Next Article in Journal
β-Thujone and Its Derivatives Modify the Probing Behavior of the Peach Potato Aphid
Next Article in Special Issue
Functional Fragments of AIMP1-Derived Peptide (AdP) and Optimized Hydrosol for Their Topical Deposition by Box-Behnken Design
Previous Article in Journal
First Report on a Solvent-Free Preparation of Polymer Inclusion Membranes with an Ionic Liquid
Previous Article in Special Issue
Low Levels of IgM and IgA Recognizing Acetylated C1-Inhibitor Peptides Are Associated with Systemic Lupus Erythematosus in Taiwanese Women
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Insulin Release Mechanism Modulated by Toxins Isolated from Animal Venoms: From Basic Research to Drug Development Prospects

by
Beatriz Elena Sarmiento
,
Luis Felipe Santos Menezes
and
Elisabeth F. Schwartz
*
Departamento de Ciências Fisiológicas, Instituto de Ciências Biológicas, Universidade de Brasília, Brasília, DF 70910-900, Brazil
*
Author to whom correspondence should be addressed.
Molecules 2019, 24(10), 1846; https://doi.org/10.3390/molecules24101846
Submission received: 1 April 2019 / Revised: 23 April 2019 / Accepted: 9 May 2019 / Published: 14 May 2019
(This article belongs to the Special Issue Bioactive Peptides—From Therapy to Nutrition)

Abstract

Venom from mammals, amphibians, snakes, arachnids, sea anemones and insects provides diverse sources of peptides with different potential medical applications. Several of these peptides have already been converted into drugs and some are still in the clinical phase. Diabetes type 2 is one of the diseases with the highest mortality rate worldwide, requiring specific attention. Diverse drugs are available (e.g., Sulfonylureas) for effective treatment, but with several adverse secondary effects, most of them related to the low specificity of these compounds to the target. In this context, the search for specific and high-affinity compounds for the management of this metabolic disease is growing. Toxins isolated from animal venom have high specificity and affinity for different molecular targets, of which the most important are ion channels. This review will present an overview about the electrical activity of the ion channels present in pancreatic β cells that are involved in the insulin secretion process, in addition to the diversity of peptides that can interact and modulate the electrical activity of pancreatic β cells. The importance of prospecting bioactive peptides for therapeutic use is also reinforced.

1. Introduction

Diabetes is a disease caused by a progressive and chronic metabolic malfunction, characterized by the body’s inability to maintain the glucose homeostasis condition [1]. Individuals with this disease may develop hyperglycemia, hyperinsulinemia, and hypertriglyceridemia [2]. Among the possible causes there are ethnicity, age group, obesity, sedentarism, family history [1,3] and also diseases, for example cystic fibrosis or pancreatitis, in addition to drugs such as glucocorticoids or the effects of organ transplantation [4]. There are four types of diabetes: type 1 diabetes (T1D), type 2 diabetes (T2D), gestational diabetes mellitus and specific types of diabetes that are caused by other reasons, such as monogenic diabetic syndrome, pancreatic or drug-related diseases, and chemical inducers [5]. In the United States, 30 million people are now afflicted with diabetes, 84 million are in prediabetes condition, and this disease was the seventh leading cause of death in 2015 [6]. Currently, there are about 422 million cases of diabetes in the world, with estimated growth to 592 million in 2035; of these, T2D is the most prevalent, responsible for about 95% of cases recorded [7]. T2D can occur due to the progressive loss of β cells secreting insulin or its resistance to absorption [8], while T1D occurs due to the destruction of autoimmune β cells, thus leading to very little or no insulin production, and gestational diabetes is usually discovered in the second or third trimester of pregnancy, but its causes are not known [5].
In patients with T2D, frequent infections and difficulties in wound healing are commonly diagnosed, causing multiple damage and complications in the organism, thus contributing to a high rate of diabetes mortality [9]. For these reasons, dietary changes, exercise and the continuous monitoring of glycemic levels can aid in the prevention and treatment of diabetes [10,11]. Treatment agents like sulfonylureas, thiazolidinedione and glucagon-like peptide agonist 1 (GLP-1) help in the treatment of T2D, while exogenous insulin applications are required for T1D [12]. However, current treatment agents can cause several adverse effects [13], and therefore the treatment of this disease demands multiple medications to control blood glucose levels [14].
In recent years, several drugs have become available for use, and some even have demonstrated that they cause weight loss and reduce the cardiovascular risk [14], but due to several limitations in the actual treatment, the development of new drugs is still necessary. Peptides isolated from animal venoms could be a new path to follow, and because some of them have selectivity and affinity for their molecular targets, they could be used to study, correlate and possibly counteract the biological malfunction in the insulin release process. Based on the ability of many of these peptides to interact with ion channels, in this review we will focus on the main ion channels that are involved in the insulin secretion process, and on peptides isolated from animal venoms that modulate the insulin release with possible and actual therapeutic use in T2D treatment.

2. Insulin Release Mechanism

The endocrine function of the pancreas is to control blood glucose levels; this organ is comprised of exocrine (97%) and endocrine tissues (1–2%) [15,16]. Most of the endocrine cells in the islet of Langerhans are called β cells (50%), which are responsible for secreting insulin into the blood circulation in response to an increase in the plasma glucose levels, and they are the only source of insulin known in mammals [16]. Several nutrients stimulate insulin secretion from pancreatic β cells, and glucose, as the most potent and best stimulus for this response [16].

Metabolic Events and Electrical Activity in β Cells

Cells in the islet of Langerhans are excitable [17], and high concentrations of glucose depolarize the membrane of pancreatic β cells [18]. The mechanism that links glucose sensing to insulin secretion (GSIS) has been extensively studied in β cells and involves the activity of metabolic events such as glycolysis [16,19], helped by glucose transporters (GLUT) like GLUT2 and Type-1 glucose transporters in rodents and humans, respectively [19,20,21,22]. Glucose enters the cells and is phosphorylated by glucokinase (GCK) to glucose-6 phosphate (G6P). In the cytoplasm, G6P enters the glycolytic pathway until pyruvic acid is obtained, which will produce Acetyl-CoA. This, in turn, starts the Krebs cycle and oxidative phosphorylation in the mitochondria, leading to a rise in the intracellular ATP/ADP ratio [16,19] to induce a cascade of electrochemical events that culminate in the increase of intracellular calcium concentration and insulin secretion [19].
Several ion channels are present in mammals [16,19,23,24,25], and in humans, the plasma glucose level in the fasting state is around 4–5 mM. In this physiological condition the β cells are electrically silent at their resting potential, which oscillates about −60 mV; however, when glucose is low or absent the resting potential is around −70 to −80 mV [16,19]. As a consequence of glucose metabolism, the ATP/ADP ratio increases, which leads to the closure of the ATP sensitive potassium channel (KATP), promoting a slow depolarization of the membrane potential, which is also dependent on the activity of TRP channels [26]. Once depolarization of the membrane potential (Vm) begins and reaches around −40mV, the voltage gated sodium channels (Nav) open, and voltage-dependent calcium channels (Cav) are activated, which allows the increase in Na+ entry into the cells and causes further depolarization [17]. At −20 mV, the Cav open, and the influx of Ca+2 ions increases the concentration of intracellular calcium and, therefore, insulin release by exocytosis [26,27].
When extracellular glucose increases from basal to high levels (>10 mM), the increment of insulin release in the first few minutes (1 to 8 min) is sharp and transient, and it is referred to as the first phase of insulin secretion. A second increase is observed when high glucose concentration is maintained, gradually increasing the rate of release to a plateau after an additional 25 to 30 min, although the intensity of secretion is slower than in the first phase, and it is sustained until reaching euglycemia. The behavior of insulin release is therefore biphasic [28,29,30,31], and insulin thus regulates the storage of nutrients and the glucose uptake in the adipose tissue and muscle, which is extremely important in the life of mammals [16].
The closure of the KATP channel has been associated with the first phase of insulin secretion, letting the depolarization and exocytosis of a small pool of granules take place [32,33,34,35]. In the second phase of insulin secretion, the mechanisms involved seem to be more complex. They are still controversial, but it is proposed that the mechanism that signaled this secretion is a KATP channel-independent pathway of glucose signaling [36,37,38]. Finally, voltage-dependent potassium channels (Kv) and calcium sensitive voltage dependent potassium channels (KCa) repolarize the membrane potential and, in consequence, stop insulin secretion [39,40,41]. It is important to mention that the KATP channel-dependent pathway is referred to as the “triggering” pathway, and it is the main pathway of GSIS; it is also known that the increase of intracellular calcium by the KATP channel-independent pathway has a potential effect on the exocytotic machinery [17,42,43,44]. In this way, these two pathways are synergistic.
In this section, we outline how the different ion channels contribute to the electrical activity pattern and play an important role in the GSIS [19,45]. The electrical activity can be different among species and depends on the different expression of these ionic channels [17,19,46]. However, the aspects or mechanism of glucose sensing are the same [17].

3. ATP Sensitive Potassium (KATP) Channels and Insulin Secretion

KATP channels in pancreatic β cells were initially described by Cook and Hales (1984), where the physiologic role has been mostly characterized [33,47] and recently reviewed elsewhere [26,48]. In β cells and neurons, the function and the structural arrangement of KATP channel are formed by KIR6.2 subunit/SUR1 receptor [49], which are associated in a 1:1 stoichiometry [50]. Here, the most important functional and electrophysiological characteristics related to insulin release will be presented.
The role of the KATP channels is very important in the relationship between the energy metabolism of the cell and membrane excitability, because the activity of these channels in the presence of intracellular ATP is reduced; in contrast, it is enhanced by the presence of MgADP, leading these channels to have the status of metabolic sensor [51]. The SUR 1 receptor is responsible for nucleotide binding and hydrolysis of the nucleotide binding folds [19,52], and the KIR6.2 subunit is responsible for pore formation and ion selectivity [53]. Furthermore, the N and C terminals are intracellular in KIR6.2 channels and structurally important in the regulation by ATP and sulfonylureas [54]. The inhibition by ATP is the most predominant characteristic of KATP channels, where only one ATP molecule is enough to inhibit the channel and facilitate insulin secretion [55], but the ATP/ADP ratio is more relevant than ATP alone in regulating the KATP [47]. In this way, in the presence of ATP or ADP, the KATP channel regulation requires both subunits to work together and in a balance for the inhibitory effect of ATP and the stimulatory effect of ADP [19]. In addition, the ATPase activity of SUR1 drives discrete conformational changes that modulate the KATP channel gating [56].
From the point of view of electrical activity, the main function of KATP channels in β cells is to determine the resting potential in the membrane [57], and the electrophysiological properties of KATP channels have been thoroughly characterized [17,45,58,59]. It is important to mention that KATP channel closure alone is not sufficient to produce membrane depolarization; a depolarized membrane current is also required [60]. The increase of glucose levels from 6 to 20 mM [17] triggers depolarization, leading to a loss of KATP channel activity by >75%, an elevation of [Ca+2]int and subsequent electrical activity [60,61] that induces a much stronger stimulation of insulin release [17]. Furthermore, these channels can be regulated by lipids such as long chain acyl-CoA esters that interact with the carboxyl terminal domain of KIR 6.2 subunit [62]; they are the most potent stimulator of KATP channel activity in human pancreatic β cells [63]. Phosphatidylinositol-4, 5-biphosphate (PIP2), a second messenger that increases KATP channel activity [64], can regulate the K+ channel activity and therefore insulin release, because this ligand can interact with other proteins that also regulate KATP channels, and it has been suggested that these proteins could be involved with the exocytotic machinery [65].
For example, syntaxin-1A (Syn-1A) is a potent endogenous inhibitor of KATP [66] and regulates the KATP channel trafficking [67,68]. This is also the case of Leptin [69], which can activate different ion channels, including KATP, both in central neurons and β cells [70,71,72]. Activation of G protein coupled receptors mediates parasympathetic input and autocrine feedback in pancreatic β cells, thus facilitating glucose-stimulated insulin secretion. This is due to reduced KATP channel activity as a response to the activation of P2Y receptors and muscarinic receptors in the β cell membrane, which lead to an increase in [Ca+2]int and a decrease in PIP2 [73,74,75,76,77]. Protein phosphorylation is also a regulatory mechanism for KATP channel conductivity and density in pancreatic β cells, and protein kinase A (PKA) and protein kinase C (PKC) are responsible for it [78,79,80]. In the KIR6.2 subunit, PKA phosphorylation sites are threonine 224 and serine 372, and the phosphorylation of these residues significantly increases the probability of having an open channel [78]. Meanwhile, PKC phosphorylates the conservative threonine 180 and, as a result, decreases the KATP channel activity [80].

