Analysis in the Promoters of DcaHsfs
2.5. The Expression Pattern of DcaHsfs in Different Tissues and Flower Development
2.6. DcaHsfs Response to Various Stresses
3. Discussion
3.1. Characterization of the Carnation Hsf Genes Family
3.2. Cis-Element Analysis in the Promoters of DcaHsfs
3.3. Structural Analysis of DcaHsfs
3.4. DcaHsfs Involvement in Carnation Development Processes
3.5. DcaHsfs are Involved in Carnation Stress Response
4. Materials and Methods
4.1. Identification and Characterization of Hsf Genes in D. caryophyllus
4.2. Phylogenetic Analysis
4.3. Structural and Motif Analyses of DcaHsf Genes
4.4. Cis-acting Element Analysis of DcaHsfs
4.5. Plant Materials, Growth Conditions, and Stress Treatments
4.6. RNA Isolation and Expression Analysis of DcaHsf Genes
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Conflicts of Interest
Abbreviations
ABA | Abscisic acid |
ABRE | ABA-responsive element |
APX | Ascorbate peroxidase |
CA | Calyx |
CAT | Catalase |
DBD | DNA-binding domains |
ERE | Ethylene-responsive element |
F | Flower |
FS | Flowering stages |
HSE | Heat shock element |
Hsf | Heat shock transcription factor |
MEME | Multiple Em for Motif Elicitation |
ML | Mature leaf |
MW | Molecular weight |
NES | Nuclear export signals |
NLS | Nuclear localization signals |
OV | Ovary |
PEG | Polyethylene glycol |
qRT-PCR | Quantitative real-time PCR |
R | Root |
RD | Repressor domains |
ROS | Reactive oxygen species |
S | Stem |
SA | Salicylic acid |
ST | Stigma |
TFs | Transcription factors |
YL | Young leaf |
References
- Hu, H.; Xiong, L. Genetic engineering and breeding of drought-resistant crops. Annu. Rev. Plant Biol. 2014, 65, 715–741. [Google Scholar] [CrossRef] [PubMed]
- Pereira, A. Plant abiotic stress challenges from the changing environment. Front. Plant Sci. 2016, 7, 1123. [Google Scholar] [CrossRef] [PubMed]
- Zhu, J.K. Abiotic stress signaling and responses in plants. Cell 2016, 167, 313–324. [Google Scholar] [CrossRef] [PubMed]
- Ohama, N.; Sato, H.; Shinozaki, K.; Yamaguchi-Shinozaki, K. Transcriptional regulatory network of plant heat stress response. Trends Plant Sci. 2017, 22, 53–65. [Google Scholar] [CrossRef]
- Rushton, P.J.; Somssich, I.E.; Ringler, P.; Shen, Q.J. WRKY transcription factors. Trends Plant Sci. 2010, 15, 247–258. [Google Scholar] [CrossRef]
- Puranik, S.; Sahu, P.P.; Srivastava, P.S.; Prasad, M. NAC proteins: Regulation and role in stress tolerance. Trends Plant Sci. 2012, 17, 369–381. [Google Scholar] [CrossRef]
- Scharf, K.D.; Berberich, T.; Ebersberger, I.; Nover, L. The plant heat stress transcription factor (Hsf) family: Structure, function and evolution. Biochim. Biophys. Acta Gene Regul. Mech. 2012, 1819, 104–119. [Google Scholar] [CrossRef]
- Kotak, S.; Larkindale, J.; Lee, U.; Koskull-Döring, P.V.; Vierling, E.; Scharf, K.D. Complexity of the heat stress response in plants. Curr. Opin. Plant Biol. 2007, 10, 310–316. [Google Scholar] [CrossRef]
