Next Article in Journal
Porphyrin Macrocycles: General Properties and Theranostic Potential
Previous Article in Journal
Difunctionalization of Dienes, Enynes and Related Compounds via Sequential Radical Addition and Cyclization Reactions
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Anti-Cancer Peptides: Status and Future Prospects

by
Gehane Ghaly
1,†,
Hatem Tallima
1,†,
Eslam Dabbish
1,
Norhan Badr ElDin
2,
Mohamed K. Abd El-Rahman
2,3,
Mahmoud A. A. Ibrahim
4,5 and
Tamer Shoeib
1,*
1
Department of Chemistry, The American University in Cairo, New Cairo 11835, Egypt
2
Analytical Chemistry Department, Faculty of Pharmacy, Cairo University, Kasr-El Aini Street, Cairo 11562, Egypt
3
Department of Chemistry and Chemical Biology, Harvard University, 12 Oxford Street, Cambridge, MA 02138, USA
4
Computational Chemistry Laboratory, Chemistry Department, Faculty of Science, Minia University, Minia 61519, Egypt
5
School of Health Sciences, University of Kwa-Zulu-Natal, Westville, Durban 4000, South Africa
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Molecules 2023, 28(3), 1148; https://doi.org/10.3390/molecules28031148
Submission received: 27 November 2022 / Revised: 26 December 2022 / Accepted: 19 January 2023 / Published: 23 January 2023
(This article belongs to the Section Materials Chemistry)

Abstract

The dramatic rise in cancer incidence, alongside treatment deficiencies, has elevated cancer to the second-leading cause of death globally. The increasing morbidity and mortality of this disease can be traced back to a number of causes, including treatment-related side effects, drug resistance, inadequate curative treatment and tumor relapse. Recently, anti-cancer bioactive peptides (ACPs) have emerged as a potential therapeutic choice within the pharmaceutical arsenal due to their high penetration, specificity and fewer side effects. In this contribution, we present a general overview of the literature concerning the conformational structures, modes of action and membrane interaction mechanisms of ACPs, as well as provide recent examples of their successful employment as targeting ligands in cancer treatment. The use of ACPs as a diagnostic tool is summarized, and their advantages in these applications are highlighted. This review expounds on the main approaches for peptide synthesis along with their reconstruction and modification needed to enhance their therapeutic effect. Computational approaches that could predict therapeutic efficacy and suggest ACP candidates for experimental studies are discussed. Future research prospects in this rapidly expanding area are also offered.

1. Introduction

Various approaches to cancer treatment have been proposed and investigated; however, many limitations persist, including toxic side effects, developed drug resistance and low selectivity. These limitations motivated the search for new non-conventional methods in cancer therapy, of which anti-cancer bioactive peptides (ACPs) demonstrated potential in diagnostic and therapeutic applications, making them a good prospect for theranostic agents. In therapeutic applications, ACPs have demonstrated higher specificity, sensitivity, accuracy and lower toxicity than conventional anticancer therapeutics [1]. ACPs were also applied in combined therapy to increase cancer cell sensitivity to other therapeutic agents [2].
Peptides are small bioactive proteins, ranging between 10 and 100 amino acid units, that perform various biochemical roles in the body [3,4]. They are linked by peptide bonds that are formed by dehydration and condensation. The application of peptides in medicine was first proposed in 1922 through the use of insulin extracted from animal pancreas in the treatment of type 1 diabetes [5]. To date, more than 600 peptides have been applied in clinical and preclinical investigations, of which 60 have been approved as drugs [6,7]. These therapeutic applications of these peptides include cancer treatment, drug-delivery systems, hormonal regulators, inflammation modulators, vaccines, antibiotics and quorum-sensing molecules [8,9,10,11,12,13]. Peptides that have therapeutic effects are classified into three main categories based on their source: natural, artificially modified and artificially synthesized [14,15]. They can be obtained from living organisms, such as animals, plants, bacteria and fungi. They can also be attained through proteolysis, synthesized chemically or by recombinant genes [16,17]. Recently, computational methods such as traditional machine learning (ML) and deep learning (DL), which are a subset of artificial intelligence (AI), have been employed in ACPs screening [13,18,19] in order to overcome potential adverse in vitro effects due to peptidases or unknown immunogenicity [20].
Antimicrobial peptides (AMPs) are part of the innate immunity in numerous organisms [21]. They are typically cationic, amphipathic molecules with high content of hydrophobic residues. These properties allow them to interact, within a short time frame, with negatively charged microbial membranes that have a low probability of developing AMP resistance, resulting in microbial death [22,23]. A group of AMPs has also displayed anticancer activity, and hence they are also regarded as ACPs and are summarized in Table 1, which lists all ACPs discussed in this review. This anticancer activity is most likely due to their interactions with the higher abundance of negatively charged molecules, such as phosphatidylserine, glycoproteins and glycolipids, on the outer plasma membranes in cancer cells relative to their counterparts in normal cells [24].

2. Conformations of ACPs

2.1. ACPs with α-Helical Conformations

Most ACPs adopt α-helical conformations; for example, BMAP-27 and BMAP-28 both adopt this conformation and are both bovine cathelicidin-derived AMPs with demonstrated antitumor activity against leukemia [26,49]. They are composed of 27 and 28 amino acid residues, respectively, where the first 18 residues from their NH2-termini form amphipathic α-helices, while the remaining residues form hydrophobic tails, a crucial feature for their cytotoxic activity [50]. Another example is P18, where its α-helical COOH-terminus has been shown to be responsible for selective anticancer activity towards human cancer cells, including Jurkat T leukemia, K562 chronic myeloid leukemia and MDA-MB-361 breast carcinoma cells with no hemolytic effects [45].
The peptide leucine-37 (LL-37) belongs to the cathelicidin family and is encoded by the CAMP gene with a highly conserved NH2-terminal α-helix. It was initially synthesized as the preproprotein, hCAP-18, then converted into its active form, LL-37, by proteinase 3-mediated extracellular cleavage [51]. The preproprotein hCAP-18 is expressed in various cell types, including neutrophils [52] and squamous epithelial cells [53]. The active form, LL-37, plays a crucial role in adaptive immunity, growth inhibition, chemotaxis and wound healing [42,54,55,56].
Cecropin A and B are ACPs first discovered in insects such as the giant silk moth Hyalophora cecropia [57], then later in mammals [58]. The insect-derived peptides consist of 34-39 amino acid residues [30,59]. These peptides are each composed of two α-helices. Cecropin A has an NH2-terminal helix that is highly amphipathic, while the carboxylic terminal helix is hydrophobic. Cecropin B1, on the other hand, has two amphipathic helices and exhibits high antitumor activity against HL-60 human promyelocytic leukemia cells and low toxicity toward normal cells [60].
Some other α-helical ACPs, such as magainins and their analogs, gaegurins, aurein 1.2 and citropin 1.1, have been isolated from amphibian skin [25,31,34,61,62,63]. Magainins consisting of 21–27 amino acid residues, with separate cationic and hydrophobic faces within their helices, have been isolated from the African frog Xenopus laevis [64]. The most common ACP, magainin 2, and its synthetic analogs, magainins A, B and G, all show lytic activity against hematopoietic and solid tumor cell lines at concentrations 5–10 fold lower than that affecting normal cells [62,65]. These ACPs have also demonstrated antitumor activity against the human lung cancer cell line A59 [66] and against several human bladder cancer lines through the formation of ion-conducting pores in cell membranes [62,67].
Gaegurins are a class of six peptides exhibiting cytotoxic activities that have been isolated from the skin of the Korean frog Rana rugose [68]. These peptides acquire a random coil conformation in solution but revert to an α-helix in membrane environments. Gaegurin 5 and 6 each consist of 24 amino acid residues and possess selective anticancer cytotoxicity with minimal effect on normal cells [34,35,61]. Gaegurin 5 and two of its synthetic analogs have shown selective antitumor activity against HCT116 colon and MCF-7 breast carcinoma cells [34]. Similarly, gaegurin 6 and its synthetic analog, PTP7, have shown selective and broad antitumor activity against various human cancer cells and, more importantly, against a multidrug-resistant variant of the breast cancer MCF-7 cell line. This demonstrated action is thought to be via an apoptotic mechanism, as evident in the DNA fragments detected in the cell line environment after being treated with the peptides [61].
Aurein 1.2 and citropin 1.1 are isolated from the Australian frog Litoria raniformis and the tree frog Litoria citropa, respectively. Both are short peptides consisting of 13 and 16 amino acid residues, respectively. Aurein 1.2 acquires α-helical conformation in solution and has shown moderate anticancer activity against almost 60 human cancer cell lines, with no significant lytic effect on erythrocytes [25]. Citropin 1.1 has an α-helical structure with well-defined hydrophobic and hydrophilic regions. This peptide exhibits a wide range of antitumor activity against human hematopoietic and non-hematopoietic cancer cell lines, with no significant lytic effect on erythrocytes [31].
Melittin is a 26 amino acid residue peptide isolated from the venom of the European honeybee Apis mellifera [69]. Starting from the NH2-terminus, 19 out of 20 residues are hydrophobic, whereas the six residues ending at the COOH-terminus are hydrophilic for an overall alkaline peptide [70,71]. At low membrane concentrations, melittin adopts an α-helical structure parallel to the lipid bilayer [44]. The activity of melittin has been shown against both cancer cells and normal erythrocytes [70,71,72].

2.2. ACPs with β-Sheet Conformations

The second most common geometric arrangement for ACPs is β-sheet conformations [73,74]. Adopting this conformation are defensins, which are a group of Cys- and Arg-rich closely related ACPs, ranging from 29 to 45 amino acid residues [75], where some of its plant-derived are reported to have activity on cancer cells [76]. In this group of ACPs, three intramolecular disulfide bridges form between the NH2-terminal and COOH-terminal regions and are formed by six conserved Cys residues. In human α- and β-defensins, the disulfide bridges occur from the NH2-terminal between Cys1–Cys6, Cys2–Cys4 and Cys3–Cys5 in α-defensins, and between Cys1–Cys5, Cys2–Cys4 and Cys3–Cys6 in β-defensins [77,78,79]. This results in a cyclic, triple-stranded, amphiphilic β-sheet structure with separated hydrophobic and hydrophilic regions [80,81]. The human neutrophil peptides HNP 1, 2 and 3 are α-defensins, originally purified from the azurophilic granules of neutrophils [39,82]. These three ACPs exhibited their activity against several types of cancers, including the pro-monocytic human myeloid leukemia cell line U937, the human erythroleukemic cell line K562, and lymphoblastoid B cells IM-9 and WIL-2 [83].
Lactoferricin is another ACP adopting a β-sheet conformation that is obtained through the pepsin-mediated hydrolysis of mammalian milk, iron-binding and glycoprotein lactoferrin [84]. The bovine peptide LfcinB consists of 25 amino acid residues, with one disulfide bridge linking the two terminal regions of the peptide. It has two amphipathic structures, a loop peptide and a twisted β-sheet configuration that is attained in solution [85,86], with segregation of the basic amino acids on one face and the hydrophobic amino acids on the other [41]. LfcinB has demonstrated wide anticancer activity, including against human and mouse leukemia, fibrosarcoma and neuroblastoma cells, as well as other carcinomas [85,87,88,89], with no toxicity towards normal cells at the applied peptide concentrations [89,90]. LfcinB also suppresses both the basic fibroblast growth factor and the vascular endothelial growth factor-driven proliferation as well as migration of human endothelial cells [91].
Tachyplesin I, a 17 amino acid residue peptide isolated from the horseshoe crab Tachypleus tridentatus [48], is arranged in two parallel β-sheets joined together by two disulfide bridges. This geometry exposes six basic Arg and Lys amino acid units on the peptide surface to give it an amphipathic structure [92]. The Cys residues maintain the stability of the peptide in serum, with no effect on its cytotoxic action [93].

2.3. Linear, Hybrid, Diastereomeric and Synthetic ACPs

Brevinin, a 25 amino acid residue peptide identified in the skin secretions of the Fujian large-headed frog, Limnonectes fujianensis, was predicted to be an amphipathic, hydrophobic, alpha helical and beta turn peptide that has the ability to penetrate membrane lipid bilayers [28]. PR-39, on the other hand, a Pro- and Arg-rich linear peptide of the cathelicidin family containing 39 amino acid residues with no secondary structure, is isolated from the porcine small intestine and neutrophils [94,95]. Hybrid ACPs, on the other hand, are a class of synthetic peptides created by combining different regions of different peptides, for example, the positively charged NH2-terminal α-helical region of cecropin A with the NH2-terminal α-helical hydrophobic region of either melittin or magainin 2 [96,97,98]. Both hybrids have shown anticancer effects against lung cancer cell lines. Modest hemolytic activity was demonstrated by the melittin hybrid, while the magainin hybrid has exhibited little or no lytic effect on erythrocytes [96]. The central hinge region (Gly–Ile–Gly) was reported to be crucial for anticancer activity, as it provides the required conformational flexibility allowing for interactions between the α-helical NH2-terminus and cell membranes. This flexibility leads to parallel alignment of the peptides, which in turn permits the insertion of the α-helical COOH-terminus through cell membranes [98].
Synthetic peptides are able to permeabilize cancerous cell membranes without being degraded enzymatically in serum [99,100]. D-K4R2L9 is a synthetic, 15 residue, diastereomeric amphipathic peptide, with D-amino acids making up a third of its sequence while also containing Leu, Lys and Arg residues. This synthetic peptide has shown anticancer activity against mouse melanoma cell lines, human prostate cancer cell lines, and significant prevention ability against lung tumor formation [101]. D-K6L9, another 15-residue synthetic diastereomeric amphipathic peptide, with D-Lys and D-Leu residues in one-third of its sequence, showed selective anticancer activity against human prostate cancer cell lines similar to D-K4R2L9 [33]. L-K6L9, an analog of D-K6L9, which consists of L-amino acids only, also showed similar anticancer activity; however, it also caused lysis of normal fibroblast and erythrocytes [102]. Magainins A, B and G which are synthetic analogs of magainin, all show significant antitumor cytotoxic activity against lung cancer and drug-resistant tumor cells [62,66,103,104]. It is noteworthy that the hybrid peptide formed by linking cecropin with magainin 2 has shown remarkable anticancer activity against several cancer cell lines, with low toxicity to erythrocytes and fibroblasts [105]. The synthetic derivatives of LfcinB, with clear cationic and hydrophobic sectors, show higher anticancer activity than their natural analog. The glutamic acid-containing murine peptide, on the other hand, has shown no anticancer activity, suggesting that the high net positive charge plays a major role in the demonstrated anticancer cytotoxicity [106,107,108]. Synthetic ACPs are typically coupled to targeting domains to further promote their selectivity and cytotoxic activity. For example, cyclic CNGRC and double cyclic RGD-4C have both been coupled to a mitochondrial membrane targeting 14 D-amino acid residues (a repeating KLAKLAK unit), pro-apoptotic peptide [109].

3. Modes of Action of ACPs

Some ACPs are active against microbial and cancerous cells, such as cecropins and magainins, while other ACPs are additionally active against normal cells, such as melittin and human neutrophil defensins HNP-1, HNP-2 and HNP-3 [72,73,110]. In most cases, the main action of ACPs is through their interactions with cell membranes, resulting either in their lysis or in their penetration. However, in a small number of cases, some other minor mechanisms also occur [24]. Interactions of ACPs with membranes involve several factors that promote tumor cell membrane charge modification and electrostatic interactions between typically cationic peptides and highly negatively charged cell membranes. Hypoxia and elevated levels of reactive oxygen species modify tumor microenvironments, disrupting phospholipid symmetrical distribution between the inner and outer plasma membrane layers. This exposes the highly expressed anionic phosphatidylserine on the outer layer, allowing for recognition by cationic ACPs [111,112]. High concentrations of phosphatidylethanolamine zwitterions, deregulation of glycosylation, glycolipids and membrane glycoproteins with repeated regions of O-glycosylation, in addition to over-expression of heparan sulfate proteoglycans, all contribute to the acquired negative charge of a tumor cell membrane [111,113]. Other factors such as an increased number of filopodia and microvilli, which provides more surface area for contact [114]; lower cholesterol content and rigidity of the tumor plasma membrane, exposing it to hydrophobic interactions [115,116], also contribute to selective ACPs cytotoxicity towards tumor cell membranes.
Several models describing the interactions of ACPs with cell membranes have been investigated. Those models have been elucidated through various techniques, including circular dichroism, X-ray crystallography, nuclear magnetic resonance, reverse-phase high-performance liquid chromatography and surface plasmon resonance [117,118].

3.1. Membrane Interaction Mechanisms

3.1.1. The Carpet Model

In the so-called carpet model, the α-helical ACPs accumulate on the plasma membranes of cells through electrostatic interactions in a parallel fashion similar to a carpet, as shown in Figure 1. After reaching a critical concentration, the ACPs rotate on themselves, redirecting the membrane phospholipids. Similar to a detergent effect, this results in increased membrane fluidity, destruction of the lipid bilayer and micelle formation. The cells’ plasma membranes rupture due to the strain exerted on them, causing their eventual death due to their penetration by the ACPs [73,119]. Defensins are an example of ACPs acting through this model [120]. Magainins and their analogs, gaegurins, aurein 1.2 and citripin 1.1, also adopt this mechanism through this model at low concentrations [120], with the latter two ACPs adopting other mechanisms when they dimerize [121,122].