Inhibitors of KATP Channel Activity

Inhibitors of KATP channel activity can act either by interacting with SUR receptors or with KIR6.2 subunits [81]. Sulfonylureas such as tolbutamide, gliclazide and glimepiride have a high affinity to SUR receptors [82,83,84] and close the channel, but these compounds can also interact with KIR6.2 subunits with low affinity [83,85]. On the other hand, there are other compounds such Imidazolines and antimalarials that block KATP channels by binding to the KIR6.2 subunit [86,87,88]. The antimalarial agents known as quinoline drugs induce a variety of side effects, and the most important are cardiac abnormalities, neuropsychiatric disturbances and hypoglycemia [89]. Gribble and co-workers (2000) showed that mefloquine, quinine, and chloroquine inhibited the KIR6.2/SUR1 in pancreatic β cells, and that inhibition is mediated by interaction of the drugs with the KIR6.2 subunits of the KATP, rather than with the regulatory SUR subunit [88,90]. Lopez-Izquierdo and co-workers (2011) postulated that the inhibition of KATP channels by mefloquine results from the interaction between PIP2 and KIR channels [91], a proposition which is supported by a number of studies that conclude that this interaction directly controls KIR channels gating [92,93,94,95]. PNU99963 and PNU37883A are selective but structurally different non-sulfonylurea KATP channel inhibitors [96,97], and electrophysiological studies showed that PNU37883A at low micromolar concentrations inhibited KATP currents in single vascular smooth muscle [98]. Moreover, it was a direct pore blocker for the KIR6.1 subunit, while PNU99963 interacted with high nanomolar affinity with the sulfonylurea receptor [99,100].

4. Nav Channels and Insulin Secretion

Voltage dependent Na+ channels (VDSC) play a central role in cellular excitability [101], and their presence in mouse islets was described for the first time by Plant in 1988 [102]. VDSC are dually influenced by the membrane potential, because they are activated in response to membrane depolarization and inactivated as a consequence of sustained depolarization [103]. Pancreatic β cells have a voltage-dependent Na+ current that, owing to the voltage dependence of inactivation, is unlikely to play an important role in glucose-stimulated electrical activity [102]. In this scenario, at the resting potential most VDSC are inactivated or closed, and their inactivation can be removed only by membrane hyperpolarization [19]. Hiriart and Matteson (1988) demonstrated for the first time that all rat β cells contain VDSC and also indicated that this current is functionally important for stimulus secretion coupling, because TTX (Na+ channel blocker) partially inhibits glucose-induced insulin secretion, but at higher glucose concentrations TTX clearly inhibited the secretory response [104]. Later, it was demonstrated that VDSC are important for reaching the highest insulin release rate [105]. A few years later, it was discovered that the VDSC are present in pancreatic β cells from humans and canines and participate in GSIS by depolarizing the membrane of the cells [39,106]. However, their role in rodent pancreatic β cells is intriguing, because VDSC exhibit a voltage dependence of inactivation and, when held at membrane potentials found under physiological conditions, depolarization does not evoke Na+ currents in these cells [102,107,108].
Despite these important advances in research, we can assume that VDSC have not been as exhaustively studied as other channels in pancreatic β cells have. However, it is well known that VDSC modulators can modify the insulin release ratio [109]. Human pancreatic β cells express Nav1.6 and Nav1.7 subtypes [39], while Nav1.3 and Nav1.7 are expressed in rodents [110,111]. Besides, it was found that Nav1.7 (the highest expressed) and Nav1.3 isoforms significantly contribute to approx. 30% of the current mediated by the Na+ channel among the β cell population [111]. Ernest and co-workers (2009) reported that a knockout of Scn1b, which is predominantly expressed in β cells and codes for Nav1.7 in pancreatic β cells, causes defects in insulin release [111,112]. Velasco and co-workers (2016) reported that the Nav channels’ classical role in insulin release involves pancreatic β cell activation, soon after closure of the highly glucose-dependent KATP channel, enhancing depolarization, which promotes Ca+2 influx and insulin secretion. Na+ influx leads the membrane to further depolarize, since Na+ currents activate fast and transiently with a maximum current around −10mV, and this current is completely inactivated milliseconds after it begins. Consequently, high voltage-activated Ca+2 channels open [104]. It is widely known that β cells in pancreatic tissue express a different ion channel that uses the electrical signal coupled to blood glucose concentration to determine the insulin release ratio [113,114,115,116], such as Ca+2 and K+ channels [117,118].
Goncalves and co-workers (2003) showed that in the presence of high levels of glucose concentration the activity of VDSC and insulin secretion was enhanced [119]; therefore, it was suggested that their function is related to the variation of glucose concentration [104,119,120]. Years later, Zou and co-workers (2013) proposed that Na+ currents may be increased with an increment in glucose levels, which increases ATP production in pancreatic β cells; for this reason, VDSC are connected with the ATP levels or ATP ratio in β cells [121]. The idea is supported by whole cell recordings on pancreatic β cells from slices of rat pancreas, where increased concentrations of ATP from 2 to 8 mM in the recording pipette enhance the activity of the Na+ channel. This, in turn, plays a significant role in modulating the cell excitability and insulin secretion in pancreatic β cells, when blood glucose levels increase and change the inactivation curve to more positive potentials, and accelerate the recovery of the inactivation of Nav channels in a dose-dependent manner [121]. In this way, it is possible that the modulation of VDSC by ATP explains their role in glucose-stimulated electrical activity and insulin release, suggesting a metabolic regulation [121]. However, using insulin-secreting cells, Godazcar and co-workers (2018) did not observe an effect on the inactivation of endogenous Nav currents at 5, 11 and 20 mM of glucose, and at acutely increased glucose levels (1 to 20 mM) on Nav1.3 and Nav1.7 currents they observed no effects on inactivation [122].
It was previously reported that TTX inhibits the Na+ current and reduces glucose-stimulated insulin secretion by 55 to 70% [39]. Considering the contradictory and adverse effects in the relationship between the Na+ channel and insulin release, further experiments to explore the mechanism of ATP modulation in Na+ channel activity are needed. However, it has also been seen that the role of the VDSC in GSIS coupling is far from being a single mediating step between Ca+2 entry and inactivation of the KATP channel; indeed, recent mathematical modeling supports the idea that Na+ currents could be more important than previously thought [123]. Usually, VDSC regulate the physiology of pancreatic β cells through mechanisms other than just a depolarizing effect, and there is fascinating evidence that suggests VDSC interact with the metabolism in a bidirectional way. However, the role of these channels remains unknown [58,60,121], and it is still not completely understood in diabetes and metabolic syndrome [26]. Recently, Chen and co-workers (2018) presented the first direct evidence on the role of VDSC in the INS-1 cell line in response to changes in extracellular glucose levels. It was found that as the amplitude of the Na+ current decreased, the Na+ current of the steady state activation was suppressed with the negative shift in activation curves. Furthermore, the time course of Na+ current recovery from inactivation was prolonged, and it increased the insulin release, indicating that these channels of INS-1 cells were involved in the modulation of glucose homeostasis [124].
In addition, the activity of VDSC can also be modulated by endogenous signals, which usually act as downstream effectors of signaling cascades, such as the nerve growth factor (NGF), an endogenous molecule that favors pancreatic cell survival and insulin secretion [105,125]; these signals also enhance the activity of Ca+2 channels in pancreatic β cells [126]. The effects of NGF on both channel types are mediated by TrkA, a high-affinity receptor with intrinsic tyrosine kinase activity [127].

5. Cav Channels and Insulin Secretion

Previous reviews on glucose sensing and insulin release focused mainly on the role of KATP channels and voltage-dependent calcium channels (VDCCs) and their intrinsic relationship with insulin release, because the closure of KATP channels opens the VDCCs, allowing the influx of Ca+2 through the membrane. In this way, the increment of intracellular calcium acts as the most important messenger for insulin release [45,128,129]. Native pancreatic β cells from several species and also cell lines have different types of VDCCs [19,130], and they are located near insulin granules [128]. It has been seen that the dysfunctions of these channels alter insulin secretion, reinforcing the hypothesis that VDCCs play an important role in GSIS [129]. It has been suggested that Cavβ2 and Cavβ3 subunits could modulate GSIS by the interactions between VGCCs and PKC isozymes [131]. In β cells, the VDCCs mediate the calcium influx through the protein-protein interactions, enzymatic responses and electrical activity, playing an important role in the insulin secretion process; however, VDCCs could also help in the growth, maturation, development, survival and death of β cells [19,126,132,133].
One of the reasons for the biphasic insulin secretion process may reflect the sequential release of different pools of granules, which are associated with different subtypes of L type Ca+2 channels [128], and they are best characterized in pancreatic β cells. Since the influx of Ca+2 through them represents the largest contribution to increasing [Ca+2]int, this will favor insulin secretion. Moreover, they are the main contributors to the whole cell Cav current and insulin granule exocytosis in human, rat, and mouse β cells [16,134]. Pharmacological experiments have shown that 60–80% of the insulin release ratio can be attributed to calcium influx, mainly the L type Ca+2 channel pathway [135]. Cav1.2 and Cav1.3 channels (L type) are present in rat, mouse and human β cells. However, the Cav1.3 channel is most expressed in rat and human β cells [134,136]; besides, this channel type is the most important for the insulin secretion process [19,137,138] and plays a role in cAMP homeostasis through adenylate cyclase 1, and it may participate in insulin secretion in an indirect manner [134]. In contrast, the Cav1.2 channel is highly expressed in mouse β cells [19,134,138].
The presence of Cav2.1 (P/Q type) and Cav2.3 (R type) channels has been described in β cells from humans and mice, respectively [132] and in all primary and tumoral cell studies to date [129], and these types of channel do not seem to play an important role in GSIS [139]. However, Cav2.3 ablation strongly suppressed the second phase of insulin release [140]. T type Cav3.1 and Cav3.2 channels in rat β cells activate around −40 mV with rapid inactivation and slow deactivation; they may play the role of pacemaker in glucose-stimulating levels [19,104] and in this way play a significant role in the regulation of insulin secretion.
Several mechanisms, such as Ca+2/calmodulin signaling, protein phosphorylation, G protein-coupled receptors and phosphorylated inositol can endogenously regulate Ca+2 channels’ activity and their density in pancreatic β cells in the membrane [129]. They all regulate the influx of calcium at survival levels into the cell, and it is important to emphasize that they are among the main mechanisms that regulate L type calcium channels, which are the main focus of this review.
Possible regulation of Ca+2 channels and insulin secretion in the pancreatic β cells is regulated by cAMP, PKA, and PKB [129]. An increment of Ca+2 influx through VDCCs is observed with cAMP analogs or activators of PKA [141,142]. Besides, mouse β cells showed an increment of exocytotic activity after PKA activation [143], and there was an increment in amplitude in the L type Cav current in a dose-dependent manner after cAMP-analog exposure [129,144]. PKB interacts with the L type calcium channel activity via phosphorylation of the Cavβ2 subunit, promoting calcium channel trafficking to the membrane and, in this way, PKB participates in GSIS [145]. On the other hand, PKC modulation has been suggested to play a tonic role in maintaining Ca+2 channel function, and the effect of Cav channels by PKC activation is controversial [129]. It is also not clear whether the regulation of Ca+2 channels is carried out calcium/calmodulin-dependent kinase II (CaMKII); a reduction of Ca+2 influx through Cav channels and insulin release ratio was observed in pancreatic β cells after CaMKII inhibition [146].
The research of Schwetz and co-workers (2013) showed that activation of somatostatin receptors reduces GSIS in mouse islets by modulating L type calcium channels, and it has been suggested that somatostatin can exert this effect through a Gβγ protein-dependent mechanism [147]. Experiments in the secreting HIT cell line showed an increase in [Ca+2]int in response to glucagon, but this effect was blocked by either chelation of extracellular Ca+2 or application of Cav1 channel blockers [132,148]. It has been suggested that the effect of GLP-1 on mouse β cells stimulates insulin release due to a slower time-dependent inactivation of Cav currents; these effects have been seen in Ca+2 channels in human and rat pancreatic β cells [132]. Sarah and co-workers suggested that the intracellular II-III loop domain of Cav1.2 and Cav1.3 might target these channels to specific membrane microdomains, allowing their interaction with proteins involved in GLP-1 signaling [149].
Parasympathetic innervation of islets modulates insulin secretion, releasing acetylcholine, which activates muscarinic receptors and stimulates insulin secretion [16], but this acetylcholine also inhibits the Cav channel activity in mouse β cells [150]. However, studies in HIT cell lines have shown that muscarinic receptors increase the amplitude of whole cell Cav currents and the probability of the Cav1 channel being open [129]. Nevertheless, little information is available so far on acetylcholine signaling in β cells. Exocytotic proteins like SNAP-25, synaptotagmin and syntaxin1A also interact with L type calcium channels; β cells predominantly express Syn-1A, Syn-2, and Syn-4 in the membrane and Syn-3 in the secretory granules [26]. This interaction modulates the Cav1 channels and the exocytotic activity and could mediate exocytosis of predocked insulin-containing vesicles during the first phase of GSIS [132]. The contributions of the different calcium channel types have not been deeply studied in several species, a reason why this is still controversial.