- Swindell, W.R.; Huebner, M.; Weber, A.P. Transcriptional profiling of Arabidopsis heat shock proteins and transcription factors reveals extensive overlap between heat and non-heat stress response pathways. BMC Genom. 2007, 8, 125. [Google Scholar] [CrossRef]
- Wei, Y.X.; Hu, W.; Xia, F.Y.; Zeng, H.Q.; Li, X.L.; Yan, Y.; He, C.Z.; Shi, H.T. Heat shock transcription factors in banana: Genome-wide characterization and expression profile analysis during development and stress response. Sci. Rep. 2016, 6, 36864. [Google Scholar] [CrossRef]
- Zhang, J.; Jia, H.X.; Li, J.B.; Li, Y.; Lu, M.Z.; Hu, J.J. Molecular evolution and expression divergence of the Populus euphratica Hsf genes provide insight into the stress acclimation of desert poplar. Sci. Rep. 2016, 6, 30050. [Google Scholar] [CrossRef] [PubMed]
- Chidambaranathan, P.; Jagannadham, P.T.K.; Satheesh, V.; Kohli, D.; Basavarajappa, S.H.; Chellapilla, B.; Kumar, J.; Jain, P.K.; Srinivasan, R. Genome-wide analysis identifies chickpea (Cicer arietinum) heat stress transcription factors (Hsfs) responsive to heat stress at the pod development stage. J. Plant Res. 2017, 131, 525–542. [Google Scholar] [CrossRef] [PubMed]
- Guo, M.; Liu, J.H.; Ma, X.; Luo, D.X.; Gong, Z.H.; Lu, M.H. The plant Heat Stress Transcription Factors (HSFs): Structure, regulation, and gunction in response to abiotic stresses. Front. Plant Sci. 2016, 7, 114. [Google Scholar] [CrossRef] [PubMed]
- Koskull-DöRing, P.V.; Scharf, K.D.; Nover, L. The diversity of plant heat stress transcription factors. Trends Plant Sci. 2007, 12, 452–457. [Google Scholar] [CrossRef]
- Singh, A.; Mittal, D.; Lavania, D.; Agarwal, M.; Mishra, R.C.; Grover, A. OsHsfA2c and OsHsfB4b are involved in the transcriptional regulation of cytoplasmic OsClpB (Hsp100) gene in rice (Oryza sativa L.). Cell Stress Chaperones 2012, 17, 243–254. [Google Scholar] [CrossRef]
- Cheng, Q.; Zhou, Y.; Liu, Z.; Zhang, L.; Song, G.; Guo, Z.; Wang, W.; Qu, X.; Zhu, Y.; Yang, D. An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice. Plant Biol. 2015, 17, 419–429. [Google Scholar] [CrossRef]
- Giesguth, M.; Sahm, A.; Simon, S.; Dietz, K.J. Redox-dependent translocation of the heat shock transcription factor AtHSFA8 from the cytosol to the nucleus in Arabidopsis thaliana. FEBS Lett. 2015, 589, 718–725. [Google Scholar] [CrossRef]
- Guo, J.K.; Wu, J.; Ji, Q.; Wang, C.; Luo, L.; Yuan, Y.; Wang, Y.H.; Wang, J. Genome-wide analysis of heat shock transcription factor families in rice and Arabidopsis. J. Genet. Genom. 2008, 35, 105–118. [Google Scholar] [CrossRef]
- Wang, F.M.; Dong, Q.; Jiang, H.Y.; Zhu, S.W.; Chen, B.J.; Xiang, Y. Genome-wide analysis of the heat shock transcription factors in Populus trichocarpa and Medicago truncatula. Mol. Biol. Rep. 2012, 39, 1877–1886. [Google Scholar] [CrossRef]
