Agaricus bisporus Crude Extract: Characterization and Analytical Application
Abstract
:1. Introduction
2. Results and Discussion
2.1. Agaricus bisporus Extract Tyrosinase Activity and Protein Composition
2.2. Agaricus bisporus Extract Substrate Specificity
2.3. Agaricus bisporus Extract Interaction with Substrates
2.4. Analytical Application
3. Materials and Methods
3.1. Chemicals
3.2. Crude Extract: Preparation and Characterization
3.3. General Procedure for Crude Agaricus bisporus Extract and Phenolic Compounds Interaction Study
3.4. Analytical Application: Calibration Curves
3.5. Analytical Application: Samples Analysis
4. Conclusions
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Kampatsikas, I.; Bijelic, A.; Rompel, A. Biochemical and structural characterization of tomato polyphenol oxidases provide novel insights into their substrate specificity. Sci. Rep. 2019, 9, 1–13. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gul, I.; Ahmad, M.S.; Naqvi, S.M.S.; Hussain, A.; Wali, R.; Farooqi, A.A.; Ahmed, I. Polyphenol oxidase (PPO) based biosensors for detection of phenolic compounds: A Review. J. Appl. Biol. Biotechnol. 2017, 5, 72–85. [Google Scholar] [CrossRef]
- Fatibello-Filho, O.; Lupetti, K.O.; Leite, O.D.; Vieira, I.C. Electrochemical biosensors based on vegetable tissues and crude extracts for environmental, food and pharmaceutical analysis. Compr. Anal. Chem. 2007, 49, 357–377. [Google Scholar] [CrossRef]
- Morosanova, M.A.; Fedorov, A.S.; Morosanova, E.I. Crude Plant Extracts Mediated Polyphenol Oxidation Reactions in the Presence of 3-Methyl-2-Benzothiazolinone Hydrazone for the Determination of Total Polyphenol Content in Beverages. Curr. Anal. Chem. 2019, 15, 11–20. [Google Scholar] [CrossRef]
- Morosanova, M.A.; Bashkatova, A.S.; Morosanova, E.I. Spectrophotometric and Smartphone-Assisted Determination of Phenolic Compounds Using Crude Eggplant Extract. Molecules 2019, 24, 4407. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Leite, O.D.; Fatibello-Filho, O.; Barbosa, A.d.M. Determination of catecholamines in pharmaceutical formulations using a biosensor modified with a crude extract of fungi laccase (Pleurotus ostreatus). J. Braz. Chem. Soc. 2003, 14, 297–303. [Google Scholar] [CrossRef]
- Seo, S.Y.; Sharma, V.K.; Sharma, N. Mushroom tyrosinase: Recent prospects. J. Agric. Food Chem. 2003, 51, 2837–2853. [Google Scholar] [CrossRef]
- Kameda, E.; Langone, M.A.P.; Coelho, M.A.Z. Tyrosinase extract from Agaricus bisporus mushroom and its in natura tissue for specific phenol removal. Environ. Technol. 2006, 27, 1209–1215. [Google Scholar] [CrossRef]
- Atlow, S.C.; Bonadonna-Aparo, L.; Klibanov, A.M. Dephenolization of industrial wastewaters catalyzed by polyphenol oxidase. Biotechnol. Bioeng. 1984, 26, 599–603. [Google Scholar] [CrossRef]
- Duran, N.; Esposito, E. Potential applications of oxidative enzymes and phenoloxidase-like compounds in wastewater and soil treatment: A review. Appl. Catal. B 2000, 28, 83–99. [Google Scholar] [CrossRef]