3.1.2. The Barrel-Stave Model

The initial accumulation of ACPs in their monomeric forms on cell plasma membranes, then as their local concentration increases, as barrel-shaped multimers, is the namesake hallmark of this model. This induces conformational changes in the lipid bilayer, exposing the hydrophobic core to the hydrophobic amino acids in the peptides, which weakens the cell membranes and forms transmembrane pores through the hydrophilic peptide sections, as shown in Figure 1. This, in turn, leads cells to leake their contents and cause their subsequent death [116,123]. The ACPs LfcinB, the helical alamethicin, the dimers of each of aurein, citropin 1.1 and melittin peptides, through this mode of action, form transmembrane pores that disturb membrane integrity, allowing for their entrance into the cells cytoplasmic compartments, and for their co-localization with the negatively charged mitochondria causing cell death [85,124]. Gaegurins were also reported to achieve their cytolytic effect is achieved through the barrel stave and or the carpet model [125].

3.1.3. The Toroidal Pore Model

The toroidal pore model is a multi-step model, where initially, the ACPs are disposed of parallel to the lipid bilayers, reverting to their active form upon reaching a threshold concentration. This allows the ACPs to attain a perpendicular position over the bilayers, destabilizing the membraned of the cells and forming within them toroidal pores that enable the peptides to reach their inner membrane leaflets. This, in turn, is followed by pore disintegration, allowing the peptides into the cells compartments, as presented in Figure 1 [119,126]. Inside the cells, ACPs inhibit essential pathways, such as DNA replication or protein synthesis, causing cells termination. Cecropin A, magainin 2, protegrin-1 and LL-37 are examples of ACPs acting through the toroidal pore mechanisms [116,127]. LL-37 has also been shown to be selective in mitochondrial depolarization and cause caspase-independent apoptosis in human oral squamous cell carcinoma SAS-H1 cells [128,129].

3.1.4. Other Minor Models

There are several other minor mechanisms that are in common with the action of AMPs and allow for ACPs to interact with cancer cell membranes. Among these is the sinking raft model, in which peptides bind to the plasma membrane, resulting in the formation of transient pores [130]. The molecular electroporation model is another example; while not fully understood, this model involves the high charge density on the peptides providing an electrostatic potential that, upon interacting with the plasma membrane, results in electroporation and pore formation followed by cell death [130]. Cecropin A and B, as well as high concentrations of HNP1, HNP2 and HNP3, express their action through this latter model [29,30,59]. In the case of the last three peptides, the suppression of DNA synthesis in renal cell carcinoma lines causes reduced cell viabilities [131], while membrane permeabilization occurs through forming voltage-dependent, ion-permeable channels [132]. These three peptides may also induce DNA damage, as single-strand DNA breaks were detected in treated cells [133]. HNP-1 and HNP-3 may also disrupt neovascularization during tumor development and inhibit the proliferation of endothelial cells induced by vascular endothelial growth factor [134]. However, they were shown not to be tumor-selective, causing lysis of normal human leukocytes, epithelial cells and fibroblasts [135,136]. It has also been reported that their cytotoxicity can be serum-inhibited [137].
Another minor mechanism for ACPs membrane interaction is the aggregate channel model, where peptides form clusters on the plasma membrane by binding to the phospholipidic heads. The formed aggregates associate with water molecules, forming channels through which ions and larger molecules can pass without significant depolarization or destruction of the plasma membrane [138]. Magainins 2, A, B and G, at high concentrations, are reported to exhibit their anticancer activities through the formation of ion-conducting pores in cell membranes [62,67]. The anticancer activities of melittin are thought to involve the hyperactivation of phospholipase A2, an influx of Ca+2 and the subsequent destruction of the transformed cells, as in cells with ras overexpression [139,140]. Another reported mechanism involves the transient activation of endogenous phospholipase D, which leads to a signal transduction pathway, in turn promoting the membrane permeability of the peptide, as in U937 human monocytic leukemia cells [141].
The peptide-induced lipid segregation and the leaky-slit models play a limited role in ACPs interactions with membrane proteins. In the former, peptides binding to cell membranes lead to the grouping of anionic lipids into separate peptide–lipid domains and the segregation of zwitterionic lipids. The resulting rearrangement of the membrane layers affects cell viability and survival [116,142]. In the latter model, peptides bind to the membrane lipids forming linear amphipathic matrices, with the hydrophobic regions facing the double layer. The resulting highly positive curvature adopted by the lipids causes the formation of transient toxic fibrillar oligomers, the so-called leaky slits, that increase cell membrane permeability [142].
The classical and lysis-mediated complement pathways are other mechanisms adopted by by some ACPs such as Tachyplesin I to exhibit their anticancer activities. This mechanism involves binding to over-expressed hyaluronan in human TSU prostate carcinoma cells and to the C1q in human serum [143]. Tachyplesin I also adopts a non-cytolytic mechanism by inducing tumor cell differentiation, thereby reversing the malignant phenotype. This is manifested in the decreased expression of tumor-associated antigens (α-fetoprotein, proliferating cell nuclear antigen), modulation of differentiation-associated enzyme expression (γ-glutamyltransferase, tyrosine aminotransferase), decreased expression of the c-myc oncogene and increased expression of the tumor suppressor gene p21WAF1/CIP1, as observed in the peptide-treated SMMC-7721 human hepatoma cell and BGC-823 human gastric adenocarcinoma cell cultures [144,145].
The induction of syndecan-1 expression is another anticancer mechanism adopted by PR-39, as evident in hepatocellular carcinoma cell lines treated by this ACP [146]. PR-39 enters eukaryotic cells through a receptor-mediated process without permeabilizing the plasma membrane [46]. Within the cytosolic compartment, the NH2-terminal Arg residues in PR-39 form complexes with multiple SH3-containing cytoplasmic proteins, including the signaling adaptor protein p130Cas and the p85α regulatory subunit of phosphatidylinositol 3-kinase [46,147,148]

3.2. Non-Membrane Interactions

Apart from membrane interactions, some ACPs can act through angiogenesis inhibition, tumor apoptosis induction, essential cell protein targeting or immune cell recruitment [149]. The peptides P9, P12 and SP5031 were shown to cause angiogenesis inhibition due to interference with growth factor receptors [150,151,152]. ACPs, such as bovine lactoferricin, can penetrate into the intracellular compartment to reach the mitochondria, resulting in programmed cell death [86,90,153,154]. Some ACPs interfere with functional proteins to inhibit tumor genesis and progression, such as human LL-37, which inhibits proteasomes in gastric cancer cells [155,156]. Other ACPs, such as LTX-315 and LTX-401, can trigger immunogenic events against tumor cells [157,158]. LTX-315, for example, causes immunogenic cell death through the infiltration of T-lymphocytes and myeloid cells, which results in triggering a local inflammatory response. This can also release the inflammatory cytokine HMGB1 and ATP through transient focal necrosis, in addition to activating the apoptotic lysosome caspase-3 [36,159,160]. LTX-401, on the other hand, causes oncolytic necrosis that can promote the combined therapeutic effect of immunotherapies [158].

4. Effects of Hypoxia, pH and Enzyme Activation on ACPs

Hypoxia is a characteristic feature of the cancer tissue microenvironment. Fusing the trans activator of transcription with the hypoxia-inducible factor, HIF-1α protein, results in a species that is stable in a hypoxic environment but is degradable in healthy cell microenvironments; thus, selective penetration of cancer cell membranes is obtained [161].
Since cancer cells require high-energy uptake, they trigger a shift from oxidative to glycolytic metabolism. This is typically due to the upregulation of HIF-related genes, even when the physiological oxygen level is available, in a phenomenon known as the Warburg effect. This, in turn, results in increased cell accumulation of lactate acid [162,163,164]. Hypoxia also triggers increased activities of carbonic anhydrases, Na+/H+ exchangers, bicarbonate transporters and of indoleamine 2,3 dioxygenase, in addition to the accumulation of lactate acid all of these factors contribute to lowering the pH and are ultimately responsible for the acidic microenvironment that is always observed for cancer cells [165,166,167,168]. By taking advantage of this acidic microenvironment, pH low insertion peptides (pHLIPs) can be coupled to cell-penetrating peptides (CPPs) or to nano-carriers, where their acidic amino acid residues allow for their permeabilization of cancer cell membranes and their subsequent internalization [169,170]. The pH low insertion peptides are short unstructured peptides exhibiting weak interactions with cell membranes at neutral pH [171] but revert to helical conformation when the transmembrane domain becomes protonated at pH < 6.5, allowing the COOH-terminus to be inserted through the cell membrane [172].
Cancer cell membranes are externally coated with specific enzymes, not expressed on membranes of normal cells. These enzymes, such as metalloproteases, degrade protein structures in the extracellular matrix and therefore play a crucial role in tumor invasion and eventual metastasis. CPPs have their positively charged domain shielded with a negatively charged peptide domain through a peptide linker that can be cleaved by metalloproteases causing the activation of the CPP in the tumor microenvironment [173]. These cancer cell surface membrane receptors are therefore utilized for selective targeting by peptides or small ligands attached to CPPs such as brain and glioma targeting homing peptides and mitochondrial SS-peptides [174,175,176,177,178,179,180,181].

5. ACPs as Diagnostic Tools

5.1. Imaging Biosensors Employing ACPs

Radiolabeled antibodies have been recently widely applied with good outcomes. However, their high molecular weights which make them liable to sequestration by the reticuloendothelial and liver Kupffer cells, in addition to the long half-life of the isotopes employed, leading to their long elimination times from the body were shown to be disadvantages [182]. Radiolabeling of low molecular weight peptides that are typically less than 50 amino acid residues provides a better alternative as imaging tracers [183,184]. These peptides offer several advantages including their rapid uptake by the target tissues, good sensitivity in deep tissues, low bone marrow uptake, rapid plasma renal clearance and relatively low pharmacological dose to be administered, which make them suitable for imaging procedures. Analogs of regulatory peptides have also been applied for this purpose [185,186].
Examples of radiolabeled peptides and peptide analogs include somatostatin, a cyclic hormone expressed in the central and peripheral nervous systems, and cholecystokinin, a hormone present in the gastrointestinal tract and nervous system which is similar to gastrin both structurally and functionally. Further examples include the gastrin-releasing peptide and bombesin, which bind G-coupled receptors on prostate, breast, pancreatic and small-cell lung carcinoma cancer cells; agonistic peptide-receptor coupling binds to G-coupled proteins, internalizing the peptide-receptor complex, while antagonistic coupling acts externally on the cell membrane [187,188]; the secretin-like neuropeptides vasoactive intestinal peptide and pituitary adenylate cyclase-activating peptide; the glucagon-like peptide 1; and neurotensin [189].
Dipeptide nanoparticles have also been used as imaging and sensing probes. They are characterized by biocompatibility, visible fluorescence and photostability [190]. Fluorescent quantum dots and nanoclusters, such as gold nanoclusters, can also be conjugated with such peptide nano-assemblies for cancer imaging [191,192].
The linkage of dyes to the NH2-termini of pHLIPs allows for the labeling of tumor cells [193]. Changing one or two amino acid residues in the transmembrane domain of pHLIPs to alter their pH50, the pH at which 50% of the pHLIPs are inserted in the cancer cells, has been reported [194]. However, pHLIPs generally show relatively low tumor specificity and accumulate in the kidneys in pathologic and inflammation cases [195].

5.2. Non-Imaging Biosensing Techniques Employing ACPs

ACPs that are used in non-imaging biosensing techniques are typically short synthetic peptide ligands that are used for the detection of specific cancer markers [196]. In ELISA, an enzyme-linked conjugate and substrate are used to identify and quantify a specific target molecule in biological fluids through an antigen-antibody reaction with rapid low limit colorimetric detection with high specificity [197].
Synthetic peptides can also be used as probes in microarrays, where they are adsorbed on the surface of nitrocellulose-coated glass slides and are exposed to the specimen. A number of different unique peptide disease-specific biomarkers can be used in real time, randomly immobilized, to ensure equal accessibility to all antibodies on the peptide microarray during epitope mapping [198].
Binding of different peptides to biologically sensitive fluorophores creates various probes or molecular sensors [199]. In addition, peptides coupled to nanomaterials, such as Ag nanoparticles [200] and Au@Pt nanorods [201] have shown higher sensitivity, selectivity, stability as well as faster signal response [202,203,204,205]. This is of special significance since most diagnostic techniques target tumors but cannot efficiently detect circulating tumor cells due to their low concentration levels, heterogeneity in the blood sample, and non-specific binding of other normal cells, such as leukocytes [206].

6. Synthesis and Modification of ACPs

Solid phase peptide synthesis (SPPS) is the preferred synthesis method for small peptides containing less than 50 amino acid residues [207]. This can be achieved by means of fully automated peptide synthesizers employing non-proteinogenic amino acids with the possibility of applying post-transational modifications during the process. In this technique, the α-amino group and side chain are bound to temporary and semi-permanent protecting groups, respectively, while a polymer resin is coupled to the COOH-terminal residue from which the synthesis cycle is initiated proceeding towards the NH2–terminus, following the removal of the α-amino protecting group. The resin, typically stationed to the right for correct interpretation of sequence and stereochemistry, swells in the applied organic solvent to expand alongside the area of peptide growth, finally cleaving off the final product by means of a bifunctional linker that provides either a peptide acid or a peptide amide that is then isolated and characterized.
From a green chemistry perspective, SPPS has several disadvantages, including high solvent consumption and the use of hazardous chemicals [208]. On the other hand, SPPS meets many green criteria, such as a one-pot reaction, no mechanical losses, a simple work-up process, automatization and miniaturization, high yield and purity, and the potential for simultaneous synthesis of different peptides at the same conditions. Typically, two approaches can be applied in SPPS; these are the tert-butyloxycarbonyl (Boc)/benzyl and 9-fluorenylmethyloxycarbonyl (Fmoc)/tBu approaches. In the first of these strategies, the α-amino group is protected by the Boc group, which is later removed by trifluoroacetic acid in dichloromethane, while the side chain functional groups are protected by benzyl-base groups, which are later removed by hydrogen fluoride [209,210]. The second approach has the α-amino group being protected by the base labile Fmoc group, which is later removed typically by 20% piperidine in dimethylformamide, while the side chain functional groups are protected by the acid-labile tert -butyl or trityl-based groups, which are later removed by trifluoroacetic acid [211].
Liquid phase peptide synthesis, on the other hand, involves the synthesis of peptides in solution employing tags with different properties than the reagents and products to allow for its facile elimination. Several tag molecules have been used, such as polydisperse polyethylene glycol (PEG), monodisperse PEG, perfluoroalkyl substances, ionic liquids, polycarbons, hydrophobic polymers and phosphorus-containing tags [212].
Reconstructing the main chains of ACPs, or modifying their side chains, have been common approaches to enhancing their therapeutic effects [213]. The main chain transformation of ACPs through the replacement of the amino acids changes the activity and selectivity of the peptides by altering their net charges, hydrophilicities and conformations [214,215]. Changes involving non-natural amino acids allow for the synthesis of ACPs with a variety of physiochemical properties [216], including higher conformational flexibilities [217], higher metabolic stabilities [218] and more favored membrane interactions than ACPs with all-natural amino acids [219].
Incorporating cholesterol into the side chains of ACPs, on the other hand, facilitates their penetration into cancer cells by driving peptides self-assembly [220]. PEG coupling to side chain groups of ACPs increases their diameters, changing their physicochemical properties, extending their half-lives, improving their selectivity and reducing their toxicity towards normal cells [221,222]. Threonine, serine and tyrosine side chains, for example, can undergo phosphorylation [223,224], a post-synthesis modification, causing toxicity reduction towards normal cells [213]. Glycosidic bonds via glycosyltransferases may link sugars to specific amino acids on ACPs [225]; this sometimes results in the loss of their activity or function [226]. ACPs palmitoylation occurs through their reaction via a reversible thioester linkage with palmitate, a 16-carbon saturated fatty acid [227]. This reaction may improve either the ACPs selectivity or cytotoxicity to normal cells, but not both simultaneously [228].

7. Computational Approaches in ACPs Synthesis

Traditionally, ACPs have been lab identified and synthesized through various experimental techniques; this process is cost, time and manpower intensive [20]. Recently, however, computationally supported studies to determine the potential interactions of identified ACPs with different proteins helped advance their development [229]. These techniques offer relatively accurate tools for predicting potential ACPs activities before starting in vitro evaluations, saving time, minimizing cost and maximizing output [20]. In the last decade, artificial intelligence (AI) has been used to develop efficient computational methods that can predict peptide sequences with high anti-cancer activities making the ACPs synthesis process faster and more targeted. Most of the AI-developed methods rely on using amino acid sequences of peptides [230,231,232]. Three AI approaches are currently being used in developing ACP predictors, traditional machine learning (ML), deep learning (DL)—which is a subset of ML—and hybrid methods using a combination of both, as shown in Figure 2 [230,231,232,233,234].