- Chung, E.; Kim, K.M.; Lee, J.H. Genome-wide analysis and molecular characterization of heat shock transcription factor family in Glycine max. J. Genet. Genom. 2013, 40, 127–135. [Google Scholar] [CrossRef]
- Lin, Y.X.; Jiang, H.Y.; Chu, Z.X.; Tang, X.L.; Zhu, S.W.; Cheng, B.J. Genome-wide identification, classification and analysis of heat shock transcription factor family in maize. BMC Genom. 2011, 12, 76. [Google Scholar] [CrossRef] [PubMed]
- Giorno, F.; Guerriero, G.; Baric, S.; Mariani, C. Heat shock transcriptional factors in Malus domestica: Identification, classification and expression analysis. BMC Genom. 2012, 13, 639. [Google Scholar] [CrossRef] [PubMed]
- Zhou, S.J.; Zhang, P.; Jing, Z.; Shi, J.L. Genome-wide identification and analysis of heat shock transcription factor family in cucumber (Cucumis sativus L.). Plant Omics 2013, 6, 449–455. [Google Scholar]
- Zhang, J.; Liu, B.B.; Li, J.B.; Zhang, L.; Wang, Y.; Zheng, H.Q.; Lu, M.Z.; Chen, J. Hsf and Hsp gene families in Populus: Genome-wide identification, organization and correlated expression during development and in stress responses. BMC Genom. 2015, 16, 181. [Google Scholar] [CrossRef]
- Wang, J.; Sun, N.; Deng, T.; Zhang, L.D.; Zuo, K.J. Genome-wide cloning, identification, classification and functional analysis of cotton heat shock transcription factors in cotton (Gossypium hirsutum). BMC Genom. 2014, 15, 961. [Google Scholar] [CrossRef]
- Xue, G.P.; Sadat, S.; Drenth, J.; Mcintyre, C.L. The heat shock factor family from Triticum aestivum in response to heat and other major abiotic stresses and their role in regulation of heat shock protein genes. J. Exp. Bot. 2014, 65, 539–557. [Google Scholar] [CrossRef]
- Zhu, X.Y.; Huang, C.Q.; Zhang, L.; Liu, H.F.; Yu, J.H.; Hu, Z.Y.; Hua, W. Systematic analysis of Hsf family genes in the Brassica napus genome reveals novel responses to heat, drought and high CO2 stresses. Front. Plant Sci. 2017, 8, 1174. [Google Scholar] [CrossRef]
- Boxriker, M.; Boehm, R.; Krezdorn, N.; Rotter, B.; Piepho, H.P. Comparative transcriptome analysis of vase life and carnation type in Dianthus caryophyllus L. Sci. Hortic. 2017, 217, 61–72. [Google Scholar] [CrossRef]
- Onozaki, T.; Ikeda, H.; Yamaguchi, T. Genetic improvement of vase life of carnation flowers by crossing and selection. Sci. Hortic. 2001, 87, 107–120. [Google Scholar] [CrossRef]
- Muneer, S.; Soundararajan, P.; Jeong, B.R. Proteomic and antioxidant analysis elucidates the underlying mechanism of tolerance to hyperhydricity stress in in vitro shoot cultures of Dianthus caryophyllus. J. Plant Growth Regul. 2016, 35, 667–679. [Google Scholar] [CrossRef]
- Yagi, M.; Kosugi, S.; Hirakawa, H.; Ohmiya, A.; Tanase, K.; Harada, T.; Kishimoto, K.; Nakayama, M.; Ichimura, K.; Onozaki, T.; et al. Sequence analysis of the genome of carnation (Dianthus caryophyllus L.). DNA Res. 2013, 21, 231–241. [Google Scholar] [CrossRef] [PubMed]