- Ikehata, K.; Nicell, J.A. Color and toxicity removal following tyrosinase-catalyzed oxidation of phenols. Biotechnol. Prog. 2000, 16, 533–540. [Google Scholar] [CrossRef] [PubMed]
- Silva, L.M.C.; Salgado, A.M.; Coelho, M.A.Z. Agaricus bisporus as a source of tyrosinase for phenol detection for future biosensor development. Environ. Technol. 2010, 31, 611–616. [Google Scholar] [CrossRef] [PubMed]
- Silva, L.M.C.; Salgado, A.M.; Coelho, M.A.Z. Development of an amperometric biosensor for phenol detection. Environ. Technol. 2011, 32, 493–497. [Google Scholar] [CrossRef] [PubMed]
- Silva, L.M.C.; de Mello, A.C.C.; Salgado, A.M. Phenol determination by an amperometric biosensor based on lyophilized mushroom (Agaricus bisporus) tissue. Environ. Technol. 2014, 35, 1012–1017. [Google Scholar] [CrossRef]
- Fiorentino, D.; Gallone, A.; Fiocco, D.; Palazzo, G.; Mallardi, A. Mushroom tyrosinase in polyelectrolyte multilayers as an optical biosensor for o-diphenols. Biosens. Bioelectron. 2010, 25, 2033–2037. [Google Scholar] [CrossRef]
- del Torno-de Roman, L.; Alonso-Lomillo, M.A.; Dominguez-Renedo, O.; Arcos-Martinez, M.J. Tyrosinase based biosensor for the electrochemical determination of sulfamethoxazole. Sens. Actuators B 2016, 227, 48–53. [Google Scholar] [CrossRef]
- Frangu, A.; Pravcova, K.; Silarova, P.; Arbneshi, T.; Sys, M. Flow injection tyrosinase biosensor for direct determination of acetaminophen in human urine. Anal. Bioanal. Chem. 2019, 411, 2415–2424. [Google Scholar] [CrossRef]
- Cortina-Puig, M.; Munoz-Berbel, X.; Calas-Blanchard, C.; Marty, J.L. Diazonium-functionalized tyrosinase-based biosensor for the detection of tea polyphenols. Microchim. Acta. 2010, 171, 187–193. [Google Scholar] [CrossRef]
- Nadifiyine, S.; Haddam, M.; Mandli, J.; Chadel, S.; Blanchard, C.C.; Marty, J.L.; Amine, A. Amperometric biosensor based on tyrosinase immobilized on to a carbon black paste electrode for phenol determination in olive oil. Anal. Lett. 2013, 46, 2705–2726. [Google Scholar] [CrossRef]
- Wu, L.; Deng, D.; Jin, J.; Lu, X.; Chen, J. Nanographene-based tyrosinase biosensor for rapid detection of bisphenol A. Biosens. Bioelectron. 2012, 35, 193–199. [Google Scholar] [CrossRef]
- Wichers, H.J.; Gerritsen, Y.A.M.; Chapelon, C.G.J. Tyrosinase isoforms from the fruitbodies of Agaricus bisporus. Phytochemistry 1996, 43, 333–337. [Google Scholar] [CrossRef]
- Kertesz, D.; Zito, R. Mushroom polyphenol oxidase I. Purification and general properties. Biochim. Biophys. Acta. 1965, 96, 447–462. [Google Scholar] [CrossRef]
- Wu, J.; Chen, H.; Gao, J.; Liu, X.; Cheng, W.; Ma, X. Cloning, characterization and expression of two new polyphenol oxidase cDNAs from Agaricus. bisporus. Biotechnol. Lett. 2010, 32, 1439–1447. [Google Scholar] [CrossRef] [PubMed]
- Ismaya, W.T.; Rozeboom, H.J.; Weijn, A.; Mes, J.J.; Fusetti, F.; Wichers, H.J.; Dijkstra, B.W. Crystal structure of Agaricus bisporus mushroom tyrosinase: Identity of the tetramer subunits and interaction with tropolone. Biochemistry 2011, 50, 5477–5486. [Google Scholar] [CrossRef] [Green Version]
