Rational Design of Plant Hairpin-like Peptide EcAMP1: Structural–Functional Correlations to Reveal Antibacterial and Antifungal Activity
Abstract
:1. Introduction
2. Results and Discussion
3. Materials and Methods
3.1. Microorganisms
3.1.1. Bacteria and Yeast
3.1.2. Plant Pathogenic Filamentous Fungi
3.2. Design of the EcAMP1 Analogs
3.3. Solid-Phase Peptide Synthesis
3.4. Heterologous Expression in Escherichia coli System
3.5. Cleavage of EcAMP1-X3/X4-Thioredoxin Fusion Protein by Enteropeptidase
3.6. Analytical Reversed-Phase HPLC
3.7. MALDI-TOF MS
3.8. Molecular Modeling
3.9. Antimicrobial Activity In Vitro
4. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Sample Availability
References
- Hadacek, F.; Kaufman, P.B. Secondary Metabolites as Plant Traits: Current Assessment and Future Perspectives. CRC. Crit. Rev. Plant Sci. 2002, 21, 273–322. [Google Scholar] [CrossRef]
- Zaynab, M.; Fatima, M.; Sharif, Y.; Zafar, M.H.; Ali, H. Role of primary metabolites in plant defense against pathogens Microbial Pathogenesis Role of primary metabolites in plant defense against pathogens. Microb. Pthogenes. 2019, 137, 103728. [Google Scholar] [CrossRef] [PubMed]
- Zaynab, M.; Fatima, M.; Abbas, S.; Sharif, Y.; Umair, M.; Zafar, M.H.; Bahadar, K. Role of secondary metabolites in plant defense against pathogens. Microb. Pathog. 2018, 124, 198–202. [Google Scholar] [CrossRef] [PubMed]
- Egorov, T.A.; Odintsova, T.I.; Pukhalsky, V.A.; Grishin, E.V. Diversity of wheat anti-microbial peptides. Peptides 2005, 26, 2064–2073. [Google Scholar] [CrossRef]
- Salas, C.E.; Badillo-Corona, J.A.; Ramírez-Sotelo, G.; Oliver-Salvador, C. Biologically active and antimicrobial peptides from plants. Biomed Res. Int. 2015, 2015, 102129. [Google Scholar] [CrossRef] [Green Version]
- Tossi, A.; Sandri, L. Molecular Diversity in Gene-Encoded, Cationic Antimicrobial Polypeptides. Curr. Pharm. Des. 2005, 8, 743–761. [Google Scholar] [CrossRef]
- Tam, J.P.; Wang, S.; Wong, K.H.; Tan, W.L. Antimicrobial peptides from plants. Pharmaceuticals 2015, 8, 711–757. [Google Scholar] [CrossRef]
- Kulaeva, O.; Kliukova, M.; Afonin, A.; Sulima, A.; Zhukov, V.; Tikhonovich, I. The role of plant antimicrobial peptides (AMPs) in response to biotic and abiotic environmental factors. Biol. Commun. 2020, 65, 187–199. [Google Scholar] [CrossRef]
- Slavokhotova, A.A.; Rogozhin, E.A. Defense Peptides From the α-Hairpinin Family Are Components of Plant Innate Immunity. Front. Plant Sci. 2020, 11, 465. [Google Scholar] [CrossRef]
- Oparin, P.B.; Mineev, K.S.; Dunaevsky, Y.E.; Arseniev, A.S.; Belozersky, M.A.; Grishin, E.V.; Egorov, T.A.; Vassilevski, A.A. Buckwheat trypsin inhibitor with helical hairpin structure belongs to a new family of plant defence peptides. Biochem. J. 2012, 446, 69–77. [Google Scholar] [CrossRef] [Green Version]
- Yamada, K.; Shimada, T.; Kondo, M.; Nishimura, M.; Hara-Nishimura, I. Multiple functional proteins are produced by cleaving Asn-Gln bonds of a single precursor by vacuolar processing enzyme. J. Biol. Chem. 1999, 274, 2563–2570. [Google Scholar] [CrossRef] [Green Version]