- Zhang, J.; Li, Y.; Jia, H.X.; Li, J.B.; Huang, J.; Lu, M.Z.; Hu, J.J. The heat shock factor gene family in Salix suchowensis: A genome-wide survey and expression profiling during development and abiotic stresses. Front. Plant Sci. 2015, 6, 748. [Google Scholar] [CrossRef] [PubMed]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; de Peer, Y.V.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef] [PubMed]
- He, Y.; Li, W.; Lv, J.; Jia, Y.B.; Wang, M.C.; Xia, G.M. Ectopic expression of a wheat MYB transcription factor gene, TaMYB73, improves salinity stress tolerance in Arabidopsis thaliana. J. Exp. Bot. 2012, 63, 1511–1522. [Google Scholar] [CrossRef] [PubMed]
- Rose, A.B. Intron-mediated regulation of gene expression. Curr. Top. Microbiol. Immunol. 2008, 326, 277–290. [Google Scholar] [PubMed]
- Pelham, H.R.; Bienz, M. A synthetic heat-shock promoter element confers heat-inducibility on the herpes simplex virus thymidine kinase gene. EMBO J. 1981, 1, 1473–1477. [Google Scholar] [CrossRef]
- Tang, R.M.; Zhu, W.J.; Song, X.Y.; Lin, X.Y.; Cai, J.H.; Man, W.; Yang, Q. Genome-wide identification and function analyses of heat shock transcription factors in potato. Front. Plant Sci. 2016, 7, 490. [Google Scholar] [CrossRef]
- Xie, L.H.; Li, X.Y.; Hou, D.; Cheng, Z.C.; Liu, J.; Li, J.; Mu, S.H.; Gao, J. Genome-wide analysis and expression profiling of the heat shock factor gene family in Phyllostachys edulis during development and in response to abiotic stresses. Forests 2019, 10, 100. [Google Scholar] [CrossRef]
- Fragkostefanakis, S.; Röth, S.; Schleiff, E.; Scharf, K.D. Prospects of engineering thermotolerance in crops through modulation of heat stress transcription factor and heat shock protein networks. Plant Cell Environ. 2015, 38, 1881–1895. [Google Scholar] [CrossRef]
- Liu, B.; Hu, J.; Zhang, J. Evolutionary divergence of duplicated Hsf genes in Populus. Cells 2019, 8, 438. [Google Scholar] [CrossRef]
- Hu, Y.; Han, Y.T.; Zhang, K.; Zhao, F.L.; Li, Y.J.; Zheng, Y.; Wang, Y.J.; Wen, Y.Q. Identification and expression analysis of heat shock transcription factors in the wild Chinese grapevine (Vitis pseudoreticulata). Plant Physiol. Biochem. 2016, 99, 1–10. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.S.; Jiang, J.; Han, X.J.; Zhang, Y.X.; Zhuo, R.Y. Identification, expression analysis of the Hsf family, and characterization of class A4 in Sedum Alfredii Hance under cadmium stress. Int. J. Mol. Sci. 2018, 19, 1216. [Google Scholar] [CrossRef] [PubMed]
- Mittal, D.; Chakrabarti, S.; Sarkar, A.; Singh, A.; Grover, A. Heat shock factor gene family in rice: Genomic organization and transcript expression profiling in response to high temperature, low temperature and oxidative stresses. Plant Physiol. Biochem. 2009, 47, 785–795. [Google Scholar] [CrossRef] [PubMed]