7.1. Traditional Machine Learning

In supervised machine learning, a labeled dataset of inputs and outputs is used to train the algorithm. This algorithm looks for a general formula that transforms the input into output. Patterns in data can be found using supervised machine learning algorithms for both continuous data and outputs with a categorical classification which is the regression. Unsupervised machine learning algorithms, on the other hand, use unlabeled data to find structure in the incoming data; this can be used to simplify or organize data [235]. AI computational methods of predicting ACPs rely on the use of a dataset consisting of the amino acid sequences of experimentally proven ACPs and non-ACPs. An initial step in the development of a statistical predictor is the selection or building of a valid benchmark dataset. A common dataset is utilized to examine the significance of the differences between the datasets, which would have two predefined classifications: anticancer and non-anticancer classes. These datasets are the base for training the machine learning algorithm and are a benchmark for testing various developed models [13,18,19].
In the feature extraction approach, datasets are subject to intensive data analysis that extracts different features linking them to the ACPs and non-ACPs datasets. The properties predicted by this approach include amino acid composition (AAC), dipeptide composition (DPC), atomic composition (AC), physicochemical properties (PCP), amino acid indices (AAINDEX and BLOSUM62) and amino acid Z-scales (which are five properties of amino acids as follows: Z1: lipophilicity, Z2: steric bulk and polarizability, Z3: polarity and charge, Z4 and Z5: electronegativity, heat of formation, electrophilicity and hardness) [13,236,237,238,239,240,241,242,243].
Some of the widely used ML algorithm classifiers are support vector machines (SVM), k-nearest neighbor (KNN), random forest (RF), ensemble classifiers with a clustering and dynamic selection (LibD3C), light gradient boosting machine (LightGBM), generalized neural network (GNN) and probabilistic neural network (PNN) [244,245,246,247]. The most widely used classifier, SVM, is a group of supervised learning techniques for classifying data, conducting regression analysis and identifying outliers. Because they select the decision boundary that optimizes the distance from the nearest data points of all the classes, SVM varies from other classification techniques. The maximum margin hyperplane is the name of the decision boundary produced by SVM [244]. In the RF algorithm, instead of relying on one decision tree, the random forest takes the prediction from each tree and bases its prediction of the final output on the majority votes of predictions [248].
Classification is followed by a validation step to identify the accuracy, sensitivity, specificity and correlation coefficient of every studied case with a final suggested most accurate prediction model. Different cross-validation tests, including jackknife, k-independent and folding-based tests, have been employed in machine learning and pattern recognition to gauge the effectiveness of various predictors. Due to its exceptional outcomes, Jackknife stands out among all of these tests as being very effective and dependable, as presented in Figure 3 [249,250,251].
The SVM ML model was recently used with a balanced training dataset of 225 ACPs and 225 non-ACPs and applied on AAC and DPC as well as on a binary profile (BP) related order of amino acids features to develop AntiCP, an ML ACP model [242]. The second generation of this model, AntiCP 2.0, received a bigger training-balanced dataset of 861 ACPs and 861 non-ACPs and achieved accuracies of up to 88.8% [233]. A predictor model named MLACP [13] was developed using a Tyagi-B dataset as the training dataset and a screened HC dataset of Hajisharifi, Chen and LEE as the benchmarking dataset [243]. The RF and SMV ML classifiers with a 10-fold cross-validation method were recently employed, where the RF ML model showed an accuracy of 94.6% (0.885 Matthew’s correlation coefficient (MCC)) and 82.7% (0.674 MCC) on the HC and LEE dataset, respectively. In 2022, MLACP 2.0 was enhanced with large training and independent datasets, seven different ML classifiers on 17 different encoded features, with a final predictor model having nine features [252]. However, MLCP 2.0 has shown accuracy and MCC on an independent dataset of 76.5% and 0.513 respectively. The mACPpred machine learning model was proposed to predict ACPs with a balanced dataset of a total of 532 samples [253]. In this model, seven different encoding features are used to represent a peptide sequence and work with an SVM model to predict ACPs. The features extracted are AAC, DPC, composition–transition–distribution (CTD), quasi-sequence-order (QSO), amino acid index (AAIF), BP NC5 and conjoint triad (CTF). The best-developed predictor gave an accuracy of 91.7% and an MCC of 0.836. A highly advanced ML technique named DRACP, which reached an accuracy rate of 96%, is one in which the sequence and chemical properties of the amino acids were used to extract the feature of ACPs [254]. In this technique, the average 20 amino acid composition for a sequence was taken as a first feature. Then, based on the distribution of hydrophobic and hydrophilic residues, amino acids were divided into six groups according to their chemical properties, thus giving the second feature. These two features of ACPs were subsequently encoded using deep belief networks, and to identify the real ACPs, random relevance vector machines were employed. The effectiveness of this technique, which was shown to be reliable, was investigated on two different datasets. Many other ML predictor models were reported employing different datasets, features and ML methods, as summarized in Table 2. Some additionally developed ML models are the ACHP and the low-dimensional feature models [255,256].

7.2. Deep Learning (DL)

Several computational techniques have been proposed for the identification of ACPs, and an increasing number of machine learning algorithms, as previously discussed, are being used to build ACP predictors. Even though some of these methods have demonstrated comparatively good accuracy and robustness, selecting the proper features to capture the ACP sequences remains difficult for standard machine learning methods. DL algorithms are utilized to further increase the prediction accuracy and robustness to overcome this restriction. In DL, unlike traditional ML, the feature identification is carried out by means of AI rather than the researcher after a data embedding process in which the peptide sequence data are expressed as a matrix [19,233,234]. This is followed by the feature extraction step using DL algorithms such as convolutional neural network (CNN), long short-term memory (LSTM), attention model, recurrent neural network (RNN) and CNN-RNN [263,264]. CNN is a neural network architecture for DL that directly derives its learning from data, while RNN is a sequence model that performs input and output processing in units of sequence. Following DL feature extraction, classification is then carried out using the sigmoid dense activation function as shown in Figure 4 [234].
A long short-term neural network model (LSTM), that integrates binary profile information and a k-mer sparse matrix of the reduced amino-acid alphabet to successfully identify novel anticancer peptides was recently presented [234]. For the ACP-DL predictor, RNN was used to explicitly predict whether or not an input string of amino acids constitutes an ACP after each amino acid in each sequence is transformed into feature vectors before being fed into the LSTM. ACP-DL relies on a trained dataset ACP740 of 376 ACPs and 364 non-ACPs and an independent dataset ACP240 of 129 ACPs and 111 non-ACPs. A PTPD computational model utilizing a combination of Word2vec and CNN was shown to predict therapeutic peptides very effectively and is a notable recent advance [265]. In addition to extracting and combining various aspects, such as sequence, physicochemical and evolutionary-based features, in an interactive way for ACP identification, a new multi-headed deep convolutional neural network called ACP-MHCNN was introduced in 2020 [266]. In another approach, the DeepACP model, the predictors are built using three deep learning architectures; a CNN, a CNN-RNN and an RNN containing bidirectional long short-term memory cells (biLSTMs) [263]. The benchmark datasets of 250 ACPs and 250 non-ACPs tested against experimental findings demonstrate that the RNN architecture offers the best overall prediction performance. DeepACP results showed that biLSTMs in the RNN outperform other topologies. In order to choose the best architecture, a variety of alternate designs were created by changing the proportion of RNN cells, convolution kernels and network layers in CNNs. Benchmark and independent datasets used were similar to that of ACPred-FL. DeepACP performance was evaluated against some previously reported models on an independent dataset of 82 ACPs and 82 non-ACPs, as reported by Yu et al. [263].
The ACP-red LAF model developed in 2021 is a unique peptide representation-learning model based on learnable and adaptive embedding [264]. It uses a multi-sense and multi-scaled embedding technique that is an entirely end-to-end framework that does not require feature engineering and can automatically learn and extract sequential context features of ACPs. A multi-head attention method is applied in particular to help the model comprehend the discriminative features and enhance the feature representation capability in order to capture global information in ACP sequences. Compared to ML, ACP-red FL, a bigger and more refined balanced benchmark and independent datasets are used in DL ACP-red LAF. Upon testing ACP-red LAF on a balanced ACP-mixed-80 dataset, an accuracy of 81.15% and MCC of 0.633 was obtained compared to 74.32% and 0.519 as obtained for accuracy and MCC, respectively, by the AntiCP-DPC model. Several additional DL models are reported such as CL-ACP and more recently ACPNet [267,268].

7.3. Hybrid Approach and New Methods

Combining DL with traditional ML is performed through hybrid learning. A demonstration of data splitting of a total of 1722 samples balanced dataset, embedding and feature extraction were successfully handled by a DL hybrid learning process [19], whereas classification is handled by the traditional ML approach and testing performed on a 970 ACPs and 970 non-ACPs dataset showing an accuracy of 93.5%. On the other hand, the traditional ML approach performs data splitting and feature extraction with prediction performance improvement by means of data augmentation in ACP-DA [269]; while the multilayer perceptron (MLP) DL method performs classification. A newly introduced computational model for graph learning called ACP-GCN uses graph convolution networks to automatically and precisely predict ACPs [270]. In this approach, each peptide sample is represented as a graph, and for the first time, ACPs prediction is treated as a graph classification task. The unique model xDeep-AcPEP developed in 2021 aimed to predict the biological activity of ACPs against six tumor cells, including breast, colon, cervix, lung, skin and prostate, using a deep learning technique based on CNN [271]. This study demonstrated that learning models employing multi-tasking outperform traditional single-tasking models in terms of predictor performance. The uniqueness of this study comes from the fact that most of the prediction models of ACPs were made to sort peptides based on their amino acid sequences. On the other hand, the prediction was seen in this study as a multiclass classification problem that divides peptides into active, moderately active and inactive categories.

8. Future Prospects

Cancer treatment involves several modalities, such as surgery, chemotherapy, immunotherapy and radiotherapy. Despite such varied treatment options, cancer remains a leading cause of death globally. This highlights some inadequacies of such treatment options, which are accentuated when considering that surgery is not effective unless at an early stage and carries the risk of triggering metastasis, while chemotherapeutics generally lack specificity and may trigger cancer resistance. ACPs have shown promising performance both as diagnostic and therapeutic tools in terms of efficiency and specificity. ACPs, having originated from AMPs, carved out a distinct therapeutic role by extending our abilities in molecular targeting. The high cost of large-scale production of ACPs, their susceptibility to proteolytic cleavage and concerns about the usage of particular ACPs with sequences similar to those of human and natural AMPs due to the potential compromising of the human immune system and the possible subsequent threat to public health, are all significant drawbacks to ACPs large scale adoption. However, since ACPs are typically not targeted to specific extracellular or intracellular receptors, their use many inhibit many resistance mechanisms. This combined with their demonstrated cytotoxic efficacies against a variety of cancer types and will ensure their continued presence and development in the therapeutic anti-cancer arsenal. The success of ACPs depends on their sequences, secondary structures, net charges, amphipathicities, oligomerization abilities and high serum stabilities. Despite the absence of clear standards for ACPs design, an improved understanding of structures-activities relationships enhanced by innovative molecular representations and advanced computational approaches may provide valuable tools for advancing ACPs to theranostic success.

Author Contributions

Conceptualization, H.T. and T.S.; software, N.B.E. and T.S.; analysis, G.G., E.D. and H.T.; resources, N.B.E.; data curation, G.G., H.T., E.D. and T.S.; writing—original draft preparation, G.G., H.T. and E.D.; writing—review and editing, N.B.E., M.K.A.E.-R., M.A.A.I. and T.S; visualization, E.D. and T.S.; project coordination, T.S. All authors have read and agreed to the published version of the manuscript.

Funding

The APC was fully covered by an MDPI author voucher (73eb9a6014880d76) for which T.S. and all authors are very greatful. This research received no other external funding.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

All data used in this review are contained within the references listed.

Acknowledgments

The authors wish to thank engineer Mohamed Abd El Salam from the Petrobel Company (Egypt) for his help in creating Figure 1 using Adobe Illustrator 2022.

Conflicts of Interest

The authors declare no conflict of interest.

Abbreviations

AAC: amino acid composition; AAIF: amino acid index; AC: atomic composition; ACP: anticancer bioactive peptide; aCPP: activable cell penetrating peptides; AI: artificial intelligence; AMP: antimicrobial peptide; AUNCs: gold nanoclusters; bFGF: basic fibroblast growth factor; Boc: tert –butyloxycarbonyl; BP: binary profile; Cas: carbonic anhydrases; CNN: convolutional neural network; CPP: cell-penetrating peptide; CTC: circulating tumor cells; CTD: composition-transition-distribution; CTF: conjoint triad; DCM: dichloromethane; DL: deep learning; DPC: dipeptide composition; ELISA: enzyme-linked immunoassay; Fmoc: fluorenylmethyloxycarbonyl; GLP-1: glucagon-like peptide 1; GNN: generalized neural network; GRP: gastrin-releasing peptide; hBD3: Human β-defensin 3; HF: hydrogen fluoride; HIF: hypoxia-inducible factor; HMGB1: High mobility group box protein 1; HNP: human neutrophil peptide; ICD: immunogenic cell death; IDO: Indoleamine 2,3 Dioxygenase; KNN: k-nearest neighbor; LfcinB: Lactoferricin B; LibD3C: ensemble classifiers with a clustering and dynamic selection; LightGBM: light gradient boosting machine; LL-37: Leucine leucine-37; LPPS: liquid phase peptide synthesis; LSTM: long short-term memory; MCC: Matthew’s correlation coefficient; ML: machine learning; MSC: multiscaled embedding; MSE: multisense embedding; MSMC: multisense-scaled embedding; NT: neurotensin; PACAP: pituitary adenylate cyclase-activating peptide; PCP: physicochemical properties; PEG: polyethylene glycol; pHLIPs: pH low insertion peptides; PLA2: Phospholipase A2; PLD: Phospholipase D; PNN: probabilistic neural network; QSO: quasi-sequence-order; Ras: rat sarcoma virus; RF: random forest; RNN: recurrent neural network; ROS: reactive oxygen species; SPPS: Solid phase peptide synthesis; SVM: support vector machines; Tat: trans activator of transcription; TFA: trifluoroacetic acid; VEGF: vascular endothelial growth factor; VIP: vasoactive intestinal peptide.