- O’Connor, E.; McGowan, J.; McCarthy, C.G.P.; Amini, A.; Grogan, H.; Fitzpatrick, D.A. Whole Genome Sequence of the Commercially Relevant Mushroom Strain Agaricus bisporus var. bisporus ARP23. G3-Genes Genom. Genet. 2019, 9, 3057–3066. [Google Scholar] [CrossRef] [Green Version]
- Weijn, A.; Bastiaan-Net, S.; Wichers, H.J.; Mes, J.J. Melanin biosynthesis pathway in Agaricus bisporus mushrooms. Fungal Genet. Biol. 2013, 55, 42–53. [Google Scholar] [CrossRef]
- Mauracher, S.G.; Molitor, C.; Michael, C.; Kragl, M.; Rizzi, A.; Rompel, A. High level protein-purification allows the unambiguous polypeptide determination of latent isoform PPO4 of mushroom tyrosinase. Phytochemistry 2014, 99, 14–25. [Google Scholar] [CrossRef] [Green Version]
- Faccio, G.; Arvas, M.; Thony-Meyer, L.; Saloheimo, M. Experimental and bioinformatic investigation of the proteolytic degradation of the C-terminal domain of a fungal tyrosinase. J. Inorg. Biochem. 2013, 121, 37–45. [Google Scholar] [CrossRef]
- Fujieda, N.; Murata, M.; Yabuta, S.; Ikeda, T.; Shimokawa, C.; Nakamura, Y.; Hata, Y.; Itoh, S. Multifunctions of MelB, a fungal tyrosinase from Aspergillus oryzae. Chem. Bio. Chem. 2012, 13, 193–201. [Google Scholar] [CrossRef]
- Katrolia, P.; Rajashekhara, E.; Yan, Q.; Jiang, Z. Biotechnological potential of microbial α-galactosidases. Crit. Rev. Biotechnol. 2014, 34, 307–317. [Google Scholar] [CrossRef]
- Mast, S.W.; Moremen, K.W. Family 47 α-Mannosidases in N-Glycan Processing. Methods Enzymol. 2006, 415, 31–46. [Google Scholar] [CrossRef] [Green Version]
- Val-Cid, C.; Biarnes, X.; Faijes, M.; Planas, A. Structural-Functional Analysis Reveals a Specific Domain Organization in Family GH20 Hexosaminidases. PLoS ONE 2015, 10, e0128075. [Google Scholar] [CrossRef] [PubMed]
- Rankin, S.A.; Christiansen, A.; Lee, W.; Banavara, D.S.; Lopez-Hernandez, A. Invited review: The application of alkaline phosphatase assays for the validation of milk product pasteurization. J. Dairy Sci. 2010, 93, 5538–5551. [Google Scholar] [CrossRef] [PubMed]
- Miggiano, G.A.; Mordente, A.; Martorana, G.E.; Meucci, E.; Castelli, A. In vitro effect of ascorbic acid on bovine kidney alkaline phosphatase activity. Acta. Vitaminol. Enzymol. 1983, 5, 153–158. [Google Scholar] [PubMed]
- Komarek, J.; Kavkova, E.I.; Houser, J.; Horackova, A.; Zdanska, J.; Demo, G.; Wimmerova, M. Structure and properties of AB21, a novel Agaricus bisporus protein with structural relation to bacterial pore-forming toxins. Proteins 2018, 86, 897–911. [Google Scholar] [CrossRef] [PubMed]
- Erjavec, J.; Kos, J.; Ravnikar, M.; Dreo, T.; Sabotic, J. Proteins of higher fungi—from forest to application. Trends Biotechnol. 2012, 30, 259–273. [Google Scholar] [CrossRef]
- Jia, D.; Wang, B.; Li, X.; Peng, W.; Zhou, J.; Tan, H.; Tang, J.; Huang, Z.; Tan, W.; Gan, B.; et al. Proteomic Analysis Revealed the Fruiting-Body Protein Profile of Auricularia polytricha. Curr. Microbiol. 2017, 74, 943–951. [Google Scholar] [CrossRef]