6. Transient Receptor Potential (TRP) Channels and Insulin Secretion

It is worthwhile considering a different conceptual scenario where TRP channels could possibly be involved in the regulation of the insulin secretion process. TRP channels are composed of non-selective cation channels that act as cellular sensors and mediate the responses to changes in the extracellular environment [151]. They also play an important role in the background current that contributes to membrane depolarization after KATP channels’ closure [152] and in cellular processes such as hormone secretion and reloading Ca+2 stores [151]. TRP channels are present in pancreatic β cells (human, mouse, rat) and insulin-secreting cell lines [151,152,153], and they have been suggested to be involved in the regulation of [Ca+2]int [154]. In mammals, TRP channels are grouped in six sub families [155], and almost all of them are located on the intracellular membranes, in addition to the plasma membrane [156]; all share a common tetrameric structure, which is similar to the voltage-gated K+ channel [157]. TRP channel function is influenced by large intracellular domains that can be modulated by phosphoinositides, ammonium ions and venom toxins [158,159,160].
TRPM2 channels could contribute to insulin release induced by glucose, temperature stimuli and incretin hormones [161,162]; for example, exedin-4 is a GLP-1 receptor agonist that favors the insulin release from rat pancreatic β cells. In islets after shRNA-mediated knockdown of TRPM2 expression, the insulin release was significantly reduced [161], and it has been described in pancreatic β cells that the Ca+2 entry through TRPM2 channels acts as an inductor of GSIS after protein kinase A activation [162,163]. TRPM5 and TRPM4 channels are candidates for inducing cellular depolarization in response to increasing [Ca+2]int concentration. It has been shown that TRPM5 channels have a functional role in pancreatic β cells, and this function is involved in the regulation of the insulin release process [164]. Recently, TRMP5 channels have been considered as a modulator of GLP-1R in a PKC-dependent pathway; and these channels are shown to be at least partly responsible for the GLP-1 mediated insulinotropic effects [165]. The pharmacological potential of TRPM5 should be to lead to the stimulation of the physiological path in the insulin secretion process [164,166]. On the other hand, the TRPM5 channel has been considered as an important determinant of Ca+2 oscillation in mouse β cells [164], and the absence of this channel causes significant glucose intolerance in adult animals [164,167]. In addition, TRPV1 channels might also be an interesting drug target for compounds that modulate channel activity, insulin release and GLP-1 secretion [168]. The depolarization caused by the activation of TRPM3 channels could lead to the activation of L type Ca+2 channels [169,170], while activators of these channels also enhance glucose-dependent insulin release [170,171].
TRPM4 channels are a component in the control of [Ca+2]int signals for insulin release, and it is probable that TRPM 4 channels are not involved in the signal mechanism following glucose stimulation, but this does not exclude a possible role of TRP4 channels in G-receptor (Gq-or Gs receptor-coupled) signaling pathways, as has been seen during stimulation with glucagon. Besides, GLP-1 insulin release stimulation is at least partially dependent on PKC and TRMP4 channel activation [165]. The TRPV4 channel is expressed in mouse pancreatic islets and min6 β cells, where it confers a human islet amyloid polypeptide (hIAPP)-induced rise of the intracellular Ca+2 levels that activated these channels; however, hIAPP induces cytotoxicity and contributes to the loss of β cells [172]. Recently, Skrzypski et al., 2013 showed that TRPV4 triggers glucose-stimulated insulin secretion by modulating intracellular calcium [173].
Evidence suggested that several TRP channels regulate the insulin secretion process and pancreatic β cells function through the ability of these channels to increase the [Ca+2]int and membrane depolarization, which could be one of the functions that they play in GSIS in the pancreatic β cells [174], but their specific role in the insulin secretion process has not been fully unraveled [175]. In mammals, it has been seen that the participation of these channels in metabolic status and particularly in the pathophysiology of pancreatic β cells has increase over the years. There is no doubt of the importance of these channels in controlling insulin secretion in response to many stimuli [163,176]. Considering the side effects of sulfonylureas, it is necessary to develop new insulin secretagogues, and TRP channels are interesting targets for this development. Indeed, several TRP channels have an important potential for use as a target for insulin-tropic drugs, a feature that makes the investigation of their function in human islets an urgent and challenging task.

7. Kv Channels and Insulin Secretion

The insulin secretion process ends when the pancreatic β cells are repolarized by the activation of potassium channels such as Kv and KCa [39,40,41]. It has been recognized that voltage-dependent outward K+ currents in insulin-secreting cells are involved in both Kv and KCa current components, where the Kv component contributes 80 to 85% of total voltage-dependent outward currents, while the KCa component contributes 15 to 20% [177,178,179]. Although the role of Kv channels involved in the regulation of GSIS still remains obscure [180], recent research has suggested that Kv1, Kv2 and KCa channels, and recently Kv1.7 channels, are important for the insulin secretion process.
It has been suggested that Kv1 channels represent 25% of the β cells’ delayed rectifier currents, whereas Kv2 channels represent 60% [181,182,183,184], and the latter are considered the most prominent Kv channels in β cells [152]. Kv2.1 channels serve as a break for glucose-stimulated insulin secretion [152,177,184,185], and their inhibition enhances GSIS [181,182,183,184]. These channels activate gradually and inactivate slowly or do not inactivate at all, and they mediate the majority of the voltage-dependent outward K+ current in mouse and rat β cells [152,177,184]. Several studies identify the Kv2.1 channel as the major contributor to voltage-dependent outward K+ currents in rodent pancreatic β cells and insulinoma cells lines [177,184] and regulate excitability [Ca+2]int and insulin secretion [177,184]. The Kv2.1 channel has been reported to be involved in the maintenance of fasting blood sugar during the burst of β cells’ insulin release between meals, but it is considered a difficult pharmacological target due to its widespread expression [186].
KCa channels are regulated commonly by intracellular Ca+2 [19], and the kinetics of the currents suggests the capability of these channels to modulate electrical activity, including action potential shape and amplitude [40,41]. The BK type is present in pancreatic β cells, and their important role in GSIS was evident when blockage of these channels increased action potential amplitude and enhanced the insulin release by 70%; in contrast, the inhibition of Kv2.1/2.2 channels’ activity did not show any stimulatory effects on electrical activity and insulin secretion [39]. It has also been suggested that the BK type participates in repolarizing the plateau or the spikes [187], as does the Kv2.1 channel [186]. The expression of Kv1.7 at high levels in rodent islets suggests that these Kv subtypes to the remainder of the β cells delayed rectifier current [178,188], and it was also elucidated that the gene for human Kv1.7 mapped to chromosome 19q13.3; it is a region considered an important diabetes susceptibility locus [189]. Finol-Urdaneta and co-workers (2012) described a toxin (Conkunitzin-S1) that blocks the Kv1.7 channel subtype, and as a consequence there is an increasing glucose-stimulated insulin release due to the increase in action potential firing [180]. They thus demonstrated that these channels are physiologically relevant for the pancreatic insulin secretion process, and indicated that Kv1.7 activity contributes actively to the control of GSIS in pancreatic β cells [180].
Pharmacological inhibition and even genetic ablation of Kv channels result in a prolongation of action potential duration that increases [Ca+2] and insulin secretion [177,186,190], which has been seen in mouse β cells in the presence of antagonist tetraethylammonium (TEA) [191,192]. It is important to emphasize that inhibition of Kv channels results in potentiation of the insulin secretion process in a glucose-dependent manner, because in physiological conditions these channels only open in response to membrane depolarization at high glucose level [185]. Previous studies have shown that the activation of Ca+2 channels and mobilization of calcium from intracellular stores are responsible for cAMP-regulated cellular function [144,193]. Liu and co-workers (2017) provided new evidence that demonstrates the ability of cAMP signaling to enhance [Ca+2]int, and insulin secretion is also due to the inhibition of Kv channels; it is suggested that the cAMP/Kv channel pathway could be a therapeutic strategy for diabetes treatment [194]. This point of view is also supported by the studies with the GLP-1 receptor agonist that potentiated insulin secretion in a glucose-dependent manner through the cAMP pathway [195,196]. Since pancreatic β cells’ Kv current is considered a potent glucose-dependent regulator of insulin secretion, MacDonald & Wheeler hypothesized that the physiological secretagogue GLP-1 could regulate Kv channel function. In general, the glucose dependence of the insulinotropic effect of Kv inhibitors makes these channels promising targets for the development of treatments [190].
Finally, ERG K+ channels are also part of the larger family of Kv channels [197]. They are present in pancreatic α and β cells [198,199] and modulate cellular activity by controlling the repolarization of the action potential [200,201]. It has been suggested that inhibition of Erg1 K+ channel activity in β cells enhances insulin secretion under high glucose-stimulatory conditions, while in the alpha cell, channel blockage inhibits secretion of glucagon under low glucose conditions [198]. This could be a possible therapeutic mechanism for the treatment of diabetes.