References

  1. Bakare, O.O.; Gokul, A.; Wu, R.; Niekerk, L.A.; Klein, A.; Keyster, M. Biomedical Relevance of Novel Anticancer Peptides in the Sensitive Treatment of Cancer. Biomolecules 2021, 11, 1120. [Google Scholar] [CrossRef] [PubMed]
  2. Messina, C.S.; Weiher, H.; Schmidt-Wolf, I.G.H. Targeting Prostate Cancer with a Combination of WNT Inhibitors and a Bi-Functional Peptide. Anticancer Res. 2017, 37, 555–559. [Google Scholar] [CrossRef] [PubMed]
  3. Buscaill, P.; Rivas, S. Transcriptional Control of Plant Defence Responses. Curr. Opin. Plant Biol. 2014, 20, 35–46. [Google Scholar] [CrossRef] [PubMed]
  4. Taveira, G.B.; Carvalho, A.O.; Rodrigues, R.; Trindade, F.G.; da Cunha, M.; Gomes, V.M. Thionin-like Peptide from Capsicum annuum Fruits: Mechanism of Action and Synergism with Fluconazole against Candida Species Applied Microbiology. BMC Microbiol. 2016, 16, 12. [Google Scholar] [CrossRef]
  5. Banting, F.G.; Best, C.H.; Collip, J.B.; Campbell, W.R.; Fletcher, A.A. Pancreatic Extracts in the Treatment of Diabetes Mellitus. Can. Med. Assoc. J. 1922, 12, 141–146. [Google Scholar] [CrossRef]
  6. Lau, J.L.; Dunn, M.K. Therapeutic Peptides: Historical Perspectives, Current Development Trends, and Future Directions. Bioorg. Med. Chem. 2018, 26, 2700–2707. [Google Scholar] [CrossRef]
  7. Fuchs, J.A.; Grisoni, F.; Kossenjans, M.; Hiss, J.A.; Schneider, G. Lipophilicity Prediction of Peptides and Peptide Derivatives by Consensus Machine Learning. MedChemComm 2018, 9, 1538–1546. [Google Scholar] [CrossRef]
  8. Li, W.; Joshi, M.D.; Singhania, S.; Ramsey, K.H.; Murthy, A.K. Peptide Vaccine: Progress and Challenges. Vaccines 2014, 2, 515–536. [Google Scholar] [CrossRef]
  9. Verbeke, F.; de Craemer, S.; Debunne, N.; Janssens, Y.; Wynendaele, E.; van de Wiele, C.; de Spiegeleer, B. Peptides as Quorum Sensing Molecules: Measurement Techniques and Obtained Levels in Vitro and in Vivo. Front. Neurosci. 2017, 11, 183. [Google Scholar] [CrossRef]
  10. Basith, S.; Manavalan, B.; Shin, T.H.; Lee, G. IGHBP: Computational Identification of Growth Hormone Binding Proteins from Sequences Using Extremely Randomised Tree. Comput. Struct. Biotechnol. J. 2018, 16, 412–420. [Google Scholar] [CrossRef]
  11. Manavalan, B.; Shin, T.H.; Kim, M.O.; Lee, G. AIPpred: Sequence-Based Prediction of Anti-Inflammatory Peptides Using Random Forest. Front. Pharmacol. 2018, 9, 276. [Google Scholar] [CrossRef]
  12. Tesauro, D.; Accardo, A.; Diaferia, C.; Milano, V.; Guillon, J.; Ronga, L.; Rossi, F. Peptide-Based Drug-Delivery Systems in Biotechnological Applications: Recent Advances and Perspectives. Molecules 2019, 24, 351. [Google Scholar] [CrossRef] [PubMed]
  13. Manavalan, B.; Basith, S.; Shin, T.H.; Choi, S.; Kim, M.O.; Lee, G. MLACP: Machine-Learning-Based Prediction of Anticancer Peptides. Oncotarget 2017, 8, 77121. [Google Scholar] [CrossRef] [PubMed]
  14. Dias, S.A.; Freire, J.M.; Pérez-Peinado, C.; Domingues, M.M.; Gaspar, D.; Vale, N.; Gomes, P.; Andreu, D.; Henriques, S.T.; Castanho, M.A.R.B.; et al. New Potent Membrane-Targeting Antibacterial Peptides from Viral Capsid Proteins. Front. Microbiol. 2017, 8, 775. [Google Scholar] [CrossRef]
  15. Kim, J.S.; Jeong, J.H.; Kim, Y. Design, Characterization, and Antimicrobial Activity of a Novel Antimicrobial Peptide Derived from Bovine Lactophoricin. J. Microbiol. Biotechnol. 2017, 27, 759–767. [Google Scholar] [CrossRef]
  16. Iikuni, N.; Hahn, B.H.; la Cava, A. Potential for Anti-DNA Immunoglobulin Peptide Therapy in Systemic Lupus Erythematosus. Expert Opin. Biol. Ther. 2009, 9, 201–206. [Google Scholar] [CrossRef]
  17. McGovern, D.P.; Astle, A.T.; Clavin, S.L.; Newell, F.N. Task-Specific Transfer of Perceptual Learning across Sensory Modalities. Curr. Biol. 2016, 26, R20–R21. [Google Scholar] [CrossRef] [PubMed]
  18. Basith, S.; Manavalan, B.; Hwan Shin, T.; Lee, G. Machine Intelligence in Peptide Therapeutics: A next-Generation Tool for Rapid Disease Screening. Med. Res. Rev. 2020, 40, 1276–1314. [Google Scholar] [CrossRef] [PubMed]
  19. Lv, Z.; Cui, F.; Zou, Q.; Zhang, L.; Xu, L. Anticancer Peptides Prediction with Deep Representation Learning Features. Brief. Bioinform. 2021, 22, bbab008. [Google Scholar] [CrossRef]
  20. Liscano, Y.; Oñate-Garzón, J.; Delgado, J.P. Peptides with Dual Antimicrobial–Anticancer Activity: Strategies to Overcome Peptide Limitations and Rational Design of Anticancer Peptides. Molecules 2020, 25, 4245. [Google Scholar] [CrossRef]
  21. Iwasaki, T.; Ishibashi, J.; Tanaka, H.; Sato, M.; Asaoka, A.; Taylor, D.M.; Yamakawa, M. Selective Cancer Cell Cytotoxicity of Enantiomeric 9-Mer Peptides Derived from Beetle Defensins Depends on Negatively Charged Phosphatidylserine on the Cell Surface. Peptides 2009, 30, 660–668. [Google Scholar] [CrossRef]
  22. Brandenburg, L.O.; Merres, J.; Albrecht, L.J.; Varoga, D.; Pufe, T. Antimicrobial Peptides: Multifunctional Drugs for Different Applications. Polymers 2012, 4, 539–560. [Google Scholar] [CrossRef]
  23. Fernebro, J. Fighting Bacterial Infections—Future Treatment Options. Drug Resist. Updat. 2011, 14, 125–139. [Google Scholar] [CrossRef] [PubMed]
  24. Zhong, C.; Zhang, L.; Yu, L.; Huang, J.; Huang, S.; Yao, Y. A Review for Antimicrobial Peptides with Anticancer Properties: Re-Purposing of Potential Anticancer Agents. BIO Integr. 2020, 1, 156–167. [Google Scholar] [CrossRef]
  25. Rozek, T.; Wegener, K.L.; Bowie, J.H.; Olver, I.N.; Carver, J.A.; Wallace, J.C.; Tyler, M.J. The Antibiotic and Anticancer Active Aurein Peptides from the Australian Bell Frogs Litoria Aurea and Litoria Raniformis: The Solution Structure of Aurein 1.2. Eur. J. Biochem. 2000, 267, 5330–5341. [Google Scholar] [CrossRef]
  26. Yang, S.; Lee, C.W.; Kim, H.J.; Jung, H.-H.; Kim, J.I.; Shin, S.Y.; Shin, S.-H. Structural Analysis and Mode of Action of BMAP-27, a Cathelicidin-Derived Antimicrobial Peptide. Peptides 2019, 118, 170106. [Google Scholar] [CrossRef]
  27. Hoskin, D.W.; Ramamoorthy, A. Studies on Anticancer Activities of Antimicrobial Peptides. Biochim. Biophys. Acta (BBA)-Biomembr. 2008, 1778, 357–375. [Google Scholar] [CrossRef]
  28. Li, B.; Lyu, P.; Xie, S.; Qin, H.; Pu, W.; Xu, H.; Chen, T.; Shaw, C.; Ge, L.; Kwok, H.F. LFB: A Novel Antimicrobial Brevinin-like Peptide from the Skin Secretion of the Fujian Large Headed Frog, Limnonectes Fujianensi. Biomolecules 2019, 9, 242. [Google Scholar] [CrossRef]
  29. Ye, J.S.; Zheng, X.J.; Leung, K.W.; Chen, H.M.; Sheu, F.S. Induction of Transient Ion Channel-like Pores in a Cancer Cell by Antibiotic Peptide. J. Biochem. 2004, 136, 255–259. [Google Scholar] [CrossRef]
  30. Chen, H.M.; Wang, W.; Smith, D.; Chan, S.C. Effects of the Anti-Bacterial Peptide Cecropin B and Its Analogs, Cecropins B-1 and B-2, on Liposomes, Bacteria, and Cancer Cells. Biochim. Biophys. Acta Gen. Subj. 1997, 1336, 171–179. [Google Scholar] [CrossRef]
  31. Doyle, J.; Brinkworth, C.S.; Wegener, K.L.; Carver, J.A.; Llewellyn, L.E.; Olver, I.N.; Bowie, J.H.; Wabnitz, P.A.; Tyler, M.J. NNOS Inhibition, Antimicrobial and Anticancer Activity of the Amphibian Skin Peptide, Citropin 1.1 and Synthetic Modifications: The Solution Structure of a Modified Citropin 1.1. Eur. J. Biochem. 2003, 270, 1141–1153. [Google Scholar] [CrossRef] [PubMed]
  32. Piotrowska, U.; Oledzka, E.; Zgadzaj, A.; Bauer, M.; Sobczak, M. A Novel Delivery System for the Controlled Release~ of Antimicrobial Peptides: Citropin 1.1 and Temporin A. Polymers 2018, 10, 489. [Google Scholar] [CrossRef]
  33. Papo, N.; Braunstein, A.; Eshhar, Z.; Shai, Y. Suppression of Human Prostate Tumor Growth in Mice by a Cytolytic D-, L-Amino Acid Peptide: Membrane Lysis, Increased Necrosis, and Inhibition of Prostate-Specific Antigen Secretion. Cancer Res. 2004, 64, 5779–5786. [Google Scholar] [CrossRef]
  34. Won, H.S.; Seo, M.D.; Jung, S.J.; Lee, S.J.; Kang, S.J.; Son, W.S.; Kim, H.J.; Park, T.K.; Park, S.J.; Lee, B.J. Structural Determinants for the Membrane Interaction of Novel Bioactive Undecapeptides Derived from Gaegurin 5. J. Med. Chem. 2006, 49, 4886–4895. [Google Scholar] [CrossRef] [PubMed]
  35. Won, H.-S.; Kang, S.-J.; Lee, B.-J. Action Mechanism and Structural Requirements of the Antimicrobial Peptides, Gaegurins. Biochim. Biophys. Acta (BBA)—Biomembr. 2009, 1788, 1620–1629. [Google Scholar] [CrossRef]
  36. Mandke, P.; Vasquez, K.M. Interactions of High Mobility Group Box Protein 1 (HMGB1) with Nucleic Acids: Implications in DNA Repair and Immune Responses. DNA Repair 2019, 83, 102701. [Google Scholar] [CrossRef] [PubMed]
  37. Ye, Y.; Zeng, Z.; Jin, T.; Zhang, H.; Xiong, X.; Gu, L. The Role of High Mobility Group Box 1 in Ischemic Stroke. Front. Cell. Neurosci. 2019, 13, 127. [Google Scholar] [CrossRef]
  38. PepDraw. Available online: http://www2.tulane.edu/~biochem/WW/PepDraw/index.html (accessed on 21 December 2022).
  39. Fruitwala, S.; El-Naccache, D.W.; Chang, T.L. Multifaceted Immune Functions of Human Defensins and Underlying Mechanisms. Semin. Cell Dev. Biol. 2019, 88, 163–172. [Google Scholar] [CrossRef] [PubMed]
  40. Liu, S.; Zhou, L.; Li, J.; Suresh, A.; Verma, C.; Foo, Y.H.; Yap, E.P.H.; Tan, D.T.H.; Beuerman, R.W. Linear Analogues of Human β-Defensin 3: Concepts for Design of Antimicrobial Peptides with Reduced Cytotoxicity to Mammalian Cells. ChemBioChem 2008, 9, 964–973. [Google Scholar] [CrossRef]
  41. Hwang, P.M.; Zhou, N.; Shan, X.; Arrowsmith, C.H.; Vogel, H.J. Three-Dimensional Solution Structure of Lactoferricin B, an Antimicrobial Peptide Derived from Bovine Lactoferrin. Biochemistry 1998, 37, 4288–4298. [Google Scholar] [CrossRef]
  42. Aghazadeh, H.; Memariani, H.; Ranjbar, R.; Pooshang Bagheri, K. The Activity and Action Mechanism of Novel Short Selective LL-37-Derived Anticancer Peptides against Clinical Isolates of Escherichia Coli. Chem. Biol. Drug Des. 2019, 93, 75–83. [Google Scholar] [CrossRef] [PubMed]
  43. Pinto, I.B.; dos Santos Machado, L.; Meneguetti, B.T.; Nogueira, M.L.; Espínola Carvalho, C.M.; Roel, A.R.; Franco, O.L. Utilization of Antimicrobial Peptides, Analogues and Mimics in Creating Antimicrobial Surfaces and Bio-Materials. Biochem. Eng. J. 2019, 150, 107237. [Google Scholar] [CrossRef]
  44. Frey, S.; Tamm, L.K. Orientation of Melittin in Phospholipid Bilayers. A Polarized Attenuated Total Reflection Infrared Study. Biophys. J. 1991, 60, 922–930. [Google Scholar] [CrossRef]
  45. Kim, Y.; Hahm, K.S.; Lee, D.; Lee, M.; Lee, S.H.; Kim, J.; Song, W.; Eom, S.; Park, E.; Yang, S.T.; et al. Antibacterial, Antitumor and Hemolytic Activities of α-Helical Antibiotic Peptide, P18 and Its Analogs. J. Pept. Res. 2001, 58, 504–514. [Google Scholar] [CrossRef]
  46. Chan, Y.R.; Gallo, R.L. PR-39, a Syndecan-Inducing Antimicrobial Peptide, Binds and Affects P130(Cas). J. Biol. Chem. 1998, 273, 28978–28985. [Google Scholar] [CrossRef] [PubMed]
  47. Jiang, M.; Chen, R.; Zhang, J.; Chen, F.; Wang, K.-J. A Novel Antimicrobial Peptide Spampcin56–86 from Scylla paramamosain Exerting Rapid Bactericidal and Anti-Biofilm Activity In Vitro and Anti-Infection In Vivo. Int. J. Mol. Sci. 2022, 23, 13316. [Google Scholar] [CrossRef]
  48. Nakamura, T.; Furunaka, H.; Miyata, T.; Tokunaga, F.; Muta, T.; Iwanaga, S.; Niwa, M.; Takao, T.; Shimonishi, Y. Tachyplesin, a Class of Antimicrobial Peptide from the Hemocytes of the Horseshoe Crab (Tachypleus Tridentatus). Isolation and Chemical Structure. J. Biol. Chem. 1988, 263, 16709–16713. [Google Scholar] [CrossRef]
  49. Risso, A.; Zanetti, M.; Gennaro, R. Cytotoxicity and Apoptosis Mediated by Two Peptides of Innate Immunity. Cell. Immunol. 1998, 189, 107–115. [Google Scholar] [CrossRef]
  50. McManus, A.M.; Otvos, L.; Hoffmann, R.; Craik, D.J. Conformational Studies by NMR of the Antimicrobial Peptide, Drosocin, and Its Non-Glycosylated Derivative: Effects of Glycosylation on Solution Conformation. Biochemistry 1999, 38, 705–714. [Google Scholar] [CrossRef]
  51. Sørensen, O.E.; Follin, P.; Johnsen, A.H.; Calafat, J.; Sandra Tjabringa, G.; Hiemstra, P.S.; Borregaard, N. Human Cathelicidin, HCAP-18, Is Processed to the Antimicrobial Peptide LL-37 by Extracellular Cleavage with Proteinase 3. Blood 2001, 97, 3951–3959. [Google Scholar] [CrossRef]
  52. Sørensen, O.; Arnljots, K.; Cowland, J.B.; Bainton, D.F.; Borregaard, N. The Human Antibacterial Cathelicidin, HCAP-18, Is Synthesized in Myelocytes and Metamyelocytes and Localized to Specific Granules in Neutrophils. Blood 1997, 90, 2796–2803. [Google Scholar] [CrossRef] [PubMed]
  53. Nilsson, M.F.; Sandstedt, B.; Sørensen, O.; Weber, G.; Borregaard, N.; Ståhle-Bäckdahl, M. The Human Cationic Antimicrobial Protein (HCAP18), a Peptide Antibiotic, Is Widely Expressed in Human Squamous Epithelia and Colocalizes with Interleukin-6. Infect. Immun. 1999, 67, 2561–2566. [Google Scholar] [CrossRef] [PubMed]
  54. Jin, G.; Weinberg, A. Human Antimicrobial Peptides and Cancer. Semin. Cell Dev. Biol. 2019, 88, 156–162. [Google Scholar] [CrossRef] [PubMed]
  55. Niyonsaba, F.; Iwabuchi, K.; Someya, A.; Hirata, M.; Matsuda, H.; Ogawa, H.; Nagaoka, I. A Cathelicidin Family of Human Antibacterial Peptide LL-37 Induces Mast Cell Chemotaxis. Immunology 2002, 106, 20–26. [Google Scholar] [CrossRef]
  56. Carretero, M.; Escámez, M.J.; García, M.; Duarte, B.; Holguín, A.; Retamosa, L.; Jorcano, J.L.; del Río, M.; Larcher, F. In Vitro and in Vivo Wound Healing-Promoting Activities of Human Cathelicidin LL-37. J. Investig. Dermatol. 2008, 128, 223–236. [Google Scholar] [CrossRef] [PubMed]
  57. Steiner, H.; Hultmark, D.; Engström, Å.; Bennich, H.; Boman, H.G. Sequence and Specificity of Two Antibacterial Proteins Involved in Insect Immunity. Nature 1981, 292, 246–248. [Google Scholar] [CrossRef]
  58. Lee, J.Y.; Boman, A.; Chuanxin, S.; Andersson, M.; Jornvall, H.; Mutt, V.; Boman, H.G. Antibacterial Peptides from Pig Intestine: Isolation of a Mammalian Cecropin. Proc. Natl. Acad. Sci. USA 1989, 86, 9159–9162. [Google Scholar] [CrossRef]