- Selinheimo, E.; Gasparetti, C.; Mattinen, M.; Steffensen, C.; Buchert, J.; Kruus, K. Comparison of substrate specificity of tyrosinases from Trichoderma reesei and Agaricus bisporus. Enzyme Microb. Technol. 2009, 44, 1–10. [Google Scholar] [CrossRef]
- Munoz-Munoz, J.L.; Garcia-Molina, F.; Garcia-Ruiz, P.A.; Molina-Alarcon, M.; Tudela, J.; Garcia-Canovas, F.; Rodriguez-Lopez, J.N. Phenolic substrates and suicide inactivation of tyrosinase: Kinetics and mechanism. Biochem. J. 2008, 416, 431–440. [Google Scholar] [CrossRef] [Green Version]
- Karioti, A.; Protopappa, A.; Megoulas, N.; Skaltsa, H. Identification of tyrosinase inhibitors from Marrubium velutinum and Marrubium cylleneum. Bioorg. Med. Chem. 2007, 15, 2708–2714. [Google Scholar] [CrossRef]
- Garcia-Jimenez, A.; Teruel-Puche, J.A.; Berna, J.; Rodriguez-Lopez, J.N.; Tudela, J.; Garcia-Ruiz, P.A.; Garcia-Canovas, F. Characterization of the action of tyrosinase on resorcinols. Bioorg. Med. Chem. 2016, 24, 4434–4443. [Google Scholar] [CrossRef]
- Selinheimo, E.; NiEidhin, D.; Steffensen, C.; Nielsen, J.; Lomascolo, A.; Halaouli, S.; Record, E.; OBeirne, D.; Buchert, J.; Kruus, K. Comparison of the characteristics of fungal and plant tyrosinases. J. Biotechnol. 2007, 130, 471–480. [Google Scholar] [CrossRef] [PubMed]
- Gouzi, H.; Benmansour, A. Partial purification and characterization of polyphenol oxidase extracted from Agaricus bisporus (JE Lange) Imbach. IJCRE 2007, 5, A76. [Google Scholar] [CrossRef]
- Abdullah, J.; Ahmad, M.; Karuppiah, N.; Heng, L.Y.; Sidek, H. Immobilization of tyrosinase in chitosan film for an optical detection of phenol. Sens. Actuators B 2006, 114, 604–609. [Google Scholar] [CrossRef]
- Wu, X.J.; Choi, M.M.; Wu, X.M. An organic-phase optical phenol biosensor coupling enzymatic oxidation with chemical reduction. Analyst 2004, 129, 1143–1149. [Google Scholar] [CrossRef] [PubMed]
- Hashim, H.S.; Fen, Y.W.; Omar, N.A.S.; Daniyal, W.M.E.M.M.; Saleviter, S.; Abdullah, J. Structural, optical and potential sensing properties of tyrosinase immobilized graphene oxide thin film on gold surface. Optik 2020, 212, 164786. [Google Scholar] [CrossRef]
- Jang, E.; Son, K.J.; Kim, B.; Koh, W.G. Phenol biosensor based on hydrogel microarrays entrapping tyrosinase and quantum dots. Analyst 2010, 135, 2871–2878. [Google Scholar] [CrossRef]
- Paranjpe, P.; Dutta, S.; Karve, M.; Padhye, S.; Narayanaswamy, R. A disposable optrode using immobilized tyrosinase films. Anal. Biochem. 2001, 294, 102–107. [Google Scholar] [CrossRef]
- Rivas, G.A.; Solis, V.M. Indirect electrochemical determination of l-tyrosine using mushroom tyrosinase in solution. Anal. Chem. 1991, 63, 2762–2765. [Google Scholar] [CrossRef]
- Vasina, D.V.; Pavlov, A.R.; Koroleva, O.V. Extracellular proteins of Trametes hirsuta st. 072 induced by copper ions and a lignocellulose substrate. BMC Microbiol. 2016, 16, 106. [Google Scholar] [CrossRef] [Green Version]
- Uppuluri, P.; Dinakaran, H.; Thomas, D.P.; Chaturvedi, A.K.; Lopez-Ribot, J.L. Characteristics of Candida albicans Biofilms Grown in a Synthetic Urine Medium. J. Clin. Microbiol. 2009, 47, 4078–4083. [Google Scholar] [CrossRef] [Green Version]
