Discovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion Liocheles australasiae
Abstract
1. Introduction
2. Results
2.1. Identification of κ-KTx-like Peptides
2.2. Biological Activity
2.3. Structure–Activity Relationship
3. Discussion
4. Materials and Methods
4.1. Materials
4.2. Venom Fractionation
4.3. Mass Spectrometry
4.4. Sequence Analysis
4.5. Peptide Synthesis
4.6. Folding Reaction
4.7. Determination of Disulfide Bonding Patterns
4.8. 3D Structure Prediction
4.9. Bioassay
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Ghezellou, P.; Jakob, K.; Atashi, J.; Ghassempour, A.; Spengler, B. Mass-spectrometry-based lipidome and proteome profiling of Hottentotta saulcyi (Scorpiones: Buthidae) Venom. Toxins 2022, 14, 370. [Google Scholar] [CrossRef] [PubMed]
- Evans, E.R.J.; McIntyre, L.; Northfield, T.D.; Daly, N.L.; Wilson, D.T. Small molecules in the venom of the scorpion Hormurus waigiensis. Biomedicines 2020, 8, 259. [Google Scholar] [CrossRef] [PubMed]
- Inceoglu, B.; Lango, J.; Jing, J.; Chen, L.L.; Doymaz, F.; Pessah, I.N.; Hammock, B.D. One scorpion, two venoms: Prevenom of Parabuthus transvaalicus acts as an alternative type of venom with distinct mechanism of action. Proc. Natl. Acad. Sci. USA 2003, 100, 922–927. [Google Scholar] [CrossRef] [PubMed]
- Herzig, V.; Cristofori-Armstrong, B.; Israel, M.R.; Nixon, S.A.; Vetter, I.; King, G.F. Animal toxins—Nature’s evolutionary-refined toolkit for basic research and drug discovery. Biochem. Pharmacol. 2020, 181, 114096. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.T.; Luo, H.; Peng, X.Z.; Chen, J.J. Spider and scorpion knottins targeting voltage-gated sodium ion channels in pain signaling. Biochem. Pharmacol. 2024, 227, 116465. [Google Scholar] [CrossRef] [PubMed]
- Vilas Boas, L.C.P.; Campos, M.L.; Berlanda, R.L.A.; de Carvalho Neves, N.; Franco, O.L. Antiviral peptides as promising therapeutic drugs. Cell. Mol. Life Sci. 2019, 76, 3525–3542. [Google Scholar] [CrossRef] [PubMed]
- Mendes, L.C.; Viana, G.M.M.; Nencioni, A.L.A.; Pimenta, D.C.; Beraldo-Neto, E. Scorpion peptides and ion channels: An insightful review of mechanisms and drug development. Toxins 2023, 15, 238. [Google Scholar] [CrossRef] [PubMed]
- Smith, J.J.; Herzig, V.; King, G.F.; Alewood, P.F. The insecticidal potential of venom peptides. Cell. Mol. Life Sci. 2013, 70, 3665–3693. [Google Scholar] [CrossRef] [PubMed]
- Yacoub, T.; Rima, M.; Karam, M.; Fajloun, J. Antimicrobials from venomous animals: An overview. Molecules 2020, 25, 2402. [Google Scholar] [CrossRef]
- Miyashita, M.; Sakai, A.; Matsushita, N.; Hanai, Y.; Nakagawa, Y.; Miyagawa, H. A novel amphipathic linear peptide with both insect toxicity and antimicrobial activity from the venom of the scorpion Isometrus maculatus. Biosci. Biotechnol. Biochem. 2010, 74, 364–369. [Google Scholar] [CrossRef]
- Daly, N.L.; Wilson, D. Structural diversity of arthropod venom toxins. Toxicon 2018, 152, 46–56. [Google Scholar] [CrossRef]
- Ortiz, E.; Gurrola, G.B.; Schwartz, E.F.; Possani, L.D. Scorpion venom components as potential candidates for drug development. Toxicon 2015, 93, 125–135. [Google Scholar] [CrossRef] [PubMed]
- Juichi, H.; Miyashita, M.; Nakagawa, Y.; Miyagawa, H. Isolation and characterization of the insecticidal, two-domain toxin LaIT3 from the Liocheles australasiae scorpion venom. Biosci. Biotechnol. Biochem. 2019, 83, 2183–2189. [Google Scholar] [CrossRef]