- Dossa, K.; Diouf, D.; Cisse, N. Genome-wide investigation of Hsf genes in sesame reveals their segmental duplication expansion and their active role in drought stress response. Front. Plant Sci. 2016, 7, 1522. [Google Scholar] [CrossRef]
- Ikeda, M.; Mitsuda, N.; Ohme-Takagi, M. Arabidopsis HsfB1 and HsfB2b act as repressors of the expression of heat-inducible Hsfs but positively regulate the acquired thermotolerance. Plant Physiol. 2011, 157, 1243–1254. [Google Scholar] [CrossRef]
- Li, Z.J.; Zhang, L.L.; Wang, A.X.; Xu, X.Y.; Li, J.F. Ectopic overexpression of SlHsfA3, a heat stress transcription factor from tomato, confers increased thermotolerance and salt hypersensitivity in germination in transgenic Arabidopsis. PLoS ONE 2013, 8, e54880. [Google Scholar] [CrossRef]
- Yamanouchi, U.; Yano, M.; Lin, H.X.; Ashikari, M.; Yamada, K. A rice spotted leaf gene, Spl7, encodes a heat stress transcription factor protein. Proc. Natl. Acad. Sci. USA 2002, 99, 7530–7535. [Google Scholar] [CrossRef]
- Baniwal, S.K.; Chan, K.Y.; Scharf, K.D.; Nover, L. Role of heat stress transcription factor HsfA5 as specific repressor of HsfA4. J. Biol. Chem. 2007, 282, 3605–3613. [Google Scholar] [CrossRef]
- Hu, Y.; Han, Y.T.; Wei, W.; Li, Y.J.; Zhang, K.; Gao, Y.R.; Zhao, F.L.; Feng, J.Y. Identification, isolation, and expression analysis of heat shock transcription factors in the diploid woodland strawberry Fragaria vesca. Front. Plant Sci. 2015, 6, 736. [Google Scholar] [CrossRef]
- Schramm, F.; Ganguli, A.; Kiehlmann, E.; Englich, G.; Walch, D.; Koskull-Döring, P.V. The heat stress transcription factor HsfA2 serves as a regulatory amplifier of a subset of genes in the heat stress response in Arabidopsis. Plant Mol. Biol. 2006, 60, 759–772. [Google Scholar] [CrossRef]
- Pick, T.; Jaskiewicz, M.; Peterhänsel, C.; Conrath, U. Heat shock factor HsfB1 primes gene transcription and systemic acquired resistance in Arabidopsis. Plant Physiol. 2012, 159, 52–55. [Google Scholar] [CrossRef] [PubMed]
- Schmidt, R.; Schippers, J.H.M.; Welker, A.; Mieulet, D.; Guiderdoni, E.; Mueller-Roeber, B. Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica. AoB Plants 2012, 2012, pls011. [Google Scholar] [CrossRef] [PubMed]
- Livak, K.J.; Schmittgenb, T.D. Analysis of relative gene expression data using real-time quantitative PCR and the 2−ΔΔCT Method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef] [PubMed]
Protein Name | Gene ID | Subfamily | Size | I.I. | Stability | A.I. | n.c.r. (%) | p.c.r.(%) | GRAVY | pI | MW (kDa) |
---|---|---|---|---|---|---|---|---|---|---|---|
DcaHsf-A1 | Dca57201.1 | A1 | 488 | 55.97 | U | 66.72 | 69 | 47 | −0.690 | 4.74 | 54.49 |
DcaHsf-A2a | Dca14360.1 | A2 | 380 | 59.24 | U | 83.55 | 59 | 45 | −0.503 | 5.12 | 42.96 |