  59. Boman, H.G.; Hultmark, D. Cell-Free Immunity in Insects. Annu. Rev. Microbiol. 1987, 41, 103–126. [Google Scholar] [CrossRef]
  60. Chan, S.C.; Yau, W.L.; Wang, W.; Smith, D.K.; Sheu, F.S.; Chen, H.M. Microscopic Observations of the Different Morphological Changes Caused by Anti-Bacterial Peptides on Klebsiella Pneumoniae and HL-60 Leukemia Cells. J. Pept. Sci. 1998, 4, 413–425. [Google Scholar] [CrossRef]
  61. Kim, S.; Kim, S.S.; Bang, Y.J.; Kim, S.J.; Lee, B.J. In Vitro Activities of Native and Designed Peptide Antibiotics against Drug Sensitive and Resistant Tumor Cell Lines. Peptides 2003, 24, 945–953. [Google Scholar] [CrossRef]
  62. Cruciani, R.A.; Barker, J.L.; Zasloff, M.; Chen, H.C.; Colamonici, O. Antibiotic Magainins Exert Cytolytic Activity against Transformed Cell Lines through Channel Formation. Proc. Natl. Acad. Sci. USA 1991, 88, 3792–3796. [Google Scholar] [CrossRef] [PubMed]
  63. Cruz-Chamorro, L.; Puertollano, M.A.; Puertollano, E.; de Cienfuegos, G.Á.; de Pablo, M.A. In Vitro Biological Activities of Magainin Alone or in Combination with Nisin. Peptides 2006, 27, 1201–1209. [Google Scholar] [CrossRef] [PubMed]
  64. Zasloff, M. Magainins, a Class of Antimicrobial Peptides from Xenopus Skin: Isolation, Characterization of Two Active Forms, and Partial CDNA Sequence of a Precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef] [PubMed]
  65. Jacob, L.; Zasloff, M. Potential Therapeutic Applications of Magainins and Other Antimicrobial Agents of Animal Origin. In Ciba Foundation Symposium; Wiley: Hoboken, NJ, USA, 1994; Volume 186. [Google Scholar]
  66. Baker, M.A.; Maloy, W.L.; Zasloff, M.; Jacob, L.S. Anticancer Efficacy of Magainin2 and Analogue Peptides. Cancer Res. 1993, 53, 3052–3057. [Google Scholar]
  67. Lehmann, J.; Retz, M.; Sidhu, S.S.; Suttmann, H.; Sell, M.; Paulsen, F.; Harder, J.; Unteregger, G.; Stöckle, M. Antitumor Activity of the Antimicrobial Peptide Magainin II against Bladder Cancer Cell Lines. Eur. Urol. 2006, 50, 141–147. [Google Scholar] [CrossRef]
  68. Park, J.M.; Jung, J.E.; Lee, B.J. Antimicrobial Peptides from the Skin of a Korean Frog, Rana Rugosa. Biochem. Biophys. Res. Commun. 1994, 205, 948–954. [Google Scholar] [CrossRef]
  69. Gauldie, J.; Hanson, J.M.; Shipolini, R.A.; Vernon, C.A. The Structures of Some Peptides from Bee Venom. Eur. J. Biochem. 1978, 83, 405–410. [Google Scholar] [CrossRef]
  70. Habermann, E.; Jentsch, J. Sequenzanalyse Des Melittins Aus Den Tryptischen Und Peptischen Spaltstücken. Hoppe Seylers Z. Physiol. Chem. 1967, 348, 37–50. [Google Scholar] [CrossRef]
  71. Tosteson, M.T.; Tosteson, D.C. The Sting. Melittin Forms Channels in Lipid Bilayers. Biophys. J. 1981, 36, 109–116. [Google Scholar] [CrossRef]
  72. Tosteson, M.T.; Holmes, S.J.; Razin, M.; Tosteson, D.C. Melittin Lysis of Red Cells. J. Membr. Biol. 1985, 87, 35–44. [Google Scholar] [CrossRef]
  73. Papo, N.; Shai, Y. Host Defense Peptides as New Weapons in Cancer Treatment. Cell. Mol. Life Sci. 2005, 62, 784–790. [Google Scholar] [CrossRef] [PubMed]
  74. Schweizer, F. Cationic Amphiphilic Peptides with Cancer-Selective Toxicity. Eur. J. Pharmacol. 2009, 625, 190–194. [Google Scholar] [CrossRef]
  75. Lehrer, R.I.; Lichtenstein, A.K.; Ganz, T. Defensins: Antimicrobial and Cytotoxic Peptides of Mammalian Cells. Annu. Rev. Immunol. 1993, 11, 105–128. [Google Scholar] [CrossRef] [PubMed]
  76. Arceo-Martinez, M.T.; Guzmán-Rodríguez, J.; Palomera-Sánchez, Z.; Ochoa-Zarzosa, A.; López-Meza, J.E. Defensin Γ-Thionin from Capsicum Chinense Induces Apoptosis in the Human Breast Cancer Cell Line MCF-7 and Regulate Histone H3 Epigenetic Modifications. FASEB J. 2018, 32, 804–833. [Google Scholar] [CrossRef]
  77. Zasloff, M. Antimicrobial Peptides of Multicellular Organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef]
  78. Dhople, V.; Krukemeyer, A.; Ramamoorthy, A. The Human Beta-Defensin-3, an Antibacterial Peptide with Multiple Biological Functions. Biochim. Biophys. Acta Biomembr. 2006, 1758, 1499–1512. [Google Scholar] [CrossRef] [PubMed]
  79. Martin, E.; Ganz, T.; Lehrer, R.I. Defensins and Other Endogenous Peptide Antibiotics of Vertebrates. J. Leukoc. Biol. 1995, 58, 128–136. [Google Scholar] [CrossRef]
  80. Selsted, M.E.; Harwig, S.S.L. Determination of the Disulfide Array in the Human Defensin HNP-2. A Covalently Cyclized Peptide. J. Biol. Chem. 1989, 264, 4003–4007. [Google Scholar] [CrossRef]
  81. Hill, C.P.; Yee, J.; Selsted, M.E.; Eisenberg, D. Crystal Structure of Defensin HNP-3, an Amphiphilic Dimer: Mechanisms of Membrane Permeabilization. Science (1979) 1991, 251, 1481–1485. [Google Scholar] [CrossRef]
  82. Ganz, T.; Selsted, M.E.; Szklarek, D.; Harwig, S.S.; Daher, K.; Bainton, D.F.; Lehrer, R.I. Defensins. Natural Peptide Antibiotics of Human Neutrophils. J. Clin. Investig. 1985, 76, 1427–1435. [Google Scholar] [CrossRef]
  83. Szyk, A.; Wu, Z.; Tucker, K.; Yang, D.; Lu, W.; Lubkowski, J. Crystal Structures of Human α-Defensins HNP4, HD5, and HD6. Protein Sci. 2006, 15, 2749–2760. [Google Scholar] [CrossRef]
  84. Bellamy, W.; Takase, M.; Yamauchi, K.; Wakabayashi, H.; Kawase, K.; Tomita, M. Identification of the Bactericidal Domain of Lactoferrin. Biochim. Biophys. Acta (BBA) Protein Struct. Mol. 1992, 1121, 130–136. [Google Scholar] [CrossRef]
  85. Eliassen, L.T.; Berge, G.; Leknessund, A.; Wikman, M.; Lindin, I.; Løkke, C.; Ponthan, F.; Johnsen, J.I.; Sveinbjørnsson, B.; Kogner, P.; et al. The Antimicrobial Peptide, Lactoferricin B, Is Cytotoxic to Neuroblastoma Cells in Vitro and Inhibits Xenograft Growth in Vivo. Int. J. Cancer 2006, 119, 493–500. [Google Scholar] [CrossRef] [PubMed]
  86. Furlong, S.J.; Ridgway, N.D.; Hoskin, D.W. Modulation of Ceramide Metabolism in T-Leukemia Cell Lines Potentiates Apoptosis Induced by the Cationic Antimicrobial Peptide Bovine Lactoferricin. Int. J. Oncol. 2008, 32, 537–544. [Google Scholar] [CrossRef] [PubMed]
  87. Yoo, Y.C.; Watanabe, R.; Koike, Y.; Mitobe, M.; Shimazaki, K.I.; Watanabe, S.; Azuma, I. Apoptosis in Human Leukemic Cells Induced by Lactoferricin, a Bovine Milk Protein-Derived Peptide: Involvement of Reactive Oxygen Species. Biochem. Biophys. Res. Commun. 1997, 237, 624–628. [Google Scholar] [CrossRef] [PubMed]
  88. Tone Eliassen, L.; Berge, G.; Sveinbjørnsson, B.; Svendsen, J.S.; Vorland, L.H.; Rekdal, Ø. Evidence for a Direct Antitumor Mechanism of Action of Bovine Lactoferricin. Anticancer Res. 2002, 22, 2703–2710. [Google Scholar]
  89. Mader, J.S.; Salsman, J.; Conrad, D.M.; Hoskin, D.W. Bovine Lactoferricin Selectively Induces Apoptosis in Human Leukemia and Carcinoma Cell Lines. Mol. Cancer Ther. 2005, 4, 612–624. [Google Scholar] [CrossRef]
  90. Furlong, S.J.; Mader, J.S.; Hoskin, D.W. Lactoferricin-Induced Apoptosis in Estrogen-Nonresponsive MDA-MB-435 Breast Cancer Cells Is Enhanced by C6 Ceramide or Tamoxifen. Oncol. Rep. 2006, 15, 1385–1390. [Google Scholar] [CrossRef]
  91. Mader, J.S.; Smyth, D.; Marshall, J.; Hoskin, D.W. Bovine Lactoferricin Inhibits Basic Fibroblast Growth Factor- and Vascular Endothelial Growth Factor165-Induced Angiogenesis by Competing for Heparin-like Binding Sites on Endothelial Cells. Am. J. Pathol. 2006, 169, 1753–1766. [Google Scholar] [CrossRef]
  92. Rao, A.G. Conformation and Antimicrobial Activity of Linear Derivatives of Tachyplesin Lacking Disulfide Bonds. Arch. Biochem. Biophys. 1999, 361, 127–134. [Google Scholar] [CrossRef]
  93. Ramamoorthy, A.; Thennarasu, S.; Tan, A.; Gottipati, K.; Sreekumar, S.; Heyl, D.L.; An, F.Y.P.; Shelburne, C.E. Deletion of All Cysteines in Tachyplesin I Abolishes Hemolytic Activity and Retains Antimicrobial Activity and Lipopolysaccharide Selective Binding. Biochemistry 2006, 45, 6529–6540. [Google Scholar] [CrossRef]
  94. Agerberth, B.; Lee, J.-Y.; Bergman, T.; Carlquist, M.; Boman, H.G.; Mutt, V.; Jörnvall, H. Amino Acid Sequence of PR-39: Isolation from Pig Intestine of a New Member of the Family of Proline-arginine-rich Antibacterial Peptides. Eur. J. Biochem. 1991, 202, 849–854. [Google Scholar] [CrossRef]
  95. Shi, J.; Ross, C.R.; Chengappa, M.M.; Sylte, M.J.; McVey, D.S.; Blecha, F. Antibacterial Activity of a Synthetic Peptide (PR-26) Derived from PR-39, a Proline-Arginine-Rich Neutrophil Antimicrobial Peptide. Antimicrob. Agents Chemother. 1996, 40, 115–121. [Google Scholar] [CrossRef]
  96. Shin, S.Y.; Lee, M.K.; Kim, K.L.; Hahm, K.S. Structure-Antitumor and Hemolytic Activity Relationships of Synthetic Peptides Derived from Cecropin A-Magainin 2 and Cecropin A-Melittin Hybrid Peptides. J. Pept. Res. 1997, 50, 279–285. [Google Scholar] [CrossRef]
  97. Shin, S.Y.; Kang, J.H.; Hahm, K.S. Structure-Antibacterial, Antitumor and Hemolytic Activity Relationships of Cecropin A-Magainin 2 and Cecropin A-Melittin Hybrid Peptides. J. Pept. Res. 1999, 53, 82–90. [Google Scholar] [CrossRef]
  98. Oh, D.; Shin, S.Y.; Kang, J.H.; Hahm, K.S.; Kim, K.L.; Kim, Y. NMR Structural Characterization of Cecropin A(1-8)—Magainin 2(1-12) and Cecropin A(1-8)—Melittin(1-12) Hybrid Peptides. J. Pept. Res. 1999, 53, 578–589. [Google Scholar] [CrossRef]
  99. Oren, Z.; Hong, J.; Shai, Y. A Repertoire of Novel Antibacterial Diastereomeric Peptides with Selective Cytolytic Activity. J. Biol. Chem. 1997, 272, 14643–14649. [Google Scholar] [CrossRef] [PubMed]
  100. Papo, N.; Shai, Y. New Lytic Peptides Based on the D,L-Amphipathic Helix Motif Preferentially Kill Tumor Cells Compared to Normal Cells. Biochemistry 2003, 42, 9346–9354. [Google Scholar] [CrossRef] [PubMed]
  101. Papo, N.; Shahar, M.; Eisenbach, L.; Shai, Y. A Novel Lytic Peptide Composed of DL-Amino Acids Selectively Kills Cancer Cells in Culture and in Mice. J. Biol. Chem. 2003, 278, 21018–21023. [Google Scholar] [CrossRef]
  102. Papo, N.; Seger, D.; Makovitzki, A.; Kalchenko, V.; Eshhar, Z.; Degani, H.; Shai, Y. Inhibition of Tumor Growth and Elimination of Multiple Metastases in Human Prostate and Breast Xenografts by Systemic Inoculation of a Host Defense-like Lytic Peptide. Cancer Res. 2006, 66, 5371–5378. [Google Scholar] [CrossRef] [PubMed]
  103. Sloballe, P.W.; Lee Maloy, W.; Myrga, M.L.; Jacob, L.S.; Herlyn, M. Experimental Local Therapy of Human Melanoma with Lytic Magainin Peptides. Int. J. Cancer 1995, 60, 280–284. [Google Scholar] [CrossRef]
  104. Ohsaki, Y.; Gazdar, A.F.; Chen, H.C.; Johnson, B.E. Antitumor Activity of Magainin Analogues against Human Lung Cancer Cell Lines. Cancer Res. 1992, 52, 3534–3538. [Google Scholar]
  105. Shin, S.Y.; Kang, J.H.; Jang, S.Y.; Kim, Y.; Kim, K.L.; Hahm, K.S. Effects of the Hinge Region of Cecropin A(1-8)-Magainin 2(1-12), a Synthetic Antimicrobial Peptide, on Liposomes, Bacterial and Tumor Cells. Biochim. Biophys. Acta Biomembr. 2000, 1463, 209–218. [Google Scholar] [CrossRef]
  106. Eliassen, L.T.; Haug, B.E.; Berge, G.; Rekdal, Ø. Enhanced Antitumour Activity of 15-Residue Bovine Lactoferricin Derivatives Containing Bulky Aromatic Amino Acids and Lipophilic N-Terminal Modifications. J. Pept. Sci. 2003, 9, 510–517. [Google Scholar] [CrossRef] [PubMed]
  107. Yang, N.; Strøm, M.B.; Mekonnen, S.M.; Svendsen, J.S.; Rekdal, Ø. The Effects of Shortening Lactoferrin Derived Peptides against Tumour Cells, Bacteria and Normal Human Cells. J. Pept. Sci. 2004, 10, 37–46. [Google Scholar] [CrossRef]
  108. Gifford, J.L.; Hunter, H.N.; Vogel, H.J. Lactoferricin: A Lactoferrin-Derived Peptide with Antimicrobial, Antiviral, Antitumor and Immunological Properties. Cell. Mol. Life Sci. 2005, 62, 2588–2598. [Google Scholar] [CrossRef] [PubMed]
  109. Ellerby, H.M.; Arap, W.; Ellerby, L.M.; Kain, R.; Andrusiak, R.; del Rio, G.; Krajewski, S.; Lombardo, C.R.; Rao, R.; Ruoslahti, E.; et al. Anti-Cancer Activity of Targeted pro-Apoptotic Peptides. Nat. Med. 1999, 5, 1032–1038. [Google Scholar] [CrossRef] [PubMed]
  110. Droin, N.; Hendra, J.B.; Ducoroy, P.; Solary, E. Human Defensins as Cancer Biomarkers and Antitumour Molecules. J. Proteom. 2009, 72, 918–927. [Google Scholar] [CrossRef]
  111. Baxter, A.A.; Lay, F.T.; Poon, I.K.H.; Kvansakul, M.; Hulett, M.D. Tumor Cell Membrane-Targeting Cationic Antimicrobial Peptides: Novel Insights into Mechanisms of Action and Therapeutic Prospects. Cell. Mol. Life Sci. 2017, 74, 3809–3825. [Google Scholar] [CrossRef]
  112. Felício, M.R.; Silva, O.N.; Gonçalves, S.; Santos, N.C.; Franco, O.L. Peptides with Dual Antimicrobial and Anticancer Activities. Front. Chem. 2017, 5, 5. [Google Scholar] [CrossRef] [PubMed]
  113. Raman, K.; Kuberan, B. Chemical Tumor Biology of Heparan Sulfate Proteoglycans. Curr. Chem. Biol. 2010, 4, 20–31. [Google Scholar] [CrossRef]
  114. Chan, S.C.; Hui, L.; Chen, H.M. Enhancement of the Cytolytic Effect of Anti-Bacterial Cecropin by the Microvilli of Cancer Cells. Anticancer Res. 1998, 18, 4467–4474. [Google Scholar] [PubMed]
  115. Kunda, N.K. Antimicrobial Peptides as Novel Therapeutics for Non-Small Cell Lung Cancer. Drug Discov. Today 2020, 25, 238–247. [Google Scholar] [CrossRef] [PubMed]
  116. Piotrowska, U.; Sobczak, M.; Oledzka, E. Current State of a Dual Behaviour of Antimicrobial Peptides—Therapeutic Agents and Promising Delivery Vectors. Chem. Biol. Drug Des. 2017, 90, 1079–1093. [Google Scholar] [CrossRef] [PubMed]
  117. Sitaram, N.; Nagaraj, R. Interaction of Antimicrobial Peptides with Biological and Model Membranes: Structural and Charge Requirements for Activity. Biochim. Biophys. Acta Biomembr. 1999, 1462, 29–54. [Google Scholar] [CrossRef] [PubMed]
  118. Ebenhan, T.; Gheysens, O.; Kruger, H.G.; Zeevaart, J.R.; Sathekge, M.M. Antimicrobial Peptides: Their Role as Infection-Selective Tracers for Molecular Imaging. Biomed. Res. Int. 2014, 2014, 867381. [Google Scholar] [CrossRef] [PubMed]
  119. Borrelli, A.; Tornesello, A.L.; Tornesello, M.L.; Buonaguro, F.M. Cell Penetrating Peptides as Molecular Carriers for Anti-Cancer Agents. Molecules 2018, 23, 295. [Google Scholar] [CrossRef]