- Matsushita, N.; Miyashita, M.; Ichiki, Y.; Ogura, T.; Sakuradani, E.; Nakagawa, Y.; Shimizu, S.; Miyagawa, H. Purification and cDNA cloning of LaIT2, a novel insecticidal toxin from venom of the scorpion Liocheles australasiae. Biosci. Biotechnol. Biochem. 2009, 73, 2769–2772. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Matsushita, N.; Miyashita, M.; Sakai, A.; Nakagawa, Y.; Miyagawa, H. Purification and characterization of a novel short-chain insecticidal toxin with two disulfide bridges from the venom of the scorpion Liocheles australasiae. Toxicon 2007, 50, 861–867. [Google Scholar] [CrossRef] [PubMed]
- Miyashita, M.; Mitani, N.; Kitanaka, A.; Yakio, M.; Chen, M.; Nishimoto, S.; Uchiyama, H.; Sue, M.; Hotta, H.; Nakagawa, Y.; et al. Identification of an antiviral component from the venom of the scorpion Liocheles australasiae using transcriptomic and mass spectrometric analyses. Toxicon 2021, 191, 25–37. [Google Scholar] [CrossRef]
- Olamendi-Portugal, T.; Csoti, A.; Jimenez-Vargas, J.M.; Gomez-Lagunas, F.; Panyi, G.; Possani, L.D. Pi5 and Pi6, two undescribed peptides from the venom of the scorpion Pandinus imperator and their effects on K+-channels. Toxicon 2017, 133, 136–144. [Google Scholar] [CrossRef]
- Jimenez-Vargas, J.M.; Possani, L.D.; Luna-Ramirez, K. Arthropod toxins acting on neuronal potassium channels. Neuropharmacology 2017, 127, 139–160. [Google Scholar] [CrossRef] [PubMed]
- Yamaji, N.; Dai, L.; Sugase, K.; Andriantsiferana, M.; Nakajima, T.; Iwashita, T. Solution structure of IsTX. A male scorpion toxin from Opisthacanthus madagascariensis (Ischnuridae). Eur. J. Biochem. 2004, 271, 3855–3864. [Google Scholar] [CrossRef]
- Nieto, A.R.; Gurrola, G.B.; Vaca, L.; Possani, L.D. Noxiustoxin 2, a novel K+ channel blocking peptide from the venom of the scorpion Centruroides noxius Hoffmann. Toxicon 1996, 34, 913–922. [Google Scholar] [CrossRef]
- Moller, C.; Rahmankhah, S.; Lauer-Fields, J.; Bubis, J.; Fields, G.B.; Mari, F. A novel conotoxin framework with a helix-loop-helix (Cs alpha/alpha) fold. Biochemistry 2005, 44, 15986–15996. [Google Scholar] [CrossRef] [PubMed]
- Barnham, K.J.; Dyke, T.R.; Kem, W.R.; Norton, R.S. Structure of neurotoxin B-IV from the marine worm Cerebratulus lacteus: A helical hairpin cross-linked by disulphide bonding. J. Mol. Biol. 1997, 268, 886–902. [Google Scholar] [CrossRef] [PubMed]
- Honma, T.; Minagawa, S.; Nagai, H.; Ishida, M.; Nagashima, Y.; Shiomi, K. Novel peptide toxins from acrorhagi, aggressive organs of the sea anemone Actinia equina. Toxicon 2005, 46, 768–774. [Google Scholar] [CrossRef]
- Krishnarjuna, B.; Sunanda, P.; Villegas-Moreno, J.; Csoti, A.; Morales, R.A.V.; Wai, D.C.C.; Panyi, G.; Prentis, P.; Norton, R.S. A disulfide-stabilised helical hairpin fold in acrorhagin I: An emerging structural motif in peptide toxins. J. Struct. Biol. 2021, 213, 107692. [Google Scholar] [CrossRef] [PubMed]
- Slavokhotova, A.A.; Rogozhin, E.A. Defense peptides from the α-hairpinin family are components of plant innate immunity. Front. Plant Sci. 2020, 11, 465. [Google Scholar] [CrossRef]
- Duvick, J.P.; Rood, T.; Rao, A.G.; Marshak, D.R. Purification and characterization of a novel antimicrobial peptide from maize (Zea mays L.) kernels. J. Biol. Chem. 1992, 267, 18814–18820. [Google Scholar] [CrossRef] [PubMed]
- Nolde, S.B.; Vassilevski, A.A.; Rogozhin, E.A.; Barinov, N.A.; Balashova, T.A.; Samsonova, O.V.; Baranov, Y.V.; Feofanov, A.V.; Egorov, T.A.; Arseniev, A.S.; et al. Disulfide-stabilized helical hairpin structure and activity of a novel antifungal peptide EcAMP1 from seeds of barnyard grass (Echinochloa crus-galli). J. Biol. Chem. 2011, 286, 25145–25153. [Google Scholar] [CrossRef] [PubMed]