- Conners, R.; Konarev, A.V.; Forsyth, J.; Lovegrove, A.; Marsh, J.; Joseph-Horne, T.; Shewry, P.; Brady, R.L. An unusual helix-turn-helix protease inhibitory motif in a novel trypsin inhibitor from seeds of Veronica (Veronica hederifolia L.). J. Biol. Chem. 2007, 282, 27760–27768. [Google Scholar] [CrossRef] [Green Version]
- Li, F.; Yang, X.X.; Xia, H.C.; Zeng, R.; Hu, W.G.; Li, Z.; Zhang, Z.C. Purification and characterization of Luffin P1, a ribosome-inactivating peptide from the seeds of Luffa cylindrica. Peptides 2003, 24, 799–805. [Google Scholar] [CrossRef]
- Utkina, L.L.; Andreev, Y.A.; Rogozhin, E.A.; Korostyleva, T.V.; Slavokhotova, A.A.; Oparin, P.B.; Vassilevski, A.A.; Grishin, E.V.; Egorov, T.A.; Odintsova, T.I. Genes encoding 4-Cys antimicrobial peptides in wheat Triticum kiharae Dorof. et Migush.: Multimodular structural organization, instraspecific variability, distribution and role in defence. FEBS J. 2013, 280, 3594–3608. [Google Scholar] [CrossRef]
- Rogozhin, E.A.; Ryazantsev, D.Y.; Grishin, E.V.; Egorov, T.A.; Zavriev, S.K. Defense peptides from barnyard grass (Echinochloa crusgalli L.) seeds. Peptides 2012, 38, 33–40. [Google Scholar] [CrossRef]
- Cui, X.; Du, J.; Li, J.; Wang, Z. Inhibitory site of α-hairpinin peptide from tartary buckwheat has no effect on its antimicrobial activities. Acta Biochim. Biophys. Sin. 2018, 50, 408–416. [Google Scholar] [CrossRef] [Green Version]
- Duvick, J.P.; Rood, T.; Rao, A.G.; Marshak, D.R. Purification and characterization of a novel antimicrobial peptide from maize (Zea mays L.) kernels. J. Biol. Chem. 1992, 267, 18814–18820. [Google Scholar] [CrossRef]
- Vasilchenko, A.S.; Yuryev, M.; Ryazantsev, D.Y.; Zavriev, S.K.; Feofanov, A.V.; Grishin, E.V.; Rogozhin, E.A. Studying of cellular interaction of hairpin-like peptide EcAMP1 from barnyard grass (Echinochloa crusgalli L.) seeds with plant pathogenic fungus Fusarium solani using microscopy techniques. Scanning 2016, 38, 591–598. [Google Scholar] [CrossRef] [Green Version]
- Rogozhin, E.; Zalevsky, A.; Mikov, A.; Smirnov, A.; Egorov, T. Characterization of hydroxyproline-containing hairpin-like antimicrobial peptide ecamp1-hyp from barnyard grass (Echinochloa crusgalli L.) seeds: Structural identification and comparative analysis of antifungal activity. Int. J. Mol. Sci. 2018, 19, 3449. [Google Scholar] [CrossRef] [Green Version]
- Li, H.; Hu, Y.; Pu, Q.; He, T.; Zhang, Q.; Wu, W.; Xia, X.; Zhang, J. Novel stapling by lysine tethering provides stable and low hemolytic cationic antimicrobial peptides. J. Med. Chem. 2020, 63, 4081–4089. [Google Scholar] [CrossRef]
- Gao, J.; Zhang, M.; Zhang, F.; Wang, Y.; Ouyang, J.; Luo, X.; Yang, H.; Zhang, D.; Chen, Y.; Yu, H.; et al. Design of a Sea Snake Antimicrobial Peptide Derivative with Therapeutic Potential against Drug-Resistant Bacterial Infection. ACS Infect. Dis. 2020, 6, 2451–2467. [Google Scholar] [CrossRef]