Identified Proteins | Accession Number | Highest Similarity to Proteins | Score (−10lgP) |
---|---|---|---|
Protein identification data of area A1 on the electrophoregram | |||
Polyphenol oxidase a,b (Tyrosinase) | 2Y9W_A | Chain A, Crystal Structure of PPO3, A Tyrosinase from Agaricus bisporus | 344 |
C7FF04 | Polyphenol oxidase 3 (Tyrosinase) Agaricus bisporus; PPO3; Precursor | 297 | |
ADE67053 | Tyrosinase (Agaricus bisporus) | 282 | |
Protein identification data of area A2 on the electrophoregram | |||
Protein AB21 a,b | XP_006461442 c | hypothetical protein AGABI2DRAFT_192945 (Agaricus bisporus var. bisporus H97) | 335 |
Protein identification data of area A3 on the electrophoregram | |||
Alpha-galactosidase (GH27) a,b Alpha-mannosidases (GH47) a,b | XP_006456345.1 d XP_007331943.1 e | Mixture 1: Components: 1. hypothetical protein AGABI2DRAFT_228269 (Agaricus bisporus var. bisporus H97); 2. hypothetical protein AGABI1DRAFT_86588 (Agaricus bisporus var. burnettii JB137-S8) | 240 |
Alpha-galactosidase (GH27) a,b Alpha-mannosidases (GH47) a,b | XP_007334630.1 f XP_007331943.1 e | Mixture 2: Components: 1. hypothetical protein AGABI1DRAFT_80761 (Agaricus bisporus var. burnettii JB137-S8); 2. hypothetical protein AGABI1DRAFT_86588 (Agaricus bisporus var. burnettii JB137-S8) | 221 |
Alpha-galactosidase (GH27) a,b Alpha-mannosidases (GH47) a,b | XP_006456345.1 d XP_007331943.1 e | Mixture 1: Components: 1. hypothetical protein AGABI2DRAFT_228269 (Agaricus bisporus var. bisporus H97); 2. hypothetical protein AGABI1DRAFT_86588 (Agaricus bisporus var. burnettii JB137-S8) | 246 |
Alpha-galactosidase (GH27) a,b Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B (GH47) a,b | XP_006456345.1 d XP_006463333.1 g | Mixture 2: Components: 1. hypothetical protein AGABI2DRAFT_228269 (Agaricus bisporus var. bisporus H97); 2. hypothetical protein AGABI2DRAFT_194179 (Agaricus bisporus var. bisporus H97) | 230 |
Protein identification data of area A4 on the electrophoregram | |||
Alkaline phosphatase a,b | XP_006462861.1 h | hypothetical protein AGABI2DRAFT_72252 (Agaricus bisporus var. bisporus H97) | 242 |
Beta-hexosaminidase (GH20) a,b | XP_006462439.1 i | hypothetical protein AGABI2DRAFT_193587 (Agaricus bisporus var. bisporus H97) | 193 |
Molecular chaperone DnaK a,b | WP_031376016.1 | MULTISPECIES: molecular chaperone DnaK (Pantoea) | 463 |
Protein identification data of area A5 on the electrophoregram | |||
Hypothetical protein a,b | XP_007329073.1 | hypothetical protein AGABI1DRAFT_113037 (Agaricus bisporus var. burnettii JB137-S8) | 319 |
Hypothetical protein a,b | XP_006456974.1 | hypothetical protein AGABI2DRAFT_195909 (Agaricus bisporus var. bisporus H97) | 187 |
Hypothetical protein a,b | XP_006463886.1 | hypothetical protein AGABI2DRAFT_194569 (Agaricus bisporus var. bisporus H97) | 465 |
Thaumatin-like protein a,b | XP_006455282.1 j | hypothetical protein AGABI2DRAFT_226703 (Agaricus bisporus var. bisporus H97) | 188 |