8. Calcium as a Messenger for Insulin Secretion

The electrophysiological properties of any given cell are determined by its ion channel activity. The manner in which the different ion channels contribute to electrical activity in mouse and human pancreatic β cells has been briefly outlined; all of them favor the increment of [Ca+2]int. Ca+2 is an important messenger for diverse biological activities [202], and changes in its concentration in the different compartments on the cell are crucial [203]. Thorough studies have shown that intracellular Ca+2 levels in pancreatic β cells are maintained by Ca+2 entry, predominantly through VDCC, Ca+2 uptake and release from organelles and intracellular stores, and the Ca+2 expulsion via plasma membrane pumps such as Ca+2 ATPase (PMCA) and exchangers such as the Na+/Ca+2 exchanger (NCX) [204,205,206], so any alterations in this regulatory process can affect the insulin secretion process [207].
Na+/Ca+2 exchange represents an important modulator of cytosolic free Ca2+ concentration and participates in both Ca2+ outflow and Ca2+ inflow, depending on the state of cell activity [208]. This exchange can also be stimulated by glucose and membrane depolarization [209]. For this reason, the regulation of Na+/Ca+2 exchange may be of great interest in the understanding of the stimulus for secretion coupling of glucose-induced insulin release from the pancreatic β cells; however, it must be kept in mind that Na+/Ca2+exchange is a complex system that allows both Ca2+ entry and outflow and generates, in addition, an inward current, while the plasma membrane PMCA only extrudes Ca2+ [210].
As seen in rat pancreatic β cells, Na+/Ca2+exchange displays quite a high capacity [209] and participates in the control of [Ca2+]int and insulin release [211,212]. Van Eylen and co-workers confirmed in 2002 that Na+/Ca2+exchange plays an important role in Ca2+ homeostasis, suggesting that the current generated by this exchange shapes stimulus-induced membrane potential and [Ca2+]int oscillations in insulin-secreting cells [210]. It is important to mention that in the exocytosis of insulin granules in pancreatic β cells, the cyclic AMP (cAMP) is the most important regulator and amplifier besides calcium [213,214,215]. The cAMP promotes secretion of insulin at several levels, while the related mechanisms that have been proposed include mobilization of Ca+2 from intracellular stores [216,217] and modulation of ion channel activities from KATP channels [218], L type voltage-dependent Ca+2 channels [219] and the non-selective cation channels [220]. This may take place either by increasing the electrical activity, [Ca2+]int, by recruiting granules or by acting directly on the exocytosis machinery that accounts for as much as 80% of its effect [217]. This is the reason why cAMP has the most important effects on secretory granule trafficking and exocytosis [150] and also can be the second messenger in the insulin release process. In this way, Ca+2/cAMP signaling interaction could be a new therapeutic target for antidiabetic medicines [221] and other diseases [222].
It has been established that inhibition of Kv channels boosts insulin secretion via prolongation of action potential [152,186], but there is also evidence suggesting that endogenous or exogenous enhancement of cAMP profoundly inhibits Kv channels, which in turn prolongs action potential and increases [Ca+2]int, suggesting that targeting the cAMP/Kv channel pathway may be a therapeutic strategy for diabetes treatments [194]. Finally, the effects of cAMP on pancreatic β cells are not restricted to regulation of membrane potential or the influx of calcium, but cAMP can also be involved in the mobilization of the ion from intracellular stores and other different signaling (insulin and glucagon) on the cells (more information see review [223].

9. Sulfonylureas and Diabetes

Sulfonylureas have been the group of drugs used as the main treatment of T2D for a long time, and they act in a glucose-independent manner [184,224,225]. In 1995, before the cloning of the SUR 1 subunit was carried out, the high affinity sites for sulfonylureas were localized in the membrane of β cells [226,227] with a dissociation constant at nanomolar range [47], which was the molecular target of these compounds [81]; moreover, their adverse effects were also improved [225,228,229]. Sulfonylureas induced the closure of KATP channels and depolarization of the membrane, leading to the opening of calcium channels favoring ion flow into the cell, generating insulin release by β cells in the pancreas [45]. As a result, they have been used as oral hypoglycemic agents for more than 50 years [225]. Nonetheless, clinically, these inhibitor compounds are used to treat T2D and hypoglycemic states, respectively [230,231,232,233]. In this scenario, it is important to find other strategies for treatment of disease, and natural resources such as toxins from animal venom could be a good option.

10. Natural Resources and Diabetes

Animal venoms are unique sources of compounds that target receptors and ion channels [234,235,236], and over the past 80 years toxins found in venomous and poisonous animals have been studied in order to understand the biochemical and physiological mechanisms by which these toxins lead to pathological consequences; it was also found that there are a few toxins with therapeutic use [235]. A very brief summary is provided here of toxins isolated from venomous and poisonous animals from which therapeutic drugs have been developed or are under development, and other toxins that could have potential therapeutic use in favoring the insulin secretion process (Table 1).

11. Antidiabetic Agent from Lizard Venom: Exenaide

Between 2000 and 2013, 1453 new drugs were approved by the US Food and Drug Administration (FDA) [280], but despite the number of studies using compounds isolated from animal venoms with high selectivity and specificity for different molecular targets [281], the successful cases in the development of new therapeutic drugs are still rare [282]. An interesting example is exenaide, the synthetic version of exendin-4 (GLP-1), with 39 amino acid residues isolated from Heloderma suspectum venom. It shares 53% homology with the human GLP-1 [237] and avidly binds to the GLP-1 receptor on the surface of pancreatic β cells [283]; it is largely resistant to the action of serine protease Dipeptidyl peptidase-4 (DPP-4) [284]. The greater stability of the peptide exendin-4 sparked its rapid development and it is currently used for the treatment of T2D, because this compound reduces both fasting and prandial glucose levels [285]. In addition, it has been demonstrated that this compound limits food intake and increases satiety in normal glycemic and hyperglycemic individuals, with a consequent reduction in body weight [286,287,288]. It significantly increases the two phases of insulin secretion process in patients with T2D, indicating an improvement in the response of pancreatic β cells [289]. Exedin-4, a venom peptide, provides the first example for therapeutic application for metabolic diseases such as diabetes, and expert opinion positioned it as an effective and safe drug for the treatment of T2D that has been available as exenatide (Byetta®) since 2005, albeit presenting nausea as an adverse effect [290,291].

12. Peptides with Potential Utility in the Development of New Diabetes Therapeutics

In addition to exendin-4, other Glp-1 analogues from Ornithorhynchus anatinus (platypus) and Tachyglossus aculeatus (echidna) could be good candidates for T2D [292]. These peptides show interesting biophysical characteristics, including resistance to DPP-4 cleavage in a similar way to exendin-4, at concentration of 100 nM, equivalent stimulation of the insulin secretion process and relative bias toward pERK1/2, which is involved in the activation of mitogenic signaling pathways, unlike human GLP-1 and exendin-4 with relative bias for cAMP and intracellular calcium mobilization [244]. These signaling differences generated by monotreme peptides could be another option for the development of new GLP-1 as anti-diabetic agents, such as several peptides and their analogs isolated from skin of frog, especially, the insulinotropic peptide “FSIP” isolated from the skin secretion of the frog Agalychnis litodryas, which is in phase 3 of clinical trials [293].
Most of the natural peptides that help in the insulin secretion process involve the GLP-1 pathway, and just a few interact with ionic channels. This is the reason why incretin-based therapies are becoming increasingly important in the treatment of patients with T2D [294]. In the pancreatic β cells, the insulin secretion process involves several stimuli, which makes this biological activity a complex process, but it is glucose that plays the major role [16]. In this context, toxins like guangxitoxin-1 and α-latrotoxin enhance insulin secretion in a glucose-dependent manner [182,272,273]. On the other hand, the toxin CTX-I isolated from Naja kaouthia snake venom stimulated insulin secretion in a concentration-dependent manner in the absence of glucose [249]; this type of insulin secretion modulator is also highly attractive for the treatment of T2D [109].

13. Other Options: Peptides-ionic Channel Interaction

Blocking of KATP channels is the principal target of Sulfonylureas and, in natural resources, a new inhibitor peptide (SpTx-1) was recently isolated from Scolopendra polymorpha (spider pharm) venom with high affinity to the human ATP-sensitive KIR6.2 channel [295]. Ramu and co-workers (2018) show that SpTx-1 inhibits the KATP channels from the extracellular side with a dissociation constant value of 15 nM in a relatively specific manner and in an apparent one-to-one stoichiometry [295]. This is the first evidence for a natural peptide that inhibits the channel by primarily targeting the KIR6.2 subunit rather than the SUR 1 receptor. This peptide could be an effective tool for new discoveries in the physiological roles of KATP channels and might be an appropriate target for diabetes treatment, especially neonatal diabetes mellitus, which is insensitive to sulphonylureas. However, there is still no evidence that SpTx-1 favors the insulin secretion process. On the other hand, the peptide mastoparan has been suggested to interact with these channels as well, but it has also been evaluated in different biological responses, to define the molecular mechanism involved in insulin secretion [274,275,276,277,278,279] (Table 1). Recently, Moreno and Gilart 2015 described mastoparan as toxic with a wide variety of biological effects [296], suggesting different biological applications for the peptide, but they did not consider insulin release, and maybe this is due to the lack of specificity of the peptide for this particular biological activity.
Amphibian skin secretions are a rich source of peptides with pharmacological properties that show potential for the development of antidiabetic agents [297]. A number of peptides and their analogs have been described, which favor the insulin secretion process by different pathways [297], such as GLP-1 receptors [252,253,255,256,257], KATP channel blocking in BRIN-BD11 cells [298], KATP channel-independent pathways [250], KATP channel-dependent pathways [299], or Ca2+-independent pathways [251] accompanied by physiological effects such as membrane depolarization and increased Ca2+ concentration [255,269,300,301,302]. Further, some of these peptides can interact with cAMP protein kinase A and C dependent G-protein sensitive pathways [258]. Basically, these amphibian peptides involve the most important signaling pathways for insulin release in pancreatic β cells, and most of them act without compromising the integrity of the plasma membrane; for this reason, this kind of peptide could be as important as the antimicrobial peptides (Table 1). Besides, there is evidence about several frog peptides at different concentrations (nM) that significantly and modestly enhance insulin release such as amolopin [303]; palustrin-1c [304]; xenopsin and xenopsin-AM2 [257]; plasticin-L1 and ocellatin-L2 [305]; phylloseptin L2 [251]; ranatuerin-2CBd, palustrin-2CBa, temporin-CBa, temporin-CBf [306]; brevinin-2GUb [307]; temporin-ITa [308], but unfortunately the mechanism is unknown.
In snake venoms several fractions have been found that significantly increase insulin release and do not exhibit any cytotoxic effects. For example, seven fractions isolated from Bitis nasicornis and Crotalus vegrandis snake venom that interfere in cell signaling pathways activated by integrins, such as receptor tyrosine kinases, may impact positively on insulin secretion [309]. However, the complete sequences of these fractions are not available yet. Crotoxin (crotapotin and PLA2 subunits) isolated from Crotalus durissus collilineatus snake venom stimulated secretion and is not dependent on an additional influx of Ca2+ through L-type channels, but instead is associated with arachidonic acid formation in pancreatic islets. The integrity of the plasma membrane of the pancreatic β cells was not altered by the exposure of the islets to PLA2, which is responsible for the secretion process [310].
For many years, modulators or blockers of KATP channels have been used for T2D, and research continues in this area. However, in recent years, the evidence has demonstrated that blockage or modulation of other potassium channel types such as Kv1.3, Kv1.4, Kv1.7 Kv2.1, Kv2.2 and the BK channel could be an attractive target for the management of T2D [39,181,182,183,184,190]. At the moment, only four peptides isolated from spiders, scorpion and conus (Table 1) block the potassium channel and increase insulin secretion; therefore, these toxins show another possible therapeutic pathway by which to treat diabetes [292], besides KATP channels. In this way, this anti-diabetic pathway could be more direct and focused whenever these toxins have a specific target in specific tissue and without secondary adverse effects.
Despite extensive research, selective channel blockers are limited, and most toxins that interact in these channels are rather non-selective [311]. For example, pharmacological inhibitors of the BK channel provoke an increase in the myogenic tone of various arteries [312]. Otherwise, it is important to keep in mind that the small size, compact and rigid structure, high potency, and selectivity of peptide inhibitors of mammalian potassium channels, such as charybdotoxin, margatoxin, and maurotoxin [313], have become valuable tools for research and drug development, including for diabetes. Toxins that modulate sodium channels, such as TsTx-V, depolarize mouse pancreatic β cells, increasing insulin secretion twofold over basal values [119], but the exact mechanism of action is unknown.