- Swedberg, J.E.; Nigon, L.V.; Reid, J.C.; de Veer, S.J.; Walpole, C.M.; Stephens, C.R.; Walsh, T.P.; Takayama, T.K.; Hooper, J.D.; Clements, J.A.; et al. Substrate-guided design of a potent and selective kallikrein-related peptidase inhibitor for kallikrein 4. Chem. Biol. 2009, 16, 633–643. [Google Scholar] [CrossRef]
- Berkut, A.A.; Usmanova, D.R.; Peigneur, S.; Oparin, P.B.; Mineev, K.S.; Odintsova, T.I.; Tytgat, J.; Arseniev, A.S.; Grishin, E.V.; Vassilevski, A.A. Structural Similarity between Defense Peptide from Wheat and Scorpion Neurotoxin Permits Rational Functional Design. J. Biol. Chem. 2014, 289, 14331–14340. [Google Scholar] [CrossRef] [Green Version]
- Tabakmakher, V.M.; Gigolaev, A.M.; Peigneur, S.; Krylov, N.A.; Tytgat, J.; Chugunov, A.O.; Vassilevski, A.A.; Efremov, R.G. Potassium channel blocker crafted by α-hairpinin scaffold engineering. Biophys. J. 2021, 120, 2471–2481. [Google Scholar] [CrossRef]
- Feurstein, C.; Meyer, V.; Jung, S. Structure–Activity Predictions From Computational Mining of Protein Databases to Assist Modular Design of Antimicrobial Peptides. Front. Microbiol. 2022, 1262. [Google Scholar] [CrossRef]
- Bellavita, R.; Casciaro, B.; Di Maro, S.; Brancaccio, D.; Carotenuto, A.; Falanga, A.; Cappiello, F.; Buommino, E.; Galdiero, S.; Novellino, E.; et al. First-in-Class Cyclic Temporin L Analogue: Design, Synthesis, and Antimicrobial Assessment. J. Med. Chem. 2021, 64, 11675–11694. [Google Scholar] [CrossRef]
- Nolde, S.B.; Vassilevski, A.A.; Rogozhin, E.A.; Barinov, N.A.; Balashova, T.A.; Samsonova, O.V.; Baranov, Y.V.; Feofanov, A.V.; Egorov, T.A.; Arseniev, A.S.; et al. Disulfide-stabilized helical hairpin structure and activity of a novel antifungal peptide EcAMP1 from seeds of barnyard grass (Echinochloa crus-galli). J. Biol. Chem. 2011, 286, 25145–25153. [Google Scholar] [CrossRef] [Green Version]
- Frasca, L.; Lande, R. Role of defensins and cathelicidin LL37 in auto-immune and auto-inflammatory diseases. Curr. Pharm. Biotechnol. 2012, 13, 1882–1897. [Google Scholar] [CrossRef] [PubMed]
- Slavokhotova, A.A.; Rogozhin, E.A.; Musolyamov, A.K.; Andreev, Y.A.; Oparin, P.B.; Berkut, A.A.; Vassilevski, A.A.; Egorov, T.A.; Grishin, E.V.; Odintsova, T.I. Novel antifungal α-hairpinin peptide from Stellaria media seeds: Structure, biosynthesis, gene structure and evolution. Plant Mol. Biol. 2014, 84, 189–202. [Google Scholar] [CrossRef] [PubMed]
- Longobardi, S.; Gravagnuolo, A.M.; Rea, I.; De Stefano, L.; Marino, G.; Giardina, P. Hydrophobin-coated plates as matrix-assisted laser desorption/ionization sample support for peptide/protein analysis. Anal. Biochem. 2014, 449, 9–16. [Google Scholar] [CrossRef] [PubMed]
- Wösten, H.A.B.; Scholtmeijer, K. Applications of hydrophobins: Current state and perspectives. Appl. Microbiol. Biotechnol. 2015, 99, 1587–1597. [Google Scholar] [CrossRef] [Green Version]
- Sousa, D.A.; Porto, W.F.; Silva, M.Z.; Da Silva, T.R.; Franco, O.L. Influence of cysteine and tryptophan substitution on DNA-binding activity on maize α-hairpinin antimicrobial peptide. Molecules 2016, 21, 1062. [Google Scholar] [CrossRef] [Green Version]