DcaHsf-A2b | Dca52568.1 | A2 | 359 | 58.97 | U | 80.03 | 57 | 43 | −0.548 | 5.05 | 40.55 |
DcaHsf-A3 | Dca41810.1 | A3 | 244 | 64.58 | U | 67.33 | 67 | 50 | −0.566 | 4.98 | 51.75 |
DcaHsf-A4 | Dca23163.1 | A4 | 390 | 47.75 | U | 71.95 | 59 | 47 | −0.859 | 5.7 | 44.99 |
DcaHsf-A5 | Dca19769.1 | A5 | 489 | 48.53 | U | 72.17 | 67 | 52 | −0.745 | 5.45 | 54.52 |
DcaHsf-A7 | Dca4574.1 | A7 | 425 | 48.11 | U | 67.36 | 63 | 61 | −0.771 | 6.72 | 48.91 |
DcaHsf-A9a | Dca9629.1 | A9 | 401 | 47.92 | U | 69.73 | 67 | 46 | −0.691 | 5 | 46.12 |
DcaHsf-A9b | Dca41703.1 | A9 | 331 | 36.63 | S | 69.43 | 45 | 44 | −0.805 | 6.23 | 38.21 |
DcaHsf-B1 | Dca60410.1 | B1 | 276 | 34.47 | S | 68.77 | 38 | 39 | −0.804 | 7.61 | 31.0 |
DcaHsf-B2a | Dca22545.1 | B2 | 337 | 54.72 | U | 61.64 | 35 | 29 | −0.721 | 6 | 36.48 |
DcaHsf-B2b | Dca48996.1 | B2 | 337 | 60.89 | U | 60.98 | 39 | 32 | −0.709 | 6 | 36.48 |
DcaHsf-B2c | Dca54105.1 | B2 | 318 | 61.35 | U | 68.57 | 33 | 32 | −0.592 | 5.91 | 33.80 |
DcaHsf-B3a | Dca44175.1 | B3 | 244 | 48.80 | U | 70.33 | 31 | 37 | −0.763 | 8.88 | 28.38 |
DcaHsf-B3b | Dca48010.1 | B3 | 457 | 48.40 | U | 68.96 | 31 | 37 | −0.784 | 8.88 | 28.33 |
DcaHsf-B4 | Dca39623.1 | B4 | 287 | 54.07 | U | 72.30 | 30 | 32 | −0.874 | 8.52 | 33.72 |
DcaHsf-C1 (incomplete) | Dca24054.1 | C1 | 133 | 58.77 | U | 76.24 | 21 | 22 | −0.881 | 8.01 | 15.89 |
Motif | E-Value | Width | Best Possible Match |
---|---|---|---|
Motif1 | 2.70 × 10−426 | 41 | VWDPAEFARDLLPRYFKHNNFSSFVRQLNTYGFRKVVPDRW |
Motif2 | 5.20 × 10−225 | 29 | PFLTKTYDMVDDPSTDDIVSWSEDGTSFV |
Motif3 | 1.10 × 10−187 | 29 | EFANEGFLRGQKHLLKNIKRRKTTTAHSQ |
Motif4 | 4.20 × 10−115 | 41 | GLEGENERLRRENEVLMSELVKLKQQQQNTFSLLQAMESRL |
Motif5 | 4.80 × 10−54 | 34 | QSTEWKQKQMMTFLAKAMQNPTFVQQLVQKKDER |
Motif6 | 1.60 × 10−22 | 49 | PPQQQPSTAAPTNSSDEQVISNSNSPPLAIPSVIMHRHHHHHHLYHNNN |
Motif7 | 1.20 × 10−19 | 41 | KSVKAIRVSMKRRLTSTLSAPNLNDVVEPELVRSMAVSSDN |
Motif8 | 2.60 × 10−16 | 50 | CGGGGGGSPMIFGVSIGGKRGREGGDDGGGEVVGGGEGLGATEVHDDHMH |
Motif9 | 2.60 × 10−13 | 50 | ATLDNGTDGDIKEQKVDDSMPPEIDTNVGDVSQTSWEELLWAEDEEGFRQ |
Motif10 | 7.70 × 10−10 | 29 | MRELSIKGLFDDHDDDDECGIIMRRKMTK |
Motif11 | 1.50 × 10−9 | 13 | PKPMEGLNEMNPP |
Motif12 | 1.80 × 10−5 | 41 | DSDGDDGNNKNRPKLFGVRLDLQDESERKRRKKLALDYTRT |
Motif13 | 5.20 × 10−8 | 21 | NNNNNNNVVITRKNNENEMNN |
Motif14 | 1.40 × 10−4 | 29 | PVENVVPESGNWGEDVEDLIEQLGFLGPM |
Motif15 | 1.80 × 10−4 | 21 | MTAVLVTVSDLVSSSTTSSSS |
Motif16 | 2.10 × 10−4 | 29 | MSPPPSPPAEEKPEKLTAVVVGGGGGETQ |
Motif17 | 1.70 × 10−3 | 21 | AAPSRVNDAVWTQLLTLPRGS |
Motif18 | 2.90 × 10−3 | 10 | GFRKVDPDKW |
Motif19 | 1.30 × 10−2 | 23 | TSTTCTCTPLSTESPQLGLQLSP |
Motif20 | 1.00 × 10−2 | 19 | YWYDFDGEDEVELEERVPC |
Gene Name | DBD | HR-A/B | NLS | NES | RD | AHA |
---|---|---|---|---|---|---|
DcaHsf-A1 | 31–124 | 162–182/201–212 | N.D. | (403) L | N.D. | N.D. |