14. Conclusions

Diabetes is one of the most important diseases in the world, and it requires special attention. In recent decades, several treatments have been successfully used, but adverse effects are unfortunately an issue. In this context, the search for new treatments is urgent and challenging, and the toxins present in animal venoms may be an important source. The selectivity of some toxins for special targets such as ion channels has made them good candidates as molecular tools in the treatment of different diseases. We have outlined the toxins found in different groups of animals that contribute to the insulin secretion process; most of them are at the stage of simple basic research, one is currently under clinical trials or being developed for eventual therapeutic use, and one of them is a drug for diabetes treatment. In this line, a very important discovery for diabetes treatment was the peptide exendin-4, isolated from the venom in the saliva of the lizard Heloderma suspectum. It is now the only compound from natural sources being used to treat diabetes with success, but other insulinotropic peptides isolated from Agalychnis litodryas, Ornithorhynchus anatinus and Tachyglossus aculeatus could be on their way to becoming drugs. At the moment, we can see that most of the peptides from natural sources that help in the insulin secretion process involve the GLP-1 pathway, and just a few interact with ionic channels. Therefore, in this review, we aimed to provide a better understanding of the ionic mechanisms involved in the insulin secretion process and the importance of the use of natural resources for the characterization or treatment of several illnesses such as diabetes, highlighting the ionic channel as an alternative pathway for treatment. However, it is also important to emphasize the toxins that modulate insulin secretion, even though there have not been significant advances in the search to clarify their modulating role, because with the information available, suggestions only can be made.

Author Contributions

All authors listed have made a substantial, direct and intellectual contribution to the work, and approved it for publication.

Funding

This study was supported by Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) [407625/2013-5]. BESC and LFSM received a scholarship from CAPES, and EFS was supported by CNPq.

Acknowledgments

CAPES and University of Brasilia for financial support.

Conflicts of Interest

The authors declare that there is no conflict of interest.