- Gunasekera, S.; Muhammad, T.; Strömstedt, A.A.; Rosengren, K.J.; Göransson, U. Backbone Cyclization and Dimerization of LL-37-Derived Peptides Enhance Antimicrobial Activity and Proteolytic Stability. Front. Microbiol. 2020, 11, 168. [Google Scholar] [CrossRef] [Green Version]
- Slazak, B.; Kapusta, M.; Strömstedt, A.A.; Słomka, A.; Krychowiak, M.; Shariatgorji, M.; Andrén, P.E.; Bohdanowicz, J.; Kuta, E.; Göransson, U. How Does the Sweet Violet (Viola odorata L.) Fight Pathogens and Pests—Cyclotides as a Comprehensive Plant Host Defense System. Front. Plant Sci. 2018, 9, 1296. [Google Scholar] [CrossRef] [Green Version]
- Rogozhin, E.A.; Slezina, M.P.; Slavokhotova, A.A.; Istomina, E.A.; Korostyleva, T.V.; Smirnov, A.N.; Grishin, E.V.; Egorov, T.A.; Odintsova, T.I. A novel antifungal peptide from leaves of the weed Stellaria media L. Biochimie 2015, 116, 125–132. [Google Scholar] [CrossRef]
Fungus | EcAMP1-WT | EcAMP1-X1 | EcAMP1-X2 |
---|---|---|---|
Fusarium oxysporum | 12.9 ± 1.2 | 15.4 ± 1.1 | 23.2 ± 2.6 |
F. graminearum | 6.8 ± 1.0 | 9.0 ± 1.4 | 18.1 ± 2.1 |
F. solani | 5.4 ± 1.5 | 6.9 ± 0.7 | 11.0 ± 1.9 |
Aspergillus niger | >32.0 | >32.0 | >32.0 |
Bipolaris sorokiniana | 25.7 ± 3.6 | >32.0 | >32.0 |
Alternaria alternata | 18.4 ± 2.7 | 21.1 ± 2.4 | >32.0 |
Fungus | EcAMP1-WT | EcAMP1-X3 | EcAMP1-X4 |
---|---|---|---|
F. oxysporum | 9.4 ± 1.4 | 15.0 ± 2.1 | 15.8 ± 1.6 |
F. graminearum | 5.0 ± 1.1 | 9.9 ± 1.9 | 8.5 ± 1.2 |
F. solani | 5.6 ± 0.9 | 8.6 ± 1.5 | 7.8 ± 0.7 |
Peptide Name | Amino Acid Sequence | Modification |
---|---|---|
EcAMP1-WT | GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD | Wild type |
EcAMP1-X1 | CRSQCMRRHEDEPWRVQECVSQC | Truncated form up to outercysteine pair |
EcAMP1-X2 | CMRRHEDEPWRVQEC | Truncated form up to innercysteine pair |
EcAMP1-X3 | GSGRGSCRSQCMRRHEDEPARVQECVSQCRRRRGGGD | Trp20Ala substitution |
EcAMP1-X4 | GSGRGSCRSQCMRRHEDEPWRVQECVSQCRR------ | Remove of six C-terminal amino acid residues |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Barashkova, A.S.; Ryazantsev, D.Y.; Rogozhin, E.A. Rational Design of Plant Hairpin-like Peptide EcAMP1: Structural–Functional Correlations to Reveal Antibacterial and Antifungal Activity. Molecules 2022, 27, 3554. https://doi.org/10.3390/molecules27113554
Barashkova AS, Ryazantsev DY, Rogozhin EA. Rational Design of Plant Hairpin-like Peptide EcAMP1: Structural–Functional Correlations to Reveal Antibacterial and Antifungal Activity. Molecules. 2022; 27(11):3554. https://doi.org/10.3390/molecules27113554
Chicago/Turabian StyleBarashkova, Anna S., Dmitry Y. Ryazantsev, and Eugene A. Rogozhin. 2022. "Rational Design of Plant Hairpin-like Peptide EcAMP1: Structural–Functional Correlations to Reveal Antibacterial and Antifungal Activity" Molecules 27, no. 11: 3554. https://doi.org/10.3390/molecules27113554
APA StyleBarashkova, A. S., Ryazantsev, D. Y., & Rogozhin, E. A. (2022). Rational Design of Plant Hairpin-like Peptide EcAMP1: Structural–Functional Correlations to Reveal Antibacterial and Antifungal Activity. Molecules, 27(11), 3554. https://doi.org/10.3390/molecules27113554