- Almagro Armenteros, J.J.; Tsirigos, K.D.; Sonderby, C.K.; Petersen, T.N.; Winther, O.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat. Biotechnol. 2019, 37, 420–423. [Google Scholar] [CrossRef] [PubMed]
- Duckert, P.; Brunak, S.; Blom, N. Prediction of proprotein convertase cleavage sites. Protein Eng. Des. Sel. 2004, 17, 107–112. [Google Scholar] [CrossRef] [PubMed]
- Madeira, F.; Madhusoodanan, N.; Lee, J.; Eusebi, A.; Niewielska, A.; Tivey, A.R.N.; Lopez, R.; Butcher, S. The EMBL-EBI Job Dispatcher sequence analysis tools framework in 2024. Nucleic Acids Res. 2024, 52, W521–W525. [Google Scholar] [CrossRef] [PubMed]
- Abramson, J.; Adler, J.; Dunger, J.; Evans, R.; Green, T.; Pritzel, A.; Ronneberger, O.; Willmore, L.; Ballard, A.J.; Bambrick, J.; et al. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature 2024, 630, 493–500. [Google Scholar] [CrossRef] [PubMed]





| Precursor | Sequence 1) |
|---|---|
| La-κKTx1 | MKPSTSAYALLLVLTFGIITSGVFAVPMDEENTFEVEKRGNSCMEVCLQHEGNVAECEKACNKG |
| La-κKTx2 | MKPSTSAFILLLVLTFGIITSGVSAIPMDEENTFEEQKRDSACVEVCLHHEGNVAECEEACKKS |
| La-κKTx3 | MKLLPLLVILIICALMANEAFCDQGARERSENLEDTRDLVQKPCRIVCSENMRKCIRRCTLGR |
| La-κKTx4 | MKPSSFAIALILVLFLGFTNAVSGEYAESISGDRMERAERAGCRIRCLQFTDDFEKCRKLCG |
| La-κKTx5 | MKLLPLLLVILIVCALLPNEAFCDQSAVERSESLEEVSREIVKRSCKRVCSGTRRTKKCMQKCKSQPGR |
| Peptide (Enzyme) | Mature Structure | Molecular Mass | Observed Digest | Molecular Mass | ||
|---|---|---|---|---|---|---|
| Calcd. 1) | Obsd. | Calcd. 1) | Obsd. | |||
| mLa-κKTx1 (Glu-C) | ![]() | 2590.05 | 2590.05 | ![]() | 1198.5 | 1198.4 |
![]() | 1427.6 | 1427.6 | ||||
| mLa-κKTx2 (Glu-C) | ![]() | 2685.09 | 2685.09 | ![]() | 1155.5 | 1155.4 |
![]() | 1565.6 | 1565.6 | ||||
| mLa-κKTx3 (Trypsin) | ![]() | 2743.42 | 2743.41 | ![]() | 1174.6 | 1174.6 |
![]() | 1338.6 | 1338.6 | ||||
| mLa-κKTx4 (Trypsin) | ![]() | 2855.36 | 2855.35 | ![]() | 636.3 | 636.4 |
![]() | 1519.6 | 1519.7 | ||||
| mLa-κKTx5 (Lys-C) | ![]() | 2637.30 | 2637.30 | ![]() | 583.2 | 583.3 |
![]() | 1668.8 | 1669.2 | ||||
| Peptide | LD50 (nmol/g) |
|---|---|
| mLa-κKTx1 | >80 |
| mLa-κKTx2 (LaIT5) | 10 |
| mLa-κKTx3 | >80 |
| mLa-κKTx4 | >80 |
| mLa-κKTx5 | >80 |
| No. | Analogs | LD50 (nmol/g) |
|---|---|---|
| LaIT5 | 10 | |
| 1 | LaIT5(H10Q) | 53 |
| 2 | LaIT5(E20K) | 12 |
| 3 | LaIT5(NH2) | 8.7 |
| 4 | mLa-κKTx1(Q10H) | 9.0 |
| 5 | LaIT5(D1A) | 14 |
| 6 | LaIT5(E6A) | 21 |
| 7 | LaIT5(H11A) | 45 |
| 8 | LaIT5(E12A) | 9.7 |
| 9 | LaIT5(E17A) | 4.3 |
| 10 | LaIT5(E19A) | 5.5 |
| 11 | LaIT5(E20A) | 3.1 |
| 12 | LaIT5(K23A) | 5.0 |
| 13 | LaIT5(K24A) | 3.4 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Miyashita, M.; Mitani, N.; Iwamoto, F.; Hirota, M.; Nakagawa, Y. Discovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion Liocheles australasiae. Molecules 2025, 30, 32. https://doi.org/10.3390/molecules30010032
Miyashita M, Mitani N, Iwamoto F, Hirota M, Nakagawa Y. Discovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion Liocheles australasiae. Molecules. 2025; 30(1):32. https://doi.org/10.3390/molecules30010032
Chicago/Turabian StyleMiyashita, Masahiro, Naoya Mitani, Fuki Iwamoto, Mitsuki Hirota, and Yoshiaki Nakagawa. 2025. "Discovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion Liocheles australasiae" Molecules 30, no. 1: 32. https://doi.org/10.3390/molecules30010032
APA StyleMiyashita, M., Mitani, N., Iwamoto, F., Hirota, M., & Nakagawa, Y. (2025). Discovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion Liocheles australasiae. Molecules, 30(1), 32. https://doi.org/10.3390/molecules30010032
