References

  1. Bell, G.I.; Polonsky, K.S. Diabetes mellitus and genetically programmed defects in beta - cell function. Nature 2001, 414, 788–791. [Google Scholar] [CrossRef] [Scilit]
  2. American Diabetes Association. Diagnosis and classification of diabetes mellitus. Diabetes Care 2010, 33, S62–S69. [Google Scholar] [CrossRef] [Scilit]
  3. Chillarón, J.J.; Le-roux, J.A.F.; Benaiges, D.; Pedro-botet, J. Type 1 diabetes, metabolic syndrome and cardiovascular risk. Metab. Clin. Exp. 2014, 63, 181–187. [Google Scholar] [CrossRef] [Scilit]
  4. American Diabetes Association. Diagnosis and classification of Diabetes Mellitus. Diabetes Care 2014, 37, S81–S90. [Google Scholar] [CrossRef] [Scilit]
  5. American Diabetes Association. Classification and diagnosis of diabetes: Standards of medical care in Diabetes. Diabetes Care 2018, 41, S13–S27. [Google Scholar] [CrossRef] [Scilit]
  6. Centers for Disease Control and Prevention. National Diabetes Statistics Report. 2017. Available online: https://www.cdc.gov/diabetes/data/statistics-report/index.html (accessed on 29 March 2018).
  7. Xu, L.; Li, Y.; Dai, Y.; Peng, J. Natural products for the treatment of type 2 diabetes mellitus: Pharmacology and mechanisms. Pharmacol. Res. 2018, 130, 451–465. [Google Scholar] [CrossRef] [Scilit]
  8. Franks, P.W.; McCarthy, M.I. Exposing the exposures responsible for type 2 diabetes and obesity. Science 2016, 354, 69–73. [Google Scholar] [CrossRef] [Scilit]
  9. Mcgill, J.B.; Bakris, G.L.; Fonseca, V.; Raskin, P.; Messerli, F.H.; Phillips, R.A.; Katholi, R.E.; Wright, J.T., Jr.; Iyengar, M.; Anderson, K.M.; et al. beta-Blocker use and diabetes symptom score: results from the GEMINI study. Diabetes Obes. Metab. 2007, 9, 408–417. [Google Scholar] [CrossRef] [Scilit]
  10. Andrews, R.C.; Cooper, A.R.; Montgomery, A.A.; Norcross, A.J.; Peters, P.T.J.; Sharp, P.D.J.; Jackson, N.; Fitzsimons, K.; Mba, J.B.; Coulman, K.; et al. Diet or diet plus physical activity versus usual care in patients with newly diagnosed type 2 diabetes: the Early ACTID randomised controlled trial. Lancet 2011, 378, 129–139. [Google Scholar] [CrossRef] [Scilit]
  11. Grant, P. The perfect diabetes review. Prim. Care Diabetes 2010, 4, 69–72. [Google Scholar] [CrossRef] [Scilit]
  12. Bloomgarden, Z.T. Diabetes Treatment. Diabetes Care 2009, 32, e25–e30. [Google Scholar] [CrossRef] [Scilit]
  13. Phung, O.J.; Scholle, J.M.; Talwar, M.; Coleman, C.I. Effect of Noninsulin Antidiabetic Drugs Added to Metformin Therapy on Glycemic Control, Weight Gain, and Hypoglycemia in Type 2 Diabetes. JAMA 2010, 303, 1410–1418. [Google Scholar] [CrossRef] [Scilit]
  14. Inman, T.R.; Plyushko, E.; Austin, N.P.; Johnson, J.L. The role of basal insulin and GLP-1 receptor agonist combination products in the management of type 2 diabetes. Ther. Adv. Endocrinol. Metab. 2018, 9, 151–155. [Google Scholar] [CrossRef] [Scilit]
  15. Cabrera, O.; Berman, D.M.; Kenyon, N.S.; Ricordi, C.; Berggren, P.-O.; Caicedo, A. The unique cytoarchitecture of human pancreatic islets has implications for islet cell function. Proc. Natl. Acad. Sci. USA 2006, 103, 2334–2339. [Google Scholar] [CrossRef] [Scilit]
  16. Hiriart, M.; Velasco, M.; Larqué, C.; Diaz-Garcia, C.M. Metabolic Syndrome and Ionic Channels in Pancreatic Beta Cells. In Vitamins and Hormones; Academic Press: Cambridge, MA, USA, 2014; Volume 95, pp. 87–114. ISBN 9780128001745. [Google Scholar]
  17. Rorsman, P.; Braun, M. Regulation of Insulin Secretion in Human Pancreatic Islets. Annu. Rev. Physiol. 2013, 75, 155–179. [Google Scholar] [CrossRef] [Scilit]
  18. ROSENBERG, B.; VANCAMP, L.; TROSKO, J.E.; MANSOUR, V.H. Platinum Compounds: a New Class of Potent Antitumour Agents. Nature 1969, 222, 385–386. [Google Scholar] [CrossRef] [Scilit]
  19. Hiriart, M.; Aguilar-Bryan, L. Channel regulation of glucose sensing in the pancreatic β-cell. Am. J. Physiol. Metab. 2008, 295, E1298–E1306. [Google Scholar] [CrossRef] [Scilit]
  20. Clark, A.; Braun, M.; McCulloch, L.J.; van de Bunt, M.; Gloyn, A.L.; Frayn, K.N. GLUT2 (SLC2A2) is not the principal glucose transporter in human pancreatic beta cells: Implications for understanding genetic association signals at this locus. Mol. Genet. Metab. 2011, 104, 648–653. [Google Scholar]
  21. Thorens, B.; Sarkar, H.K.; Kaback, H.R.; Lodish, H.F. Cloning and functional expression in bacteria of a novel glucose transporter present in liver, intestine, kidney, and β-pancreatic islet cells. Cell 1988, 55, 281–290. [Google Scholar] [CrossRef] [Scilit]
  22. Johnson, J.H.; Newgard, C.B.; Milburn, J.L.; Lodish, H.F.; Thorens, B. The high Km glucose transporter of islets of Langerhans is functionally similar to the low affinity transporter of liver and has an identical primary sequence. J. Biol. Chem. 1990, 265, 6548–6551. [Google Scholar]
  23. MacDonald, P.E.; Rorsman, P. Oscillations, Intercellular Coupling, and Insulin Secretion in Pancreatic β Cells. PLoS Biol. 2006, 4, e49. [Google Scholar] [CrossRef] [Scilit]
  24. Ashcroft, F.M. ATP-sensitive potassium channelopathies: focus on insulin secretion. J. Clin. Invest. 2005, 115, 2047–2058. [Google Scholar] [CrossRef] [Scilit]
  25. Nichols, C.G. KATP channels as molecular sensors of cellular metabolism. Nature 2006, 440, 470–476. [Google Scholar] [CrossRef] [Scilit]
  26. Velasco, M.; Diaz-Garcia, C.M.; Larque, C.; Hiriart, M. Modulation of Ionic Channels and Insulin Secretion by Drugs and Hormones in Pancreatic Beta Cells. Mol. Pharmacol. 2016, 90, 341–357. [Google Scholar] [CrossRef] [Scilit]
  27. Félix-Martínez, G.J.; Godínez-Fernández, J.R. Mathematical models of electrical activity of the pancreatic β-cell: A physiological review. Islets 2014, 6, e949195. [Google Scholar] [CrossRef] [Scilit]
  28. Gustafsson, A.J.; Ingelman-Sundberg, H.; Dzabic, M.; Awasum, J.; Hoa, N.K.; Östenson, C.-G.; Pierro, C.; Tedeschi, P.; Woolcott, O.; Chiounan, S.; et al. Ryanodine receptor-operated activation of TRP-like channels can trigger critical Ca 2+ signaling events in pancreatic β-cells. FASEB J. 2005, 19, 301–303. [Google Scholar] [CrossRef] [Scilit]
  29. Sharma, N.; Crane, A.; Clement, J.P.; Gonzalez, G.; Babenko, A.P.; Bryan, J.; Aguilar-Bryan, L. The C Terminus of SUR1 Is Required for Trafficking of K ATP Channels. J. Biol. Chem. 1999, 274, 20628–20632. [Google Scholar] [CrossRef] [Scilit]
  30. Zawalich, W.S.; Yamazaki, H.; Zawalich, K.C. Biphasic insulin secretion from freshly isolated or cultured, perifused rodent islets: comparative studies with rats and mice. Metabolism 2008, 57, 30–39. [Google Scholar] [CrossRef] [Scilit]
  31. CURRY, D.L.; BENNETT, L.L.; GRODSKY, G.M. Dynamics of Insulin Secretion by the Perfused Rat Pancreas. Endocrinology 1968, 83, 572–584. [Google Scholar] [CrossRef] [Scilit]
  32. Henquin, J.C. Triggering and amplifying pathways of regulation of insulin secretion by glucose. Diabetes 2000, 49, 1751–1760. [Google Scholar] [CrossRef] [Scilit]
  33. Cook, D.L.; Hales, C.N. Intracellular ATP directly blocks K+ channels in pancreatic B-cells. Nature 1984, 311, 271–273. [Google Scholar] [CrossRef] [Scilit]
  34. Wollheim, C.B.; Sharp, G.W. Regulation of insulin release by calcium. Physiol. Rev. 1981, 61, 914–973. [Google Scholar] [CrossRef] [Scilit]
  35. Hoenig, M.; Sharp, G.W.G. Glucose induces insulin release and a rise in cytosolic calcium concentration in a transplantable rat insulinoma. Endocrinology 1986, 119, 2502–2507. [Google Scholar] [CrossRef] [Scilit]
  36. Taguchi, N.; Aizawa, T.; Sato, Y.; Ishihara, F.; Hashizume, K. Mechanism of glucose-induced biphasic insulin release: physiological role of adenosine triphosphate-sensitive K+ channel-independent glucose action. Endocrinology 1995, 136, 3942–3948. [Google Scholar] [CrossRef] [Scilit]
  37. Aizawa, T.; Komatsu, M.; Asanuma, N.; Sato, Y.; Sharp, G.W.G. Glucose action “beyond ionic events” in the pancreatic β cell. Trends Pharmacol. Sci. 1998, 19, 496–499. [Google Scholar] [CrossRef] [Scilit]
  38. Straub, S.G.; Sharp, G.W.G. Glucose-stimulated signaling pathways in biphasic insulin secretion. Diabetes. Metab. Res. Rev. 2002, 18, 451–463. [Google Scholar] [CrossRef] [Scilit]
  39. Braun, M.; Ramracheya, R.; Bengtsson, M.; Zhang, Q.; Karanauskaite, J.; Partridge, C.; Johnson, P.R.; Rorsman, P. Voltage-Gated Ion Channels in Human Pancreatic -Cells: Electrophysiological Characterization and Role in Insulin Secretion. Diabetes 2008, 57, 1618–1628. [Google Scholar] [CrossRef] [Scilit]
  40. Houamed, K.M.; Sweet, I.R.; Satin, L.S. BK channels mediate a novel ionic mechanism that regulates glucose-dependent electrical activity and insulin secretion in mouse pancreatic β-cells. J. Physiol. 2010, 588, 3511–3523. [Google Scholar] [CrossRef] [Scilit]
  41. Jacobson, D.A.; Mendez, F.; Thompson, M.; Torres, J.; Cochet, O.; Philipson, L.H. Calcium-activated and voltage-gated potassium channels of the pancreatic islet impart distinct and complementary roles during secretagogue induced electrical responses. J. Physiol. 2010, 588, 3525–3537. [Google Scholar] [CrossRef] [Scilit]
  42. Henquin, J.C.; Ravier, M.A.; Nenquin, M.; Jonas, J.C.; Gilon, P. Hierarchy of the beta-cell signals controlling insulin secretion. Eur. J. Clin. Invest. 2003, 33, 742–750. [Google Scholar] [CrossRef] [Scilit]
  43. Henquin, J.-C. The dual control of insulin secretion by glucose involves triggering and amplifying pathways in β-cells. Diabetes Res. Clin. Pract. 2011, 93, S27–S31. [Google Scholar] [CrossRef] [Scilit]
  44. Henquin, J.C. Regulation of insulin secretion: a matter of phase control and amplitude modulation. Diabetologia 2009, 52, 739–751. [Google Scholar] [CrossRef] [Scilit]
  45. Ashcroft, F.M.; Rorsman, P. Electrophysiology of the pancreatic β-cell. Prog. Biophys. Mol. Biol. 1989, 54, 87–143. [Google Scholar] [CrossRef] [Scilit]
  46. Fridlyand, L.E.; Jacobson, D.A.; Philipson, L.H. Ion channels and regulation of insulin secretion in human β-cells. Islets 2013, 5, 1–15. [Google Scholar] [CrossRef] [Scilit]
  47. Aguilar-Bryan, L. Molecular Biology of Adenosine Triphosphate-Sensitive Potassium Channels. Endocr. Rev. 1999, 20, 101–135. [Google Scholar]
  48. Tinker, A.; Aziz, Q.; Li, Y.; Specterman, M. ATP-Sensitive Potassium Channels and Their Physiological and Pathophysiological Roles. In Comprehensive Physiology; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2018; Volume 8, pp. 1463–1511. [Google Scholar]
  49. Inagaki, N.; Gonoi, T.; Clement, J.P.; Namba, N.; Inazawa, J.; Gonzalez, G.; Aguilar-Bryan, L.; Seino, S.; Bryan, J. Reconstitution of I(KATP): An Inward Rectifier Subunit Plus the Sulfonylurea Receptor. Science 1995, 270, 1166–1170. [Google Scholar] [CrossRef] [Scilit]
  50. Clement, J.P.; Kunjilwar, K.; Gonzalez, G.; Schwanstecher, M.; Panten, U.; Aguilar-Bryan, L.; Bryan, J. Association and Stoichiometry of KATP Channel Subunits. Neuron 1997, 18, 827–838. [Google Scholar] [CrossRef] [Scilit]
  51. Seino, S.; Miki, T. Physiological and pathophysiological roles of ATP-sensitive K+ channels. Prog. Biophys. Mol. Biol. 2003, 81, 133–176. [Google Scholar] [CrossRef] [Scilit]