  120. Järvå, M.; Lay, F.T.; Phan, T.K.; Humble, C.; Poon, I.K.H.; Bleackley, M.R.; Anderson, M.A.; Hulett, M.D.; Kvansakul, M. X-ray Structure of a Carpet-like Antimicrobial Defensin-Phospholipid Membrane Disruption Complex. Nat. Commun. 2018, 9, 1962. [Google Scholar] [CrossRef] [PubMed]
  121. Shai, Y. Molecular Recognition between Membrane-Spanning Polypeptides. Trends Biochem. Sci. 1995, 20, 460–464. [Google Scholar] [CrossRef]
  122. Epand, R.M.; Shai, Y.; Segrest, J.P.; Anantharamiah, G.M. Mechanisms for the Modulation of Membrane Bilayer Properties by Amphipathic Helical Peptides. Biopolymers 1995, 37, 319–338. [Google Scholar] [CrossRef]
  123. Gaspar, D.; Salomé Veiga, A.; Castanho, M.A.R.B. From Antimicrobial to Anticancer Peptides. A Review. Front. Microbiol. 2013, 4, 294. [Google Scholar] [CrossRef]
  124. Mader, J.S.; Richardson, A.; Salsman, J.; Top, D.; de Antueno, R.; Duncan, R.; Hoskin, D.W. Bovine Lactoferricin Causes Apoptosis in Jurkat T-Leukemia Cells by Sequential Permeabilization of the Cell Membrane and Targeting of Mitochondria. Exp. Cell Res. 2007, 313, 2634–2650. [Google Scholar] [CrossRef]
  125. Oren, Z.; Shai, Y. Mode of Action of Linear Amphipathic α-Helical Antimicrobial Peptides. Biopolymers 1998, 47, 451–463. [Google Scholar] [CrossRef]
  126. Last, N.B.; Schlamadinger, D.E.; Miranker, A.D. A Common Landscape for Membraneactive Peptides. Protein Sci. 2013, 22, 870–882. [Google Scholar] [CrossRef]
  127. Henzler Wildman, K.A.; Lee, D.K.; Ramamoorthy, A. Mechanism of Lipid Bilayer Disruption by the Human Antimicrobial Peptide, LL-37. Biochemistry 2003, 42, 6545–6558. [Google Scholar] [CrossRef]
  128. Okumura, K.; Itoh, A.; Isogai, E.; Hirose, K.; Hosokawa, Y.; Abiko, Y.; Shibata, T.; Hirata, M.; Isogai, H. C-Terminal Domain of Human CAP18 Antimicrobial Peptide Induces Apoptosis in Oral Squamous Cell Carcinoma SAS-H1 Cells. Cancer Lett. 2004, 212, 185–194. [Google Scholar] [CrossRef] [PubMed]
  129. Mader, J.S.; Mookherjee, N.; Hancock, R.E.W.; Bleackley, R.C. The Human Host Defense Peptide LL-37 Induces Apoptosis in a Calpain- and Apoptosis-Inducing Factor-Dependent Manner Involving Bax Activity. Mol. Cancer Res. 2009, 7, 689–702. [Google Scholar] [CrossRef]
  130. Tornesello, A.L.; Borrelli, A.; Buonaguro, L.; Buonaguro, F.M.; Tornesello, M.L. Antimicrobial Peptides as Anticancer Agents: Functional Properties and Biological Activities. Molecules 2020, 25, 2850. [Google Scholar] [CrossRef] [PubMed]
  131. Müller, C.A.; Markovic-Lipkovski, J.; Klatt, T.; Gamper, J.; Schwarz, G.; Beck, H.; Deeg, M.; Kalbacher, H.; Widmann, S.; Wessels, J.T.; et al. Human α-Defensins HNPs-1, -2, and -3 in Renal Cell Carcinoma: Influences on Tumor Cell Proliferation. Am. J. Pathol. 2002, 160, 1311–1324. [Google Scholar] [CrossRef] [PubMed]
  132. Kagan, B.L.; Selsted, M.E.; Ganz, T.; Lehrer, R.I. Antimicrobial Defensin Peptides Form Voltage-Dependent Ion-Permeable Channels in Planar Lipid Bilayer Membranes. Proc. Natl. Acad. Sci. USA 1990, 87, 210–214. [Google Scholar] [CrossRef]
  133. Gera, J.F.; Lichtenstein, A. Human Neutrophil Peptide Defensins Induce Single Strand DNA Breaks in Target Cells. Cell. Immunol. 1991, 138, 108–120. [Google Scholar] [CrossRef]
  134. Chavakis, T.; Cines, D.B.; Rhee, J.-S.; Liang, O.D.; Schubert, U.; Hammes, H.-P.; Higazi, A.A.-R.; Nawroth, P.P.; Preissner, K.T.; Bdeir, K. Regulation of Neovascularization by Human Neutrophil Peptides (A-defensins): A Link between Inflammation and Angiogenesis. FASEB J. 2004, 18, 1306–1308. [Google Scholar] [CrossRef] [PubMed]
  135. Lichtenstein, A.; Ganz, T.; Selsted, M.E.; Lehrer, R.I. In Vitro Tumor Cell Cytolysis Mediated by Peptide Defensins of Human and Rabbit Granulocytes. Blood 1986, 68, 1407–1410. [Google Scholar] [CrossRef] [PubMed]
  136. Nishimura, M.; Abiko, Y.; Kurashige, Y.; Takeshima, M.; Yamazaki, M.; Kusano, K.; Saitoh, M.; Nakashima, K.; Inoue, T.; Kaku, T. Effect of Defensin Peptides on Eukaryotic Cells: Primary Epithelial Cells, Fibroblasts and Squamous Cell Carcinoma Cell Lines. J. Dermatol. Sci. 2004, 36, 87–95. [Google Scholar] [CrossRef] [PubMed]
  137. Lichtenstein, A.K.; Ganz, T.; Nguyen, T.-M.; Selsted, M.E.; Lehrer, R.I. Mechanism of Target Cytolysis by Peptide Defensins. Target Cell Metabolic Activities, Possibly Involving Endocytosis, Are Crucial for Expression of Cytotoxicity. J. Immunol. 1988, 140, 2686–2694. [Google Scholar] [CrossRef]
  138. Hancock, R.E.W.; Chapple, D.S. Peptide Antibiotics. Antimicrob. Agents Chemother. 1999, 43, 1317–1323. [Google Scholar] [CrossRef] [PubMed]
  139. Sharma, S.V. Melittin Resistance: A Counterselection for Ras Transformation. Oncogene 1992, 7, 193–201. [Google Scholar] [PubMed]
  140. Sharma, S.V. Melittin-Induced Hyperactivation of Phospholipase A2 Activity and Calcium Influx in Ras-Transformed Cells. Oncogene 1993, 8, 939–947. [Google Scholar]
  141. Saini, S.S.; Chopra, A.K.; Peterson, J.W. Melittin Activates Endogenous Phospholipase D during Cytolysis of Human Monocytic Leukemia Cells. Toxicon 1999, 37, 1605–1619. [Google Scholar] [CrossRef]
  142. Teixeira, V.; Feio, M.J.; Bastos, M. Role of Lipids in the Interaction of Antimicrobial Peptides with Membranes. Prog. Lipid Res. 2012, 51, 149–177. [Google Scholar]
  143. Chen, J.; Xu, X.M.; Underhill, C.B.; Yang, S.; Wang, L.; Chen, Y.; Hong, S.; Creswell, K.; Zhang, L. Tachyplesin Activates the Classic Complement Pathway to Kill Tumor Cells. Cancer Res. 2005, 65, 4614–4622. [Google Scholar] [CrossRef] [PubMed]
  144. Shi, S.L.; Wang, Y.Y.; Liang, Y.; Li, Q.F. Effects of Tachyplesin and N-Sodium Butyrate on Proliferation and Gene Expression of Human Gastric Adenocarcinoma Cell Line BGC-823. World J. Gastroenterol. 2006, 12, 1694–1698. [Google Scholar] [CrossRef]
  145. Ouyang, G.L.; Li, Q.F.; Peng, X.X.; Liu, Q.R.; Hong, S.G. Effects of Tachyplesin on Proliferation and Differentiation of Human Hepatocellular Carcinoma SMMC-7721 Cells. World J. Gastroenterol. 2002, 8, 1053–1058. [Google Scholar] [CrossRef] [PubMed]
  146. Ohtake, T.; Fujimoto, Y.; Ikuta, K.; Saito, H.; Ohhira, M.; Ono, M.; Kohgo, Y. Proline Rich Antimicrobial Peptide, PR-39 Gene Transduction Altered Invasive Activity and Actin Structure in Human Hepatocellular Carcinoma Cells. Br. J. Cancer 1999, 81, 393–403. [Google Scholar] [CrossRef]
  147. Tanaka, K.; Fujimoto, Y.; Suzuki, M.; Suzuki, Y.; Ohtake, T.; Saito, H.; Kohgo, Y. PI3-Kinase P85α Is a Target Molecule of Proline-Rich Antimicrobial Peptide to Suppress Proliferation of Ras-Transformed Cells. Jpn. J. Cancer Res. 2001, 92, 959–967. [Google Scholar] [CrossRef] [PubMed]
  148. Chan, Y.R.; Zanetti, M.; Gennaro, R.; Gallo, R.L. Anti-Microbial Activity and Cell Binding Are Controled by Sequence Determinants in the Anti-Microbial Peptide PR-39. J. Investig. Dermatol. 2001, 116, 230–235. [Google Scholar] [CrossRef] [PubMed]
  149. Wu, D.; Gao, Y.; Qi, Y.; Chen, L.; Ma, Y.; Li, Y. Peptide-Based Cancer Therapy: Opportunity and Challenge. Cancer Lett. 2014, 351, 13–22. [Google Scholar] [CrossRef]
  150. Wu, X.; Huang, H.; Wang, C.; Lin, S.; Huang, Y.; Wang, Y.; Liang, G.; Yan, Q.; Xiao, J.; Wu, J.; et al. Identification of a Novel Peptide That Blocks Basic Fibroblast Growth Factor-Mediated Cell Proliferation. Oncotarget 2013, 4, 1819–1828. [Google Scholar] [CrossRef]
  151. Wang, W.; Chen, X.; Li, T.; Li, Y.; Wang, R.; He, D.; Luo, W.; Li, X.; Wu, X. Screening a Phage Display Library for a Novel FGF8b-Binding Peptide with Anti-Tumor Effect on Prostate Cancer. Exp. Cell Res. 2013, 319, 1156–1164. [Google Scholar] [CrossRef]
  152. Lee, E.; Koskimaki, J.E.; Pandey, N.B.; Popel, A.S. Inhibition of Lymphangiogenesis and Angiogenesis in Breast Tumor Xenografts and Lymph Nodes by a Peptide Derived from Transmembrane Protein 45A. Neoplasia 2013, 15, 112–124. [Google Scholar] [CrossRef]
  153. Deslouches, B.; Peter Di, Y. Antimicrobial Peptides with Selective Antitumor Mechanisms: Prospect for Anticancer Applications. Oncotarget 2017, 8, 46635–46651. [Google Scholar] [CrossRef] [PubMed]
  154. Zhang, T.N.; Liu, N. Effect of Bovine Lactoferricin on DNA Methyltransferase 1 Levels in Jurkat T-Leukemia Cells. J. Dairy Sci. 2010, 93, 3925–3930. [Google Scholar] [CrossRef] [PubMed]
  155. Kuroda, K.; Okumura, K.; Isogai, H.; Isogai, E. The Human Cathelicidin Antimicrobial Peptide LL-37 and Mimics Are Potential Anticancer Drugs. Front. Oncol. 2015, 5, 144. [Google Scholar] [CrossRef]
  156. Wu, W.K.K.; Sung, J.J.Y.; To, K.F.; Yu, L.; Li, H.T.; Li, Z.J.; Chu, K.M.; Yu, J.; Cho, C.H. The Host Defense Peptide LL-37 Activates the Tumor-Suppressing Bone Morphogenetic Protein Signaling via Inhibition of Proteasome in Gastric Cancer Cells. J. Cell. Physiol. 2010, 223, 178–186. [Google Scholar] [CrossRef]
  157. Sveinbjørnsson, B.; Camilio, K.A.; Haug, B.E.; Rekdal, Ø. LTX-315: A First-in-Class Oncolytic Peptide That Reprograms the Tumor Microenvironment. Future Med. Chem. 2017, 9, 1339–1344. [Google Scholar] [CrossRef]
  158. Xie, W.; Mondragón, L.; Mauseth, B.; Wang, Y.; Pol, J.; Lévesque, S.; Zhou, H.; Yamazaki, T.; Eksteen, J.J.; Zitvogel, L.; et al. Tumor Lysis with LTX-401 Creates Anticancer Immunity. Oncoimmunology 2019, 8, e1594555. [Google Scholar] [CrossRef]
  159. Zhou, H.; Forveille, S.; Sauvat, A.; Yamazaki, T.; Senovilla, L.; Ma, Y.; Liu, P.; Yang, H.; Bezu, L.; Müller, K.; et al. The Oncolytic Peptide LTX-315 Triggers Immunogenic Cell Death. Cell Death Dis. 2016, 7, e2134. [Google Scholar] [CrossRef]
  160. Zweytick, D. LTX-315—A Promising Novel Antitumor Peptide and Immunotherapeutic Agent. Cell Stress 2019, 3, 328. [Google Scholar] [CrossRef] [PubMed]
  161. Harada, H.; Hiraoka, M.; Kizaka-Kondoh, S. Antitumor Effect of TAT-Oxygen-Dependent Degradation-Caspase-3 Fusion Protein Specifically Stabilized and Activated in Hypoxic Tumor Cells. Cancer Res. 2002, 62, 2013–2018. [Google Scholar]
  162. DeBerardinis, R.J.; Chandel, N.S. We Need to Talk about the Warburg Effect. Nat. Metab. 2020, 2, 127–129. [Google Scholar] [CrossRef]
  163. Varum, S.; Rodrigues, A.S.; Moura, M.B.; Momcilovic, O.; Easley IV, C.A.; Ramalho-Santos, J.; van Houten, B.; Schatten, G. Energy Metabolism in Human Pluripotent Stem Cells and Their Differentiated Counterparts. PLoS ONE 2011, 6, e20914. [Google Scholar] [CrossRef]
  164. Xie, J.; Wu, H.; Dai, C.; Pan, Q.; Ding, Z.; Hu, D.; Ji, B.; Luo, Y.; Hu, X. Beyond Warburg Effect—Dual Metabolic Nature of Cancer Cells. Sci. Rep. 2014, 4, 4927. [Google Scholar] [CrossRef]
  165. Chiche, J.; Brahimi-Horn, M.C.; Pouysségur, J. Tumour Hypoxia Induces a Metabolic Shift Causing Acidosis: A Common Feature in Cancer. J. Cell. Mol. Med. 2010, 14, 771–794. [Google Scholar] [CrossRef]
  166. Švastová, E.; Hulíková, A.; Rafajová, M.; Zat’Ovičová, M.; Gibadulinová, A.; Casini, A.; Cecchi, A.; Scozzafava, A.; Supuran, C.T.; Pastorek, J.; et al. Hypoxia Activates the Capacity of Tumor-Associated Carbonic Anhydrase IX to Acidify Extracellular PH. FEBS Lett. 2004, 577, 439–445. [Google Scholar] [CrossRef]
  167. Ye, Z.; Yue, L.; Shi, J.; Shao, M.; Wu, T. Role of IDO and TDO in Cancers and Related Diseases and the Therapeutic Implications. J. Cancer 2019, 10, 2771–2782. [Google Scholar] [CrossRef]
  168. Reshkin, S.J.; Cardone, R.A.; Harguindey, S. Na+-H+ Exchanger, PH Regulation and Cancer. Recent Pat. Anticancer Drug Discov. 2012, 8, 85–99. [Google Scholar] [CrossRef]
  169. Juang, V.; Chang, C.H.; Wang, C.S.; Wang, H.E.; Lo, Y.L. PH-Responsive PEG-Shedding and Targeting Peptide-Modified Nanoparticles for Dual-Delivery of Irinotecan and MicroRNA to Enhance Tumor-Specific Therapy. Small 2019, 15, 1903296. [Google Scholar] [CrossRef] [PubMed]
  170. Han, H.; Hou, Y.; Chen, X.; Zhang, P.; Kang, M.; Jin, Q.; Ji, J.; Gao, M. Metformin-Induced Stromal Depletion to Enhance the Penetration of Gemcitabine-Loaded Magnetic Nanoparticles for Pancreatic Cancer Targeted Therapy. J. Am. Chem. Soc. 2020, 142, 4944–4954. [Google Scholar] [CrossRef] [PubMed]
  171. Hunt, J.F.; Rath, P.; Rothschild, K.J.; Engelman, D.M. Spontaneous, PH-Dependent Membrane Insertion of a Transbilayer α-Helix. Biochemistry 1997, 36, 15177–15192. [Google Scholar] [CrossRef]
  172. Reshetnyak, Y.K.; Andreev, O.A.; Lehnert, U.; Engelman, D.M. Translocation of Molecules into Cells by PH-Dependent Insertion of a Transmembrane Helix. Proc. Natl. Acad. Sci. USA 2006, 103, 6460–6465. [Google Scholar] [CrossRef] [PubMed]
  173. Jiang, T.; Olson, E.S.; Nguyen, Q.T.; Roy, M.; Jennings, P.A.; Tsien, R.Y. Tumor Imaging by Means of Proteolytic Activation of Cell-Penetrating Peptides. Proc. Natl. Acad. Sci. USA 2004, 101, 17867–17872. [Google Scholar] [CrossRef] [PubMed]
  174. Ruoslahti, E.; Duza, T.; Zhang, L. Vascular Homing Peptides with Cell-Penetrating Properties. Curr. Pharm. Des. 2005, 11, 3655–3660. [Google Scholar] [CrossRef] [PubMed]
  175. Lingasamy, P.; Teesalu, T. Homing Peptides for Cancer Therapy. Adv. Exp. Med. Biol. 2021, 1295, 29–48. [Google Scholar] [CrossRef] [PubMed]
  176. Desale, K.; Kuche, K.; Jain, S. Cell-Penetrating Peptides (CPPs): An Overview of Applications for Improving the Potential of Nanotherapeutics. Biomater. Sci. 2021, 9, 1153–1188. [Google Scholar] [CrossRef] [PubMed]
  177. Maity, S.K.; Stahl, P.; Hensel, A.; Knauer, S.; Hirschhäuser, C.; Schmuck, C. Cancer-Cell-Specific Drug Delivery by a Tumor-Homing CPP-Gossypol Conjugate Employing a Tracelessly Cleavable Linker. Chem.—Eur. J. 2020, 26, 3010–3015. [Google Scholar] [CrossRef] [PubMed]
  178. Ruoslahti, E. Tumor Penetrating Peptides for Improved Drug Delivery. Adv. Drug Deliv. Rev. 2017, 110–111, 3–12. [Google Scholar] [CrossRef]
  179. Petrenko, V.A.; Gillespie, J.W. Paradigm Shift in Bacteriophage-Mediated Delivery of Anticancer Drugs: From Targeted ‘Magic Bullets’ to Self-Navigated ‘Magic Missiles. ’ Expert Opin. Drug Deliv. 2017, 14, 373–384. [Google Scholar] [CrossRef] [PubMed]