Sequence | Mr (expt) | Mr (calc) | m/z (Observed) | ppm | |
---|---|---|---|---|---|
1 | R.ALQVLQAR.D | 897.5477 | 897.5396 | 898.5549 | 9.01 |
2 | R.EWTFNMLTK.N | 1168.5607 | 1168.5587 | 1169.5680 | 1.73 |
3 | K.NRLNILDFVK.N | 1230.6811 | 1230.7084 | 1231.6884 | −22.18 |
4 | K.SVYINDWVHK.H | 1259.6255 | 1259.6299 | 1260.6328 | −3.44 |
5 | K.NDKFFTLYVR.A | 1301.6726 | 1301.6768 | 1302.6799 | −3.26 |
6 | K.SLMPLVGIPGEIK.N | 1352.7572 | 1352.7737 | 1353.7645 | −12.24 |
7 | R.FTTSDQAEWIQAAK.D | 1594.7632 | 1594.7627 | 1595.7705 | 0.31 |
8 | K.SLMPLVGIPGEIKNR.L | 1622.9171 | 1622.9178 | 1623.9243 | −0.44 |
9 | K.AAAPGFREWTFNMLTK.N | 1838.9170 | 1838.9138 | 1839.9243 | 1.78 |
10 | R.FTTSDQAEWIQAAKDLR.Q | 1978.9743 | 1978.9748 | 1979.9816 | −0.28 |
11 | R.YPDVQKQENIEGMIAGIK.A | 2032.0332 | 2032.0299 | 2033.0405 | 1.64 |
12 | R.LNILDFVKNDKFFTLYVR.A | 2244.2282 | 2244.2307 | 2245.2355 | −1.10 |
13 | R.AYESTWEQTLWEAAGTVAQR.F | 2296.0962 | 2296.0760 | 2297.1035 | 8.79 |
14 | R.LLALWQTMNYDVYVSEGMNR.E | 2402.1470 | 2402.139 | 2403.1543 | 2.99 |
15 | K.FHPIEPTFEGDFAQWQTTMR.Y | 2437.1231 | 2437.1161 | 2438.1303 | 2.84 |
16 | K.QVEITDYNGTKIEVENPILHYK.F | 2602.2997 | 2602.3279 | 2603.3070 | −10.82 |
17 | R.EATMGLIPGQVLTEDSPLEPFYTK.N | 2635.3001 | 2635.3091 | 2636.3074 | −3.42 |
18 | R.DQSDYSSFFQLGGIHGLPYTEWAK.A | 2745.2632 | 2745.2711 | 2746.2704 | −2.89 |
19 | R.DKQVEITDYNGTKIEVENPILHYK.F | 2845.4231 | 2845.4498 | 2846.4303 | −9.38 |
20 | R.QPFWDWGYWPNDPDFIGLPDQVIR.D | 2960.3728 | 2960.3922 | 2961.3801 | −6.58 |
21 | K.FHPIEPTFEGDFAQWQTTMRYPDVQK.Q | 3167.4399 | 3167.4811 | 3168.4472 | −13.00 |
22 | K.NQDPWQSDDLEDWETLGFSYPDFDPVK.G | 3242.3693 | 3242.3993 | 3243.3766 | −9.25 |
23 | K.DLRQPFWDWGYWPNDPDFIGLPDQVIR.D | 3344.5434 | 3344.6044 | 3345.5507 | −18.22 |
24 | K.NQDPWQSDDLEDWETLGFSYPDFDPVKGK.S | 3427.4427 | 3427.5157 | 3428.4500 | −21.30 |
25 | K.DLRQPFWDWGYWPNDPDFIGLPDQVIRDK.Q | 3587.6262 | 3587.7263 | 3588.6335 | −27.89 |
26 | K.NQDPWQSDDLEDWETLGFSYPDFDPVKGKSK.E | 3642.7296 | 3642.6427 | 3643.7369 | 23.9 |
27 | R.DPTLDPLVPGHMGSVPHAAFDPIFWMHHCNVDR.L | 3778.6609 | 3778.7596 | 3779.6682 | −26.11 |
28 | K.NYTWELFSNHGAVVGAHANSLEMVHNTVHFLIGR.D | 3819.7564 | 3819.8692 | 3820.7637 | −29.53 |
29 | K.FHPIEPTFEGDFAQWQTTMRYPDVQKQENIEGMIAGIK.A | 4450.9378 | 4451.1355 | 4451.9451 | −44.41 |
Experimental Data (Present Work) | Oxidized in the Presence of ABE | Not Oxidized in the Presence of ABE | |
---|---|---|---|
Data from BRENDA Database | |||
ABT substrate | Catechol Gallic acid Caffeic acid l-DOPA Resorcinol p-Cresol l-tyrosine Phenol | ||
ABT inhibitor | Chlorogenic acid Resorcinol | Ferulic acid Quercetin Rutin | |
No data for ABT | Dihydroquercetin o-Cresol m-Cresol | p-Nitrophenol o-Nitrophenol Propyl gallate Guaiacol |
Phenolic Compound | Km, M | |
---|---|---|
ABE | ABT [38] | |
Catechol | 2.7 × 10−4 | 2.5 × 10−4 |
Caffeic acid | 2.3 × 10−4 | 1.7 × 10−3 |
Chlorogenic acid | 2.1 × 10−4 | - |
l-DOPA | 1.8 × 10−4 | 1.7 × 10−4 |
l-tyrosine | 7.2 × 10−4 | 2.0 × 10−4 |
Phenol | 1.5 × 10−4 | 3.0 × 10−4 |
Phenolic Compound | Analytical Signal | LOD, M | Analytical Range, M |