  52. Quayle, J.M.; Nelson, M.T.; Standen, N.B. ATP-sensitive and inwardly rectifying potassium channels in smooth muscle. Physiol. Rev. 1997, 77, 1165–1232. [Google Scholar] [CrossRef] [Scilit]
  53. Xie, L.H.; John, S.A.; Ribalet, B.; Weiss, J.N. Activation of inwardly rectifying potassium (Kir) channels by phosphatidylinosital-4,5-bisphosphate (PIP2): Interaction with other regulatory ligands. Prog. Biophys. Mol. Biol. 2007, 94, 320–335. [Google Scholar] [CrossRef] [Scilit]
  54. MATSUO, M.; KIMURA, Y.; UEDA, K. K ATP channel interaction with adenine nucleotides. J. Mol. Cell. Cardiol. 2005, 38, 907–916. [Google Scholar] [CrossRef] [Scilit]
  55. Markworth, E.; Schwanstecher, C.; Schwanstecher, M. Mediates Closure of Pancreatic Beta – Cell ATP- Sensitive Potassium by Interaction with 1 o f4 identical sites. Diabetes 2000, 49, 1413–1418. [Google Scholar] [CrossRef] [Scilit]
  56. Zingman, L.V.; Alekseev, A.E.; Bienengraeber, M.; Hodgson, D.; Karger, A.B.; Dzeja, P.P.; Terzic, A. Signaling in Channel/Enzyme Multimers: ATPase Transitions in SUR Module Gate ATP-Sensitive K+ Conductance. Neuron 2001, 31, 233–245. [Google Scholar] [CrossRef] [Scilit]
  57. Clark, R.; Proks, P. ATP-sensitive potassium channels in health and disease. In The Islets of Langerhans; Springer: Dordrecht, The Netherlands, 2010; pp. 165–192. [Google Scholar]
  58. Ashcroft, F.M.; Rorsman, P. KATP channels and islet hormone secretion: new insights and controversies. Nat. Rev. Endocrinol. 2013, 9, 660–669. [Google Scholar] [CrossRef] [Scilit]
  59. Ashcroft, S.J.H.; Ashcroft, F.M. Properties and functions of ATP-sensitive K-channels. Cell. Signal. 1990, 2, 197–214. [Google Scholar] [CrossRef] [Scilit]
  60. Rorsman, P.; Eliasson, L.; Kanno, T.; Zhang, Q.; Gopel, S. Electrophysiology of pancreatic β-cells in intact mouse islets of Langerhans. Prog. Biophys. Mol. Biol. 2011, 107, 224–235. [Google Scholar] [CrossRef] [Scilit]
  61. Olsen, H.L.; Theander, S.; Bokvist, K.; Buschard, K.; Wollheim, C.B.; Gromada, J. Glucose Stimulates Glucagon Release in Single Rat α-Cells by Mechanisms that Mirror the Stimulus-Secretion Coupling in β-Cells. Endocrinology 2005, 146, 4861–4870. [Google Scholar] [CrossRef] [Scilit]
  62. Gribble, F.M.; Tucker, S.J.; Seino, S.; Ashcroft, F.M. Tissue specificity of sulfonylureas: studies on cloned cardiac and beta-cell K(ATP) channels. Diabetes 1998, 47, 1412–1418. [Google Scholar] [CrossRef] [Scilit]
  63. Branstrom, R.; Aspinwall, C.A.; Valimaki, S.; Ostensson, C.-G.; Tibell, A.; Eckhard, M.; Brandhorst, H.; Corkey, B.E.; Berggren, P.-O.; Larsson, O. Long-Chain CoA esters activate human pancreatic beta-cell K ATP channels: potential role in Type 2 diabetes. Diabetologia 2004, 47, 277–283. [Google Scholar] [CrossRef] [Scilit]
  64. Tarasov, A.; Dusonchet, J.; Ashcroft, F. Metabolic regulation of the pancreatic beta-cell ATP-sensitive K+ channel: a pas de deux. Diabetes 2004, 53 (Suppl. 3), S113–S122. [Google Scholar] [CrossRef] [Scilit]
  65. Pratt, E.B.; Tewson, P.; Bruederle, C.E.; Skach, W.R.; Shyng, S.-L. N-terminal transmembrane domain of SUR1 controls gating of Kir6.2 by modulating channel sensitivity to PIP 2. J. Gen. Physiol. 2011, 137, 299–314. [Google Scholar] [CrossRef] [Scilit]
  66. Chang, N.; Liang, T.; Lin, X.; Kang, Y.; Xie, H.; Feng, Z.-P.; Gaisano, H.Y. Syntaxin-1A Interacts with Distinct Domains within Nucleotide-binding Folds of Sulfonylurea Receptor 1 to Inhibit β-Cell ATP-sensitive Potassium Channels. J. Biol. Chem. 2011, 286, 23308–23318. [Google Scholar] [CrossRef] [Scilit]
  67. Pasyk, E.A.; Kang, Y.; Huang, X.; Cui, N.; Sheu, L.; Gaisano, H.Y. Syntaxin-1A Binds the Nucleotide-binding Folds of Sulphonylurea Receptor 1 to Regulate the K ATP Channel. J. Biol. Chem. 2004, 279, 4234–4240. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Cui, N.; Kang, Y.; He, Y.; Leung, Y.-M.; Xie, H.; Pasyk, E.A.; Gao, X.; Sheu, L.; Hansen, J.B.; Wahl, P.; et al. H3 Domain of Syntaxin 1A Inhibits K ATP Channels by Its Actions on the Sulfonylurea Receptor 1 Nucleotide-Binding Folds-1 and -2. J. Biol. Chem. 2004, 279, 53259–53265. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Holz, G.G.; Chepurny, O.G.; Leech, C.A. Leptin-stimulated K ATP channel trafficking. Islets 2013, 5, 229–232. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  70. Gavello, D.; Carbone, E.; Carabelli, V. Leptin-mediated ion channel regulation: PI3K pathways, physiological role, and therapeutic potential. Channels 2016, 10, 282–296. [Google Scholar] [CrossRef] [Scilit]
  71. Park, S.-H.; Ryu, S.-Y.; Yu, W.-J.; Han, Y.E.; Ji, Y.-S.; Oh, K.; Sohn, J.-W.; Lim, A.; Jeon, J.-P.; Lee, H.; et al. Leptin promotes KATP channel trafficking by AMPK signaling in pancreatic beta-cells. Proc. Natl. Acad. Sci. USA 2013, 110, 12673–12678. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  72. Wu, Y.; Shyng, S.-L.; Chen, P.-C. Concerted Trafficking Regulation of Kv2.1 and K ATP Channels by Leptin in Pancreatic β-Cells. J. Biol. Chem. 2015, 290, 29676–29690. [Google Scholar] [CrossRef] [Scilit]
  73. Shyng, S.; Nichols, C.G. Membrane Phospholipid Control of Nucleotide Sensitivity of KATP Channels. Science 1998, 282, 1138–1141. [Google Scholar] [CrossRef] [Scilit]
  74. Baukrowitz, T. PIP2 and PIP as Determinants for ATP Inhibition of KATP Channels. Science 1998, 282, 1141–1144. [Google Scholar] [CrossRef] [Scilit]
  75. Nakano, K.; Suga, S.; Takeo, T.; Ogawa, Y.; Suda, T.; Kanno, T.; Wakui, M. Intracellular Ca 2+ Modulation of ATP-Sensitive K + Channel Activity in Acetylcholine-Induced Activation of Rat Pancreatic β-Cells. Endocrinology 2002, 143, 569–576. [Google Scholar] [CrossRef] [PubMed]
  76. Petit, P.; Hillaire-Buys, D.; Manteghetti, M.; Debrus, S.; Chapal, J.; Loubatières-Mariani, M.M. Evidence for two different types of P2 receptors stimulating insulin secretion from pancreatic B cell. Br. J. Pharmacol. 1998, 125, 1368–1374. [Google Scholar] [CrossRef] [Scilit]
  77. Burnstock, G. Purinergic signalling in endocrine organs. Purinergic Signal. 2014, 10, 189–231. [Google Scholar] [CrossRef] [Scilit]
  78. Beguin, P. PKA-mediated phosphorylation of the human KATP channel: separate roles of Kir6.2 and SUR1 subunit phosphorylation. EMBO J. 1999, 18, 4722–4732. [Google Scholar] [CrossRef] [Scilit]
  79. Hu, K.; Huang, C.S.; Jan, Y.N.; Jan, L.Y. ATP-Sensitive Potassium Channel Traffic Regulation by Adenosine and Protein Kinase C. Neuron 2003, 38, 417–432. [Google Scholar] [CrossRef] [Scilit]
  80. Light, P.E.; Bladen, C.; Winkfein, R.J.; Walsh, M.P.; French, R.J. Molecular basis of protein kinase C-induced activation of ATP-sensitive potassium channels. Proc. Natl. Acad. Sci. USA 2000, 97, 9058–9063. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  81. Proks, P.; Reimann, F.; Green, N.; Gribble, F.; Frances, A. Sulfonylurea_stimulation_of_in.PDF. Am. Diabetes Assoc. 2002, 51, 368–377. [Google Scholar] [CrossRef] [Scilit]
  82. Gribble, F.M.; Ashcroft, F.M. Differential sensitivity of beta-cell and extrapancreatic K ATP channels to gliclazide. Diabetologia 1999, 42, 845–848. [Google Scholar] [CrossRef] [Scilit]
  83. Gribble, F.M.; Tucker, S.J.; Ashcroft, F.M. The Interaction of nucleotides with the tolbutamide block of cloned atp-sensitive k + channel currents expressed in xenopus oocytes: a reinterpretation. J. Physiol. 1997, 504, 35–45. [Google Scholar] [CrossRef] [Scilit]
  84. Ashcroft, F.M.; Gribble, F.M. Correlating structure and function in ATP-sensitive K+ channels. Trends Neurosci. 1998, 21, 288–294. [Google Scholar] [CrossRef] [Scilit]
  85. Ashfield, R.; Gribble, F.M.; Ashcroft, S.J.; Ashcroft, F.M. Identification of the high-affinity tolbutamide site on the SUR1 subunit of the K(ATP) channel. Diabetes 1999, 48, 1341–1347. [Google Scholar] [CrossRef] [Scilit]
  86. Mukai, E.; Ishida, H.; Horie, M.; Noma, A.; Seino, Y.; Takano, M. The Antiarrhythmic Agent Cibenzoline Inhibits KATPChannels by Binding to Kir6.2. Biochem. Biophys. Res. Commun. 1998, 251, 477–481. [Google Scholar] [CrossRef] [Scilit]
  87. Proks, P.; Ashcroft, F.M. Phentolamine block of KATP channels is mediated by Kir6.2. Proc. Natl. Acad. Sci. USA 1997, 94, 11716–11720. [Google Scholar] [CrossRef] [Scilit]
  88. Gribble, F.M.; Davis, T.M.E.; Higham, C.E.; Clark, A.; Ashcroft, F.M. The antimalarial agent mefloquine inhibits ATP-sensitive K-channels. Br. J. Pharmacol. 2000, 131, 756–760. [Google Scholar] [CrossRef] [Scilit]
  89. Nosten, F.; ter Kuile, F.O.; Luxemburger, C.; Woodrow, C.; Chongsuphajaisiddhi, T.; White, N.J.; Kyle, D.E. Cardiac effects of antimalarial treatment with halofantrine. Lancet 1993, 341, 1054–1056. [Google Scholar] [CrossRef] [Scilit]
  90. Bokvist, K.; Rorsman, P.; Smith, P.A. Block of ATP-regulated and Ca2(+)-activated K+ channels in mouse pancreatic beta-cells by external tetraethylammonium and quinine. J. Physiol. 1990, 423, 327–342. [Google Scholar] [CrossRef] [Scilit]
  91. López-Izquierdo, A.; Ponce-Balbuena, D.; Moreno-Galindo, E.G.; Aréchiga-Figueroa, I.A.; Rodríguez-Martínez, M.; Ferrer, T.; Rodríguez-Menchaca, A.A.; Sánchez-Chapula, J.A. The Antimalarial Drug Mefloquine Inhibits Cardiac Inward Rectifier K+ Channels: Evidence for Interference in PIP2-Channel Interaction. J. Cardiovasc. Pharmacol. 2011, 57, 407–415. [Google Scholar]
  92. Enkvetchakul, D.; Nichols, C.G. Gating Mechanism of K ATP Channels. J. Gen. Physiol. 2003, 122, 471–480. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  93. Logothetis, D.E.; Jin, T.; Lupyan, D.; Rosenhouse-Dantsker, A. Phosphoinositide-mediated gating of inwardly rectifying K+ channels. Pflügers Arch. - Eur. J. Physiol. 2007, 455, 83–95. [Google Scholar] [CrossRef] [Scilit]
  94. Lopes, C.M.B.; Zhang, H.; Rohacs, T.; Jin, T.; Yang, J.; Logothetis, D.E. Alterations in Conserved Kir Channel-PIP2 Interactions Underlie Channelopathies. Neuron 2002, 34, 933–944. [Google Scholar] [CrossRef] [Scilit]
  95. Xie, L.-H.; John, S.A.; Ribalet, B.; Weiss, J.N. Phosphatidylinositol-4,5-bisphosphate (PIP 2) regulation of strong inward rectifier Kir2.1 channels: multilevel positive cooperativity. J. Physiol. 2008, 586, 1833–1848. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Khan, S.A.; Higdon, N.R.; Hester, J.B.; Meisheri, K.D. Pharmacological characterization of novel cyanoguanidines as vascular KATP channel blockers. J. Pharmacol. Exp. Ther. 1997, 283, 1207–1213. [Google Scholar] [PubMed]
  97. Meisheri, K.D.; Humphrey, S.J.; Khan, S.A.; Cipkus-Dubray, L.A.; Smith, M.P.; Jones, A.W. 4-morpholinecarboximidine-N-1-adamantyl-N’-cyclohexylhydrochloride (U-37883A): pharmacological characterization of a novel antagonist of vascular ATP-sensitive K+ channel openers. J. Pharmacol. Exp. Ther. 1993, 266, 655–665. [Google Scholar]