  180. Zhao, K.; Luo, G.; Giannelli, S.; Szeto, H.H. Mitochondria-Targeted Peptide Prevents Mitochondrial Depolarization and Apoptosis Induced by Tert-Butyl Hydroperoxide in Neuronal Cell Lines. Biochem. Pharmacol. 2005, 70, 1796–1806. [Google Scholar] [CrossRef] [PubMed]
  181. Szeto, H.H.; Schiller, P.W.; Zhao, K.; Luo, G. Fluorescent Dyes Alter Intracellular Targeting and Function of Cell-penetrating Tetrapeptides. FASEB J. 2005, 19, 118–120. [Google Scholar] [CrossRef] [PubMed]
  182. Signore, A.; Mather, S.J.; Piaggio, G.; Malviya, G.; Dierckx, R.A. Molecular Imaging of Inflammation/Infection: Nuclear Medicine and Optical Imaging Agents and Methods. Chem. Rev. 2010, 110, 3112–3145. [Google Scholar] [CrossRef] [PubMed]
  183. Reubi, J.C.; Waser, B. Concomitant Expression of Several Peptide Receptors in Neuroendocrine Tumours: Molecular Basis for in Vivo Multireceptor Tumour Targeting. Eur. J. Nucl. Med. Mol. Imaging 2003, 30, 781–793. [Google Scholar] [CrossRef] [PubMed]
  184. Lee, S.; Xie, J.; Chen, X. Peptides and Peptide Hormones for Molecular Imaging and Disease Diagnosis. Chem. Rev. 2010, 110, 3087–3111. [Google Scholar] [CrossRef] [PubMed]
  185. Eberle, A.N.; Mild, G. Receptor-Mediated Tumor Targeting with Radiopeptides Part 1. General Principles and Methods. J. Recept. Signal Transduct. 2009, 29, 1–37. [Google Scholar] [CrossRef] [PubMed]
  186. Ferro-Flores, G.; de Ramirez, M.F.; Melendez-Alafort, L.; Santos-Cuevas, C.L. Peptides for In Vivo Target-Specific Cancer Imaging. Mini-Rev. Med. Chem. 2010, 10, 87–97. [Google Scholar] [CrossRef] [PubMed]
  187. Krohn, K.A. The Physical Chemistry of Ligand-Receptor Binding Identifies Some Limitations to the Analysis of Receptor Images. Nucl. Med. Biol. 2001, 28, 477–483. [Google Scholar] [CrossRef] [PubMed]
  188. Breeman, W.A.P.; Hofland, L.J.; de Jong, M.; Bernard, B.F.; Srinivasan, A.; Kwekkeboom, D.J.; Visser, T.J.; Krenning, E.P. Evaluation of Radiolabelled Bombesin Analogues for Receptor-Targeted Scintigraphy and Radiotherapy. Int. J. Cancer 1999, 81, 658–663. [Google Scholar] [CrossRef]
  189. Koopmans, K.P.; Glaudemans, A.W.J.M. Rationale for the Use of Radiolabelled Peptides in Diagnosis and Therapy. Eur. J. Nucl. Med. Mol. Imaging 2012, 39, 4–10. [Google Scholar] [CrossRef]
  190. Wang, W.; Ma, Z.; Zhu, S.; Wan, H.; Yue, J.; Ma, H.; Ma, R.; Yang, Q.; Wang, Z.; Li, Q.; et al. Molecular Cancer Imaging in the Second Near-Infrared Window Using a Renal-Excreted NIR-II Fluorophore-Peptide Probe. Adv. Mater. 2018, 30, 1900566. [Google Scholar] [CrossRef]
  191. Su, Z.; Shen, H.; Wang, H.; Wang, J.; Li, J.; Nienhaus, G.U.; Shang, L.; Wei, G. Motif-Designed Peptide Nanofibers Decorated with Graphene Quantum Dots for Simultaneous Targeting and Imaging of Tumor Cells. Adv. Funct. Mater. 2015, 25, 5472–5478. [Google Scholar] [CrossRef]
  192. Zhang, W.; Lin, D.; Wang, H.; Li, J.; Nienhaus, G.U.; Su, Z.; Wei, G.; Shang, L. Supramolecular Self-Assembly Bioinspired Synthesis of Luminescent Gold Nanocluster-Embedded Peptide Nanofibers for Temperature Sensing and Cellular Imaging. Bioconjug. Chem. 2017, 28, 2224–2229. [Google Scholar] [CrossRef]
  193. Reshetnyak, Y.K.; Yao, L.; Zheng, S.; Kuznetsov, S.; Engelman, D.M.; Andreev, O.A. Measuring Tumor Aggressiveness and Targeting Metastatic Lesions with Fluorescent PHLIP. Mol. Imaging Biol. 2011, 13, 1146–1156. [Google Scholar] [CrossRef] [PubMed]
  194. Burns, K.E.; Hensley, H.; Robinson, M.K.; Thévenin, D. Therapeutic Efficacy of a Family of PHLIP-MMAF Conjugates in Cancer Cells and Mouse Models. Mol. Pharm. 2017, 14, 415–422. [Google Scholar] [CrossRef] [PubMed]
  195. Dharmaratne, N.U.; Kaplan, A.R.; Glazer, P.M. Targeting the Hypoxic and Acidic Tumor Microenvironment with PH-Sensitive Peptides. Cells 2021, 10, 541. [Google Scholar] [CrossRef] [PubMed]
  196. Brown, L.; Westby, M.; Souberbielle, B.E.; Szawlowski, P.W.S.; Kemp, G.; Hay, P.; Dalgleish, A.G. Optimisation of a Peptide-Based Indirect ELISA for the Detection of Antibody in the Serum of HIV-1 Seropositive Patients. J. Immunol. Methods 1997, 200, 79–88. [Google Scholar] [CrossRef]
  197. Aydin, S. A Short History, Principles, and Types of ELISA, and Our Laboratory Experience with Peptide/Protein Analyses Using ELISA. Peptides 2015, 72, 4–15. [Google Scholar] [CrossRef] [PubMed]
  198. Angenendt, P. Progress in Protein and Antibody Microarray Technology. Drug Discov. Today 2005, 10, 503–511. [Google Scholar] [CrossRef] [PubMed]
  199. D’Agata, R.; Giuffrida, M.C.; Spoto, G. Peptide Nucleic Acid-Based Biosensors for Cancer Diagnosis. Molecules 2017, 22, 1951. [Google Scholar] [CrossRef] [PubMed]
  200. Cheng, W.; Ma, J.; Kong, D.; Zhang, Z.; Khan, A.; Yi, C.; Hu, K.; Yi, Y.; Li, J. One Step Electrochemical Detection for Matrix Metalloproteinase 2 Based on Anodic Stripping of Silver Nanoparticles Mediated by Host-Guest Interactions. Sens. Actuators B Chem. 2021, 330, 129379. [Google Scholar] [CrossRef]
  201. Xi, X.; Wen, M.; Song, S.; Zhu, J.; Wen, W.; Zhang, X.; Wang, S. A H2O2-Free Electrochemical Peptide Biosensor Based on Au@Pt Bimetallic Nanorods for Highly Sensitive Sensing of Matrix Metalloproteinase 2. Chem. Commun. 2020, 56, 6039–6042. [Google Scholar] [CrossRef]
  202. Gogotsi, Y. Nanomaterials Handbook, 2nd ed.; CRC Press: Boca Raton, FL, USA, 2017. [Google Scholar]
  203. Wang, J. Nanomaterial-Based Electrochemical Biosensors. Analyst 2005, 130, 421–426. [Google Scholar] [CrossRef] [PubMed]
  204. Pandey, P.; Datta, M.; Malhotra, B.D. Prospects of Nanomaterials in Biosensors. Anal. Lett. 2008, 41, 159–209. [Google Scholar] [CrossRef]
  205. Puiu, M.; Bala, C. Building Switchable Peptide-Architectures on Gold/Composite Surfaces: New Perspectives in Electrochemical Bioassays. Curr. Opin. Electrochem. 2018, 12, 13–20. [Google Scholar] [CrossRef]
  206. Farshchi, F.; Hasanzadeh, M. Microfluidic Biosensing of Circulating Tumor Cells (CTCs): Recent Progress and Challenges in Efficient Diagnosis of Cancer. Biomed. Pharmacother. 2021, 134, 111153. [Google Scholar] [CrossRef] [PubMed]
  207. Hansen, P.R.; Oddo, A. Fmoc Solid-Phase Peptide Synthesis. In Peptide Antibodies: Methods and Protocols; Houen, G., Ed.; Humana Press: New York, NY, USA, 2015; Volume 1348, pp. 33–50. ISBN 978-1-4939-2999-3. [Google Scholar]
  208. Jad, Y.E.; Kumar, A.; El-Faham, A.; de La Torre, B.G.; Albericio, F. Green Transformation of Solid-Phase Peptide Synthesis. ACS Sustain. Chem. Eng. 2019, 7, 3671–3683. [Google Scholar] [CrossRef]
  209. Merrifield, R.B. Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide. J. Am. Chem. Soc. 1963, 85, 2149–2154. [Google Scholar] [CrossRef]
  210. Pedersen, S.W.; Armishaw, C.J.; Strømgaard, K. Synthesis of Peptides Using Tert-Butyloxycarbonyl (Boc) as the α-Amino Protection Group. Methods Mol. Biol. 2013, 1047, 65–80. [Google Scholar] [CrossRef] [PubMed]
  211. Atherton, E.; Fox, H.; Harkiss, D.; Logan, C.J.; Sheppard, R.C.; Williams, B.J. A Mild Procedure for Solid Phase Peptide Synthesis: Use of Fluorenylmethoxycarbonylamino-acids. J. Chem. Soc. Chem. Commun. 1978, 537–539. [Google Scholar] [CrossRef]
  212. Sharma, A.; Kumar, A.; de la Torre, B.G.; Albericio, F. Liquid-Phase Peptide Synthesis (LPPS): A Third Wave for the Preparation of Peptides. Chem. Rev. 2022, 122, 13516–13546. [Google Scholar] [CrossRef] [PubMed]
  213. Xie, M.; Liu, D.; Yang, Y. Anti-Cancer Peptides: Classification, Mechanism of Action, Reconstruction and Modification. Open Biol. 2020, 10, 200004. [Google Scholar] [CrossRef] [PubMed]
  214. Chen, Y.; Mant, C.T.; Farmer, S.W.; Hancock, R.E.W.; Vasil, M.L.; Hodges, R.S. Rational Design of α-Helical Antimicrobial Peptides with Enhanced Activities and Specificity/Therapeutic Index. J. Biol. Chem. 2005, 280, 12316–12329. [Google Scholar] [CrossRef] [PubMed]
  215. Avrahami, D.; Shai, Y. Conjugation of a Magainin Analogue with Lipophilic Acids Controls Hydrophobicity, Solution Assembly, and Cell Selectivity. Biochemistry 2002, 41, 2254–2263. [Google Scholar] [CrossRef]
  216. Bhonsle, J.B.; Clark, T.; Bartolotti, L.; Hicks, R.P. A Brief Overview of Antimicrobial Peptides Containing Unnatural Amino Acids and Ligand-Based Approaches for Peptide Ligands. Curr. Top. Med. Chem. 2013, 13, 3205–3224. [Google Scholar] [CrossRef]
  217. Russell, A.L.; Kennedy, A.M.; Spuches, A.M.; Gibson, W.S.; Venugopal, D.; Klapper, D.; Srouji, A.H.; Bhonsle, J.B.; Hicks, R.P. Determining the Effect of the Incorporation of Unnatural Amino Acids into Antimicrobial Peptides on the Interactions with Zwitterionic and Anionic Membrane Model Systems. Chem. Phys. Lipids 2011, 164, 740–758. [Google Scholar] [CrossRef]
  218. Hicks, R.P.; Russell, A.L. Application of Unnatural Amino Acids to the de Novo Design of Selective Antibiotic Peptides. In Unnatural Amino Acids; Springer: Berlin/Heidelberg, Germany, 2012; pp. 135–167. [Google Scholar]
  219. Venugopal, D.; Klapper, D.; Srouji, A.H.; Bhonsle, J.B.; Borschel, R.; Mueller, A.; Russell, A.L.; Williams, B.C.; Hicks, R.P. Novel Antimicrobial Peptides That Exhibit Activity against Select Agents and Other Drug Resistant Bacteria. Bioorg. Med. Chem. 2010, 18, 5137–5147. [Google Scholar] [CrossRef]
  220. Narwal, V.; Deswal, R.; Batra, B.; Kalra, V.; Hooda, R.; Sharma, M.; Rana, J.S. Cholesterol Biosensors: A Review. Steroids 2019, 143, 6–17. [Google Scholar] [CrossRef]
  221. Milla, P.; Dosio, F.; Cattel, L. PEGylation of Proteins and Liposomes: A Powerful and Flexible Strategy to Improve the Drug Delivery. Curr. Drug Metab. 2012, 13, 105–119. [Google Scholar] [CrossRef] [PubMed]
  222. Ryan, S.M.; Mantovani, G.; Wang, X.; Haddleton, D.M.; Brayden, D.J. Advances in PEGylation of Important Biotech Molecules: Delivery Aspects. Expert Opin. Drug Deliv. 2008, 5, 371–383. [Google Scholar] [CrossRef] [PubMed]
  223. Sanyal, A.; Dutta, S.; Camara, A.; Chandran, A.; Koller, A.; Watson, B.G.; Sengupta, R.; Ysselstein, D.; Montenegro, P.; Cannon, J. Alpha-Synuclein Is a Target of Fic-Mediated Adenylylation/AMPylation: Possible Implications for Parkinson’s Disease. J. Mol. Biol. 2019, 431, 2266–2282. [Google Scholar] [CrossRef] [PubMed]
  224. Wan-Cheng Li, D. Editorial (Thematic Issue: Roles of Sumoylation and Phosphorylation in Normal Physiology and Human Diseases). Curr. Mol. Med. 2016, 16, 857–858. [Google Scholar]
  225. Pocheć, E.; Lityńska, A.; Bubka, M.; Amoresano, A.; Casbarra, A. Characterization of the Oligosaccharide Component of A3β1 Integrin from Human Bladder Carcinoma Cell Line T24 and Its Role in Adhesion and Migration. Eur. J. Cell Biol. 2006, 85, 47–57. [Google Scholar] [CrossRef]
  226. Huang, C.-Y.; Hsu, J.-T.; Chung, P.-H.; Cheng, W.T.-K.; Jiang, Y.-N.; Ju, Y.-T. Site-Specific N-Glycosylation of Caprine Lysostaphin Restricts Its Bacteriolytic Activity toward Staphylococcus Aureus. Anim. Biotechnol. 2013, 24, 129–147. [Google Scholar] [CrossRef] [PubMed]
  227. Aicart-Ramos, C.; Valero, R.A.; Rodriguez-Crespo, I. Protein Palmitoylation and Subcellular Trafficking. Biochim. Biophys. Acta (BBA)-Biomembr. 2011, 1808, 2981–2994. [Google Scholar] [CrossRef] [PubMed]
  228. Jian, C.; Zhang, P.; Ma, J.; Jian, S.; Zhang, Q.; Liu, B.; Liang, S.; Liu, M.; Zeng, Y.; Liu, Z. The Roles of Fatty-Acid Modification in the Activity of the Anticancer Peptide R-Lycosin-I. Mol. Pharm. 2018, 15, 4612–4620. [Google Scholar] [CrossRef]
  229. Lee, A.C.-L.; Harris, J.L.; Khanna, K.K.; Hong, J.-H. A Comprehensive Review on Current Advances in Peptide Drug Development and Design. Int. J. Mol. Sci. 2019, 20, 2383. [Google Scholar] [CrossRef] [PubMed]
  230. Ballester, P.J.; Mitchell, J.B.O. A Machine Learning Approach to Predicting Protein–Ligand Binding Affinity with Applications to Molecular Docking. Bioinformatics 2010, 26, 1169–1175. [Google Scholar] [CrossRef]
  231. Manavalan, B.; Shin, T.H.; Kim, M.O.; Lee, G. PIP-EL: A New Ensemble Learning Method for Improved Proinflammatory Peptide Predictions. Front. Immunol. 2018, 9, 1783. [Google Scholar] [CrossRef]
  232. Tallorin, L.; Wang, J.; Kim, W.E.; Sahu, S.; Kosa, N.M.; Yang, P.; Thompson, M.; Gilson, M.K.; Frazier, P.I.; Burkart, M.D. Discovering de Novo Peptide Substrates for Enzymes Using Machine Learning. Nat. Commun. 2018, 9, 5253. [Google Scholar] [CrossRef]
  233. Agrawal, P.; Bhagat, D.; Mahalwal, M.; Sharma, N.; Raghava, G.P.S. AntiCP 2.0: An Updated Model for Predicting Anticancer Peptides. Brief. Bioinform. 2021, 22, bbaa153. [Google Scholar] [CrossRef]
  234. Yi, H.-C.; You, Z.-H.; Zhou, X.; Cheng, L.; Li, X.; Jiang, T.-H.; Chen, Z.-H. ACP-DL: A Deep Learning Long Short-Term Memory Model to Predict Anticancer Peptides Using High-Efficiency Feature Representation. Mol. Ther.-Nucleic Acids 2019, 17, 1–9. [Google Scholar] [CrossRef]
  235. Jiang, T.; Gradus, J.L.; Rosellini, A.J. Supervised Machine Learning: A Brief Primer. Behav. Ther. 2020, 51, 675–687. [Google Scholar] [CrossRef]
  236. Kawashima, S.; Pokarowski, P.; Pokarowska, M.; Kolinski, A.; Katayama, T.; Kanehisa, M. AAindex: Amino Acid Index Database, Progress Report 2008. Nucleic Acids Res. 2007, 36, D202–D205. [Google Scholar] [CrossRef] [PubMed]
  237. Tung, C.-W.; Ho, S.-Y. Computational Identification of Ubiquitylation Sites from Protein Sequences. BMC Bioinform. 2008, 9, 310. [Google Scholar] [CrossRef]
  238. Rao, B.; Zhou, C.; Zhang, G.; Su, R.; Wei, L. ACPred-Fuse: Fusing Multi-View Information Improves the Prediction of Anticancer Peptides. Brief. Bioinform. 2020, 21, 1846–1855. [Google Scholar] [CrossRef] [PubMed]
  239. Lee, T.-Y.; Chen, S.-A.; Hung, H.-Y.; Ou, Y.-Y. Incorporating Distant Sequence Features and Radial Basis Function Networks to Identify Ubiquitin Conjugation Sites. PLoS ONE 2011, 6, e17331. [Google Scholar] [CrossRef]