DcaHsf-A2a | 40–154 | 183–201/222–233 | (147–156) KTIKRRRNVT (258–267) AGMKRRLTST | N.D. | N.D. | (329–338) QTSWEELLWA |
DcaHsf-A2b | 40–133 | 162–180/201–212 | (126–137) LLKTIKRRRNVT (237–246) AGMKRRLTST | (232–237) LDITHL | N.D. | (308–317) QTSWEELLWA |
DcaHsf-A3 | 37–148 | 181–199/220–230 | N.D. | (319) L | N.D. | N.D. |
DcaHsf-A4 | 11–104 | 139–157/178–189 | (204–213) HDRKRRFSRP | N.D. | N.D. | (325–334) DVFWEQFLTE |
DcaHsf-A5 | 20–113 | 138–156/177–187 | (206–217) LSAYNKKRRLPP | N.D. | ND | (438–447) DLFWEQFLTE |
DcaHsf-A7 | 40–133 | 164–182/203–213 | (126–140) LLKNIKRRKNPSQTF (237–246) LSKKRRRPIE | N.D. | ND | (322–331) DDFWEDLLNE |
DcaHsf-A9a | 87–180 | 202–220/241–251 | (173–184) LLKSIKRKRHGS (275–285) RVSKKRRLAST | (204) LDQEALKVEI | ND | N.D. |
DcaHsf-A9b | 95–188 | 210–228/249–259 | (181–192) LLKSIKRKRHGS (283–293) RVSKKRRLAST | (217–221) LKVEI | ND | N.D. |
DcaHsf-B1 | 6–99 | 125–131 | N.D. | (155–157) LEL | (220-226) KLFGVWL | N.D. |
DcaHsf-B2a | 32–125 | 151–169/190–200 | N.D. | N.D. | ND | N.D. |
DcaHsf-B2b | 32–125 | 151–169/190–200 | N.D. | N.D. | ND | N.D. |
DcaHsf-B2c | 26–119 | 145–153/172–178 | N.D. | (197–202) KENMSL | (284–290) KLFGVSI | N.D. |
DcaHsf-B3a | 29–122 | 147–152 | (5–30) SIKGLFDDHDDDDECGIIMRRKMTKP (178–187) NAMKRKCQEL (207–235) KNRPKLFGVRLDLQDESERKRRKKLALDY | (222–238) LDLQDESERKRRKKLAL | (216–222) KLFGVRL | N.D. |
DcaHsf-B3b | 29–122 | 147–152 | (5–30) SIKGLFDDHDDDDECGIIMRRKMTKP (178–187) NAMKRKCQEL (207–235) KNRPKLFGVRLDLQDESERKRRKKLALDY | N.D. | (216–222) KLFGVRL | N.D. |
DcaHsf-B4 | 12–105 | 131–149/163–166 | (275–283) HSKKRLHLA | N.D. | (268–274) RLFGVPL | N.D. |
DcaHsf-C1 (not full) | 1–44 | 73–89/98–108 | N.D. | (66) L | N.D. | N.D. |
© 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Li, W.; Wan, X.-L.; Yu, J.-Y.; Wang, K.-L.; Zhang, J. Genome-Wide Identification, Classification, and Expression Analysis of the Hsf Gene Family in Carnation (Dianthus caryophyllus). Int. J. Mol. Sci. 2019, 20, 5233. https://doi.org/10.3390/ijms20205233
Li W, Wan X-L, Yu J-Y, Wang K-L, Zhang J. Genome-Wide Identification, Classification, and Expression Analysis of the Hsf Gene Family in Carnation (Dianthus caryophyllus). International Journal of Molecular Sciences. 2019; 20(20):5233. https://doi.org/10.3390/ijms20205233
Chicago/Turabian StyleLi, Wei, Xue-Li Wan, Jia-Yu Yu, Kui-Ling Wang, and Jin Zhang. 2019. "Genome-Wide Identification, Classification, and Expression Analysis of the Hsf Gene Family in Carnation (Dianthus caryophyllus)" International Journal of Molecular Sciences 20, no. 20: 5233. https://doi.org/10.3390/ijms20205233
APA StyleLi, W., Wan, X.-L., Yu, J.-Y., Wang, K.-L., & Zhang, J. (2019). Genome-Wide Identification, Classification, and Expression Analysis of the Hsf Gene Family in Carnation (Dianthus caryophyllus). International Journal of Molecular Sciences, 20(20), 5233. https://doi.org/10.3390/ijms20205233