---|---|---|---|
l-tyrosine | Absorbance at 60 min | 4.7 × 10−5 | 1.4 × 10−4–1.0 × 10−3 |
Phenol | 1.0 × 10−6 | 3.1 × 10−6–1.0 × 10−4 | |
Catechol | The difference of the absorbance values at 30 s and 270 s | 1.8 × 10−5 | 5.4 × 10−5–1.0 × 10−3 |
Caffeic acid | 2.8 × 10−5 | 8.5 × 10−5–1.0 × 10−3 | |
Chlorogenic acid | 4.9 × 10−5 | 1.5 × 10−4–7.5 × 10−4 | |
l-DOPA | 2.3 × 10−5 | 6.8 × 10−5–1.0 × 10−3 |
Analyte | Sample | Found (RSD, %) | Added |
---|---|---|---|
Phenol | Spiked waste water 1 | (2.8 ± 0.3) × 10−6 M (4.7) | 2.9 × 10−6 M |
Spiked waste water 2 | (7.8 ± 0.7) × 10−6 M (3.4) | 7.1 × 10−6 M | |
Spiked waste water 3 | (1.4 ± 0.2) × 10−5 M (4.4) | 1.4 × 10−5 M | |
l-tyrosine | Food supplement | 633 ± 147 mg/capsule (9.3) | 500 mg/capsule * |
l-DOPA | Spiked synthetic serum 1 | (7.1 ± 2.3) × 10−5 M (23.7) | 5.0 × 10−5 M |
Spiked synthetic serum 2 | (2.5 ± 0.3) × 10−4 M (7.9) | 2.5 × 10−4 M |
Analyte | Enzyme | Analytical Signal | LOD, M | Reference |
---|---|---|---|---|
Phenol | Mushroom tyrosinase immobilized in chitosan film | Absorbance of the colored products of the enzymatic oxidation followed by coupling with MBTH | 1.0 × 10−6 | [44] |
Mushroom tyrosinase immobilized in PVA matrix | Fluorescence of Ru salts that can be quenched by the oxygen participating in the enzymatic oxidation | 8.0 × 10−5 | [45] | |
Mushroom tyrosinase immobilized in graphene oxide film | Surface plasmon resonance angle shift caused by the products of the enzymatic oxidation | 1.0 × 10−6 | [46] | |
Mushroom tyrosinase immobilized in hydrogel | CdSe/ZnS quantum dots fluorescence quenching by the product of the enzymatic oxidation (quinone) | 1.0 × 10−6 | [47] | |
Agaricus bisporus crude extract | Absorbance of the colored products of the enzymatic oxidation | 1.0 × 10−6 | Present work | |
l-DOPA | Agaricus bisporus tyrosinase immobilized in the polyelectrolyte layers | Absorbance of the colored products of the enzymatic oxidation | 2.3 × 10−5 | [15] |
Amorphophallus companulatus tyrosinase immobilized in agarose film | Reflectance of the colored products of the enzymatic oxidation | 1.7 × 10−5 | [48] | |
Agaricus bisporus crude extract | Absorbance of the colored products of the enzymatic oxidation | 2.3 × 10−5 | Present work |
Sample Availability: Not available. |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Morosanova, M.A.; Fedorova, T.V.; Polyakova, A.S.; Morosanova, E.I. Agaricus bisporus Crude Extract: Characterization and Analytical Application. Molecules 2020, 25, 5996. https://doi.org/10.3390/molecules25245996
Morosanova MA, Fedorova TV, Polyakova AS, Morosanova EI. Agaricus bisporus Crude Extract: Characterization and Analytical Application. Molecules. 2020; 25(24):5996. https://doi.org/10.3390/molecules25245996
Chicago/Turabian StyleMorosanova, Maria A., Tatyana V. Fedorova, Alexandra S. Polyakova, and Elena I. Morosanova. 2020. "Agaricus bisporus Crude Extract: Characterization and Analytical Application" Molecules 25, no. 24: 5996. https://doi.org/10.3390/molecules25245996