  240. Chen, Z.; Zhao, P.; Li, F.; Leier, A.; Marquez-Lago, T.T.; Wang, Y.; Webb, G.I.; Smith, A.I.; Daly, R.J.; Chou, K.-C. IFeature: A Python Package and Web Server for Features Extraction and Selection from Protein and Peptide Sequences. Bioinformatics 2018, 34, 2499–2502. [Google Scholar] [CrossRef]
  241. Sandberg, M.; Eriksson, L.; Jonsson, J.; Sjöström, M.; Wold, S. New Chemical Descriptors Relevant for the Design of Biologically Active Peptides. A Multivariate Characterization of 87 Amino Acids. J. Med. Chem. 1998, 41, 2481–2491. [Google Scholar] [CrossRef]
  242. Tyagi, A.; Kapoor, P.; Kumar, R.; Chaudhary, K.; Gautam, A.; Raghava, G.P.S. In Silico Models for Designing and Discovering Novel Anticancer Peptides. Sci. Rep. 2013, 3, 2984. [Google Scholar] [CrossRef] [PubMed]
  243. Hajisharifi, Z.; Piryaiee, M.; Beigi, M.M.; Behbahani, M.; Mohabatkar, H. Predicting Anticancer Peptides with Chou′ s Pseudo Amino Acid Composition and Investigating Their Mutagenicity via Ames Test. J. Theor. Biol. 2014, 341, 34–40. [Google Scholar] [CrossRef]
  244. Noble, W.S. What Is a Support Vector Machine? Nat. Biotechnol. 2006, 24, 1565–1567. [Google Scholar] [CrossRef]
  245. Keller, J.M.; Gray, M.R.; Givens, J.A. A Fuzzy K-Nearest Neighbor Algorithm. IEEE Trans. Syst. Man Cybern. 1985, SMC-15, 580–585. [Google Scholar]
  246. Lakshminarayanan, B.; Pritzel, A.; Blundell, C. Simple and Scalable Predictive Uncertainty Estimation Using Deep Ensembles. In Proceedings of the Conference on Advances in Neural Information Processing Systems, Long Beach, CA, USA, 4–9 December 2017; Volume 30. [Google Scholar]
  247. Ke, G.; Meng, Q.; Finley, T.; Wang, T.; Chen, W.; Ma, W.; Ye, Q.; Liu, T.-Y. LightGBM: A Highly Efficient Gradient Boosting Decision Tree. In Proceedings of the Conference on Advances in Neural Information Processing Systems, Long Beach, CA, USA, 4–9 December 2017; Guyon, I., Luxburg, U., von Bengio, S., Wallach, H., Fergus, R., Vishwanathan, S., Garnett, R., Eds.; Curran Associates, Inc.: Red Hook, NY, USA, 2017; Volume 30, pp. 3149–3157. [Google Scholar]
  248. Pal, M. Random Forest Classifier for Remote Sensing Classification. Int. J. Remote Sens. 2005, 26, 217–222. [Google Scholar] [CrossRef]
  249. Chou, K.-C. Some Remarks on Protein Attribute Prediction and Pseudo Amino Acid Composition. J. Theor. Biol. 2011, 273, 236–247. [Google Scholar] [CrossRef]
  250. Chou, K.-C.; Shen, H.-B. Cell-PLoc: A Package of Web Servers for Predicting Subcellular Localization of Proteins in Various Organisms. Nat. Protoc. 2008, 3, 153–162. [Google Scholar] [CrossRef]
  251. Chou, K.-C.; Shen, H.-B. Recent Progress in Protein Subcellular Location Prediction. Anal. Biochem. 2007, 370, 1–16. [Google Scholar] [CrossRef]
  252. Thi Phan, L.; Woo Park, H.; Pitti, T.; Madhavan, T.; Jeon, Y.-J.; Manavalan, B. MLACP 2.0: An Updated Machine Learning Tool for Anticancer Peptide Prediction. Comput. Struct. Biotechnol. J. 2022, 20, 4473–4480. [Google Scholar] [CrossRef] [PubMed]
  253. Boopathi, V.; Subramaniyam, S.; Malik, A.; Lee, G.; Manavalan, B.; Yang, D.-C. MACPpred: A Support Vector Machine-Based Meta-Predictor for Identification of Anticancer Peptides. Int. J. Mol. Sci. 2019, 20, 1964. [Google Scholar] [CrossRef]
  254. Zhao, T.; Hu, Y.; Zang, T. DRACP: A Novel Method for Identification of Anticancer Peptides. BMC Bioinform. 2020, 21, 559. [Google Scholar] [CrossRef] [PubMed]
  255. Li, Q.; Zhou, W.; Wang, D.; Wang, S.; Li, Q. Prediction of Anticancer Peptides Using a Low-Dimensional Feature Model. Front. Bioeng. Biotechnol. 2020, 8, 892. [Google Scholar] [CrossRef]
  256. Xu, D.; Wu, Y.; Cheng, Z.; Yang, J.; Ding, Y. ACHP: A Web Server for Predicting Anti-Cancer Peptide and Anti-Hypertensive Peptide. Int. J. Pept. Res. Ther. 2021, 27, 1933–1944. [Google Scholar] [CrossRef]
  257. Vijayakumar, S.; PTV, L. ACPP: A Web Server for Prediction and Design of Anti-Cancer Peptides. Int. J. Pept. Res. Ther. 2015, 21, 99–106. [Google Scholar] [CrossRef]
  258. Chen, W.; Ding, H.; Feng, P.; Lin, H.; Chou, K.-C. IACP: A Sequence-Based Tool for Identifying Anticancer Peptides. Oncotarget 2016, 7, 16895. [Google Scholar] [CrossRef] [PubMed]
  259. Akbar, S.; Hayat, M.; Iqbal, M.; Jan, M.A. IACP-GAEnsC: Evolutionary Genetic Algorithm Based Ensemble Classification of Anticancer Peptides by Utilizing Hybrid Feature Space. Artif. Intell. Med. 2017, 79, 62–70. [Google Scholar] [CrossRef]
  260. Schaduangrat, N.; Nantasenamat, C.; Prachayasittikul, V.; Shoombuatong, W. ACPred: A Computational Tool for the Prediction and Analysis of Anticancer Peptides. Molecules 2019, 24, 1973. [Google Scholar] [CrossRef]
  261. Wei, L.; Zhou, C.; Chen, H.; Song, J.; Su, R. ACPred-FL: A Sequence-Based Predictor Using Effective Feature Representation to Improve the Prediction of Anti-Cancer Peptides. Bioinformatics 2018, 34, 4007–4016. [Google Scholar] [CrossRef]
  262. Kabir, M.; Arif, M.; Ahmad, S.; Ali, Z.; Swati, Z.N.K.; Yu, D.-J. Intelligent Computational Method for Discrimination of Anticancer Peptides by Incorporating Sequential and Evolutionary Profiles Information. Chemom. Intell. Lab. Syst. 2018, 182, 158–165. [Google Scholar] [CrossRef]
  263. Yu, L.; Jing, R.; Liu, F.; Luo, J.; Li, Y. DeepACP: A Novel Computational Approach for Accurate Identification of Anticancer Peptides by Deep Learning Algorithm. Mol. Ther.-Nucleic Acids 2020, 22, 862–870. [Google Scholar] [CrossRef] [PubMed]
  264. He, W.; Wang, Y.; Cui, L.; Su, R.; Wei, L. Learning Embedding Features Based on Multisense-Scaled Attention Architecture to Improve the Predictive Performance of Anticancer Peptides. Bioinformatics 2021, 37, 4684–4693. [Google Scholar] [CrossRef] [PubMed]
  265. Wu, C.; Gao, R.; Zhang, Y.; de Marinis, Y. PTPD: Predicting Therapeutic Peptides by Deep Learning and Word2vec. BMC Bioinform. 2019, 20, 456. [Google Scholar] [CrossRef] [PubMed]
  266. Ahmed, S.; Muhammod, R.; Khan, Z.H.; Adilina, S.; Sharma, A.; Shatabda, S.; Dehzangi, A. ACP-MHCNN: An Accurate Multi-Headed Deep-Convolutional Neural Network to Predict Anticancer Peptides. Sci. Rep. 2021, 11, 23676. [Google Scholar] [CrossRef] [PubMed]
  267. Wang, H.; Zhao, J.; Zhao, H.; Li, H.; Wang, J. CL-ACP: A Parallel Combination of CNN and LSTM Anticancer Peptide Recognition Model. BMC Bioinform. 2021, 22, 512. [Google Scholar] [CrossRef]
  268. Sun, M.; Yang, S.; Hu, X.; Zhou, Y. ACPNet: A Deep Learning Network to Identify Anticancer Peptides by Hybrid Sequence Information. Molecules 2022, 27, 1544. [Google Scholar] [CrossRef]
  269. Chen, X.-G.; Zhang, W.; Yang, X.; Li, C.; Chen, H. ACP-DA: Improving the Prediction of Anticancer Peptides Using Data Augmentation. Front. Genet. 2021, 12, 698477. [Google Scholar] [CrossRef] [PubMed]
  270. Rao, B.; Zhang, L.; Zhang, G. Acp-Gcn: The Identification of Anticancer Peptides Based on Graph Convolution Networks. IEEE Access 2020, 8, 176005–176011. [Google Scholar] [CrossRef]
  271. Chen, J.; Cheong, H.H.; Siu, S.W.I. XDeep-AcPEP: Deep Learning Method for Anticancer Peptide Activity Prediction Based on Convolutional Neural Network and Multitask Learning. J. Chem. Inf. Model. 2021, 61, 3789–3803. [Google Scholar] [CrossRef] [PubMed]
Figure 1. Schematic representation of the most significant models of ACPs action. The yellow circles and the black linkers represent the hydrophilic and hydrophobic regions, respectively, of the phospholipid cell membranes.
Figure 1. Schematic representation of the most significant models of ACPs action. The yellow circles and the black linkers represent the hydrophilic and hydrophobic regions, respectively, of the phospholipid cell membranes.
Molecules 28 01148 g001
Figure 2. Schematic representation showing the main difference between traditional machine and deep learning approaches.
Figure 2. Schematic representation showing the main difference between traditional machine and deep learning approaches.
Molecules 28 01148 g002
Figure 3. Schematic representation showing different steps of traditional machine learning approach for building a predictor for ACPs.
Figure 3. Schematic representation showing different steps of traditional machine learning approach for building a predictor for ACPs.
Molecules 28 01148 g003
Figure 4. Schematic representation showing different steps of deep learning approach for building a predictor for ACP.
Figure 4. Schematic representation showing different steps of deep learning approach for building a predictor for ACP.
Molecules 28 01148 g004
Table 1. Summary of ACPs discussed in this review.
Table 1. Summary of ACPs discussed in this review.
PeptideSourcePrimary Amino Acid Sequence aClassNet Charge bAnticancer MechanismReference
Aurein 1.2Litoria raniformisGLFDIIKKIAESFα-Helix+1Barrel-stave pore mechanism[25]
BMAP-27Bos taurusGRFKRFRKKFKKLFKKLSPVIPLLHLα-Helix+10Membranolytic[26]
BMAP-28Bos taurusGGLRSLGRKILRAWKKYGPIIVPIIRIα-Helix+7Membranolytic[27]
BrevininLimnonectes fujianensis frogKLKNFAKGVAQSLLNKASCKLSGQCMixed α-Helix, β-sheet and random coil+5Lysosomal death pathway and autophagy-like cell death through depolarizing the transmembrane potential of cancer cells[28]
Cecropin ASilk moth Hyalophora cecropiaKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKα-Helix+7Membranolytic Apoptosis inducer[29]
Cecropin BSilk moth Hyalophora cecropiaKWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALα-Helix+8Tumor growth inhibition using pore formation and apoptosis[30]
Citropin 1.1Litoria citropa frogGLFDVIKKVASVIGGLα-Helix+2Carpet model of membrane disruption[31,32]
D-K6L9SyntheticLKLLKKLLKKLLKLLα-Helix+3Reduce neovascularization through cell membrane depolarization[33]
GaegurinsRana rugose frogGaegurin 5:
FLGALFKVASKVLPSVKCAITKKC
α-Helix+4Destruction of cell membranes through a carpet-like model and/or barrel-stave model[34,35]
Gaegurin 6:
FLPLLAGLAANFLPTIICFISYKC
HMGB1Homo sapiensGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAα-Helix+9Immature dendritic cells activation and tumor-specific cytotoxic generation[36,37,38]
HNP-1, HNP-2 and HNP-3Homo sapiensHNP-1: ACYCRIPACIAGERRYGTCIYQGRLWAFCCβ-Sheet+3Membranolytic Antiangiogenic c Cytolytic activity[39]
HNP-2: CYCRIPACIAGERRYGTCIYQGRLWAFCC
HNP-3: DCYCRIPACIAGERRYGTCIYQGRLWAFCC
hBD3Homo sapiensGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKKMixed+11Binding to the phosphatidylinositol 4,5-bisphosphate[40]
LfcinB *Mammalian lactoferrinFKC1RRWQWRMKKLGAPSITC1VRRAFβ-Sheet+8Membranolytic Apoptosis inducer Antiangiogenic[41]
LL-37 *Homo sapiensLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESα-Helix+6Toroidal pore formation[42]
Magainin 2 *Xenopus laevis frogGIGKFLHSAKKFGKAFVGEIMNSα-Helix+3Formation of pores on cell membranes Apoptosis[43]
Melittin *Venom of the European honeybee Apis melliferaGIGAVLKVLTTGLPALISWIKRKRQQα-Helix+6Destabilizes the membrane through the barrel stave mechanism PLA2 d activator PLD e activator[44]
P18Synthetic hybridKWKLFKKIPKFLHLAKKF-NH2α-Helix+7Membranolytic[38,45]
PR-39Porcine small intestine and neutrophilsRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPLinear+11Induces syndecan-1 expression[46,47]
Tachyplesin I *Tachypleus tridentatus crabKWC1FRVC2YRGIC2YRRC1Rβ-Sheet+6Binds hyaluronan and activates complement (C1q) Antiangiogenic c Induces cancer cell differentiation[48]
a Amino acid sequences are given in one-letter codes. Subscripts indicate pairings of Cys residues that form disulfide bonds. Boldface indicates cationic amino acid residues. b At neutral pH. c Suggested activity d Phospholipase A2. e Phospholipase D. * Naturally occurring cationic antimicrobial peptides with anticancer activities.
Table 2. Some of the reported traditional ML predictor models showing their types of benchmark and independent datasets, features extracted, classifiers used, accuracy and MCC.
Table 2. Some of the reported traditional ML predictor models showing their types of benchmark and independent datasets, features extracted, classifiers used, accuracy and MCC.
Benchmark DatasetIndependent DatasetFeaturesClassifierAccuracy (%)MCCReference
ACPPSA_TRAINBalanced randomly generated peptides SA_INDProtein-relatedness measures, including compositional, centroidal and distributional measures of amino acid residuesSVM960.92[257]
iACPHajisharifi et al. [243]Balanced 300 peptides One gap DPCSVM92.670.85[258]
iACP-GAEnsCHajisharifi et al. [243]NAPseudo g-Gap DPCEnsemble method (SVM/RF/PNN/KNN/GRNN)96.450.91[259]
Amphiphilic pseudo amino acid composition
Reduce amino acid alphabet composition
ACPredHajisharifi et al. [243] Balanced 205 peptides AACSVM/RF95.610.91[260]
DPC
PCP
Pseudo AAC
Amphiphilic pseudo AAC
ACPred-FLbalanced dataset ACP500balanced dataset ACP164Composition–Transition–DistributionSVM91.40.835[261]
AAC
G-gap DPC
Adaptive skip DPC
BP Features
Overlapping Property Features
Twenty-One-Bit Features
Target ACPHajisharifi et al. [243]Balanced 205 peptides Composite protein sequence representationSVM/KNN/RF98.780.97[262]
Split AAC
Pseudo position-specific scoring matrix
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Ghaly, G.; Tallima, H.; Dabbish, E.; Badr ElDin, N.; Abd El-Rahman, M.K.; Ibrahim, M.A.A.; Shoeib, T. Anti-Cancer Peptides: Status and Future Prospects. Molecules 2023, 28, 1148. https://doi.org/10.3390/molecules28031148

AMA Style

Ghaly G, Tallima H, Dabbish E, Badr ElDin N, Abd El-Rahman MK, Ibrahim MAA, Shoeib T. Anti-Cancer Peptides: Status and Future Prospects. Molecules. 2023; 28(3):1148. https://doi.org/10.3390/molecules28031148

Chicago/Turabian Style

Ghaly, Gehane, Hatem Tallima, Eslam Dabbish, Norhan Badr ElDin, Mohamed K. Abd El-Rahman, Mahmoud A. A. Ibrahim, and Tamer Shoeib. 2023. "Anti-Cancer Peptides: Status and Future Prospects" Molecules 28, no. 3: 1148. https://doi.org/10.3390/molecules28031148

APA Style

Ghaly, G., Tallima, H., Dabbish, E., Badr ElDin, N., Abd El-Rahman, M. K., Ibrahim, M. A. A., & Shoeib, T. (2023). Anti-Cancer Peptides: Status and Future Prospects. Molecules, 28(3), 1148. https://doi.org/10.3390/molecules28031148

Article Metrics

Back to TopTop