  98. Wellman, G.C.; Barrett-Jolley, R.; Köppel, H.; Everitt, D.; Quayle, J.M. Inhibition of vascular K ATP channels by U-37883A: a comparison with cardiac and skeletal muscle. Br. J. Pharmacol. 1999, 128, 909–916. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  99. Kovalev, H.; Quayle, J.M.; Kamishima, T.; Lodwick, D. Molecular analysis of the subtype-selective inhibition of cloned K ATP channels by PNU-37883A. Br. J. Pharmacol. 2004, 141, 867–873. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  100. Cui, Y.; Tinker, A.; Clapp, L.H. Different molecular sites of action for the K ATP channel inhibitors, PNU-99963 and PNU-37883A. Br. J. Pharmacol. 2003, 139, 122–128. [Google Scholar] [CrossRef] [Scilit]
  101. Hille, B. Ion Channels of Excitable Membranes, 3rd ed.; Sinauer Associates: Sunderland, MA, USA, 2001. [Google Scholar]
  102. Plant, T.D. Na+ currents in cultured mouse pancreatic B-cells. Pflugers Arch. Eur. J. Physiol. 1988, 411, 429–435. [Google Scholar] [CrossRef] [Scilit]
  103. Ahern, C.A.; Payandeh, J.; Bosmans, F.; Chanda, B. The hitchhiker’s guide to the voltage-gated sodium channel galaxy. J. Gen. Physiol. 2016, 147, 1–24. [Google Scholar] [CrossRef] [Scilit]
  104. Hiriart, M. Na channels and two types of Ca channels in rat pancreatic B cells identified with the reverse hemolytic plaque assay. J. Gen. Physiol. 1988, 91, 617–639. [Google Scholar] [CrossRef] [Scilit]
  105. Vidaltamayo, R.; Sánchez-Soto, M.C.; Hiriart, M. Nerve growth factor increases sodium channel expression in pancreatic beta cells: implications for insulin secretion. FASEB J. 2002, 16, 891–892. [Google Scholar] [CrossRef] [Scilit]
  106. Barnett, D.W.; Pressel, D.M.; Misler, S. Voltage-dependent Na+ and Ca2+ currents in human pancreatic islet β-cells: evidence for roles in the generation of action potentials and insulin secretion. Pflügers Arch. Eur. J. Physiol. 1995, 431, 272–282. [Google Scholar] [CrossRef] [Scilit]
  107. Göpel, S.; Kanno, T.; Barg, S.; Galvanovskis, J.; Rorsman, P. Voltage-gated and resting membrane currents recorded from B-cells in intact mouse pancreatic islets. J. Physiol. 1999, 521, 717–728. [Google Scholar] [CrossRef] [Scilit]
  108. Lou, X.-L.; Yu, X.; Chen, X.-K.; Duan, K.-L.; He, L.-M.; Qu, A.-L.; Xu, T.; Zhou, Z. Na+ channel inactivation: a comparative study between pancreatic islet -cells and adrenal chromaffin cells in rat. J. Physiol. 2003, 548, 191–202. [Google Scholar] [CrossRef]
  109. Diaz-Garcia, C.M.; Sanchez-Soto, C.; Hiriart, M. Toxins that Modulate Ionic Channels as Tools for Exploring Insulin Secretion. Cell. Mol. Neurobiol. 2010, 30, 1275–1281. [Google Scholar] [CrossRef] [Scilit]
  110. Vignali, S.; Leiss, V.; Karl, R.; Hofmann, F.; Welling, A. Characterization of voltage-dependent sodium and calcium channels in mouse pancreatic A- and B-cells. J. Physiol. 2006, 572, 691–706. [Google Scholar] [CrossRef] [Scilit]
  111. Zhang, Q.; Chibalina, M.V.; Bengtsson, M.; Groschner, L.N.; Ramracheya, R.; Rorsman, N.J.G.; Leiss, V.; Nassar, M.A.; Welling, A.; Gribble, F.M.; et al. Na + current properties in islet α- and β-cells reflect cell-specific Scn3a and Scn9a expression. J. Physiol. 2014, 592, 4677–4696. [Google Scholar] [CrossRef] [Scilit]
  112. Ernst, S.J.; Aguilar-Bryan, L.; Noebels, J.L. Sodium Channel β1 Regulatory Subunit Deficiency Reduces Pancreatic Islet Glucose-Stimulated Insulin and Glucagon Secretion. Endocrinology 2009, 150, 1132–1139. [Google Scholar] [CrossRef] [Scilit]
  113. Henquin, J.C. Regulation of Insulin Release by Ionic and Electrical Events in B Cells. Horm. Res. 1987, 27, 168–178. [Google Scholar] [CrossRef] [Scilit]
  114. Bratanova-Tochkova, T.K.; Cheng, H.; Daniel, S.; Gunawardana, S.; Liu, Y.-J.; Mulvaney-Musa, J.; Schermerhorn, T.; Straub, S.G.; Yajima, H.; Sharp, G.W.G. Triggering and Augmentation Mechanisms, Granule Pools, and Biphasic Insulin Secretion. Diabetes 2002, 51, S83–S90. [Google Scholar] [CrossRef] [Scilit]
  115. Rorsman, P.; Renstrom, E. Insulin granule dynamics in pancreatic beta cells. Diabetologia 2003, 46, 1029–1045. [Google Scholar] [CrossRef] [Scilit]
  116. Suckale, J.; Solimena, M. The insulin secretory granule as a signaling hub. Trends Endocrinol. Metab. 2010, 21, 599–609. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  117. Rorsman, P.; Trube, G. Calcium and delayed potassium currents in mouse pancreatic beta-cells under voltage-clamp conditions. J. Physiol. 1986, 374, 531–550. [Google Scholar] [CrossRef] [Scilit]
  118. Satin, L.S.; Tavalin, S.J.; Smolen, P.D. Inactivation of HIT cell Ca2+ current by a simulated burst of Ca2+ action potentials. Biophys. J. 1994, 66, 141–148. [Google Scholar] [CrossRef] [Scilit]
  119. Gonçalves, A.A.; Toyama, M.H.; Carneiro, E.M.; Marangoni, S.; Arantes, E.C.; Giglio, J.R.; Boschero, A.C. Participation of Na+channels in the potentiation by Tityus serrulatus α-toxin TsTx-V of glucose-induced electrical activity and insulin secretion in rodent islet β-cells. Toxicon 2003, 41, 1039–1045. [Google Scholar] [CrossRef] [Scilit]
  120. Pace, C.S. Activation of Na channels in islet cells: metabolic and secretory effects. Am. J. Physiol. Metab. 1979, 237, E130. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  121. Zou, N.; Wu, X.; Jin, Y.-Y.; He, M.-Z.; Wang, X.-X.; Su, L.-D.; Rupnik, M.; Wu, Z.-Y.; Liang, L.; Shen, Y. ATP Regulates Sodium Channel Kinetics in Pancreatic Islet Beta Cells. J. Membr. Biol. 2013, 246, 101–107. [Google Scholar] [CrossRef] [Scilit]
  122. Godazgar, M.; Zhang, Q.; Chibalina, M.V.; Rorsman, P. Biphasic voltage-dependent inactivation of human Na V 1.3, 1.6 and 1.7 Na + channels expressed in rodent insulin-secreting cells. J. Physiol. 2018, 596, 1601–1626. [Google Scholar] [CrossRef] [Scilit]
  123. Meyer-Hermann, M.E. The Electrophysiology of the β-Cell Based on Single Transmembrane Protein Characteristics. Biophys. J. 2007, 93, 2952–2968. [Google Scholar] [CrossRef] [Scilit]
  124. Chen, C.; Wang, S.; Hu, Q.; Zeng, L.; Peng, H.; Liu, C.; Huang, L.P.; Song, H.; Li, Y.; Yao, L.H.; et al. Voltage-gated Na+ channels are modulated by glucose and involved in regulating cellular insulin content of INS-1 Cells. Cell. Physiol. Biochem. 2018, 45, 446–457. [Google Scholar] [CrossRef] [Scilit]
  125. Navarro-Tableros, V.; Sanchez-Soto, M.C.; Garcia, S.; Hiriart, M. Autocrine Regulation of Single Pancreatic -Cell Survival. Diabetes 2004, 53, 2018–2023. [Google Scholar] [CrossRef] [Scilit]
  126. Navarro-Tableros, V.; Fiordelisio, T.; Hernández-Cruz, A.; Hiriart, M. Physiological development of insulin secretion, calcium channels, and GLUT2 expression of pancreatic rat β-cells. Am. J. Physiol. Metab. 2007, 292, E1018–E1029. [Google Scholar] [CrossRef] [Scilit]
  127. Rosenbaum, T.; Sanchez-Soto, M.C.; Hiriart, M. Nerve Growth Factor Increases Insulin Secretion and Barium Current in Pancreatic Beta-Cells. Diabetes 2001, 50, 1755–1762. [Google Scholar] [CrossRef] [Scilit]
  128. Yang, S.-N.; Berggren, P.-O. CaV2.3 channel and PKCλ: new players in insulin secretion. J. Clin. Invest. 2005, 115, 16–20. [Google Scholar] [CrossRef] [Scilit]
  129. Yang, S.N.; Berggren, P.O. The role of voltage-gated calcium channels in pancreatic β-cell physiology and pathophysiology. Endocr. Rev. 2006, 27, 621–676. [Google Scholar] [CrossRef] [Scilit]
  130. Reinbothe, T.M.; Alkayyali, S.; Ahlqvist, E.; Tuomi, T.; Isomaa, B.; Lyssenko, V.; Renström, E. The human L-type calcium channel Cav1.3 regulates insulin release and polymorphisms in CACNA1D associate with type 2 diabetes. Diabetologia 2013, 56, 340–349. [Google Scholar] [CrossRef] [Scilit]
  131. Rajagopal, S.; Fields, B.L.; Burton, B.K.; On, C.; Reeder, A.A.; Kamatchi, G.L. Inhibition of protein kinase C (PKC) response of voltage-gated calcium (Cav)2.2 channels expressed in Xenopus oocytes by Cavβ subunits. Neuroscience 2014, 280, 1–9. [Google Scholar] [CrossRef] [Scilit]
  132. Yang, S.-N.; Shi, Y.; Yang, G.; Li, Y.; Yu, J.; Berggren, P.-O. Ionic mechanisms in pancreatic β cell signaling. Cell. Mol. Life Sci. 2014, 71, 4149–4177. [Google Scholar] [CrossRef] [Scilit]
  133. Zhou, Y.; Sun, P.; Wang, T.; Chen, K.; Zhu, W.; Wang, H. Inhibition of Calcium Influx Reduces Dysfunction and Apoptosis in Lipotoxic Pancreatic β-Cells via Regulation of Endoplasmic Reticulum Stress. PLoS ONE 2015, 10, e0132411. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  134. Kitaguchi, T.; Oya, M.; Wada, Y.; Tsuboi, T.; Miyawaki, A. Extracellular calcium influx activates adenylate cyclase 1 and potentiates insulin secretion in MIN6 cells. Biochem. J. 2013, 450, 365–373. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  135. Davalli, A.M.; Biancardi, E.; Pollo, A.; Socci, C.; Pozza, G.; Clementi, F.; Sher, E.; Carbone, E. Dihydropyridine-sensitive and -insensitive voltage-operated calcium channels participate in the control of glucose-induced insulin release from human pancreatic beta cells. J. Endocrinol. 1996, 150, 195–203. [Google Scholar] [CrossRef] [Scilit]
  136. Iwashima, Y.; Pugh, W.; Depaoli, A.M.; Takeda, J.; Seino, S.; Bell, G.I.; Polonsky, K.S. Expression of Calcium Channel mRNAs in Rat Pancreatic Islets and Downregulation After Glucose Infusion. Diabetes 1993, 42, 948–955. [Google Scholar] [CrossRef] [Scilit]
  137. Scholze, A.; Plant, T.D.; Dolphin, A.C.; Nürnberg, B. Functional Expression and Characterization of a Voltage-Gated Ca V 1.3 (α 1D ) Calcium Channel Subunit from an Insulin-Secreting Cell Line. Mol. Endocrinol. 2001, 15, 1211–1221. [Google Scholar]
  138. Rorsman, P.; Braun, M.; Zhang, Q. Regulation of calcium in pancreatic α- and β-cells in health and disease. Cell Calcium 2012, 51, 300–308. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  139. Taylor, J.T.; Huang, L.; Keyser, B.M.; Zhuang, H.; Clarkson, C.W.; Li, M. Role of high-voltage-activated calcium channels in glucose-regulated β-cell calcium homeostasis and insulin release. Am. J. Physiol. Metab. 2005, 289, E900–E908. [Google Scholar] [CrossRef] [Scilit]
  140. Jing, X.; Li, D.-Q.; Olofsson, C.S.; Salehi, A.; Surve, V.V.; Caballero, J.; Ivarsson, R.; Lundquist, I.; Pereverzev, A.; Schneider, T.; et al. CaV2.3 calcium channels control second-phase insulin release. J. Clin. Invest. 2005, 115, 146–154. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  141. Henquin, J.-C.; Meissner, H.P. Dibutyryl cyclic AMP triggers Ca2+ influx and Ca2+-dependent electrical activity in pancreatic B cells. Biochem. Biophys. Res. Commun. 1983, 112, 614–620. [Google Scholar] [CrossRef] [Scilit]
  142. HENQUIN, J.C.; MEISSNER, H.P. The Ionic, Electrical, and Secretory Effects of Endogenous Cyclic Adenosine Monophosphate in Mouse Pancreatic B Cells: Studies with Forskolin. Endocrinology 1984, 115, 1125–1134. [Google Scholar] [CrossRef] [Scilit]
  143. Gillis, K.D.; Misler, S. Enhancers of cytosolic cAMP augment depolarization-induced exocytosis from pancreatic B-cells: evidence for effects distal to Ca2+ entry. Pflügers Arch. Eur. J. Physiol. 1993, 424, 195–197. [Google Scholar] [CrossRef] [Scilit]
  144. Kanno, T.; Suga, S.; Wu, J.; Kimura, M.; Wakui, M. Intracellular cAMP potentiates voltage-dependent activation of L -type Ca 2+ channels in rat islet β-cells. Pflugers Arch. Eur. J. Physiol. 1998, 435, 578–580. [Google Scholar] [CrossRef] [Scilit]
  145. Cui, X.; Yang, G.; Pan, M.; Zhang, X.-N.; Yang, S.-N. Akt Signals Upstream of L-Type Calcium Channels to Optimize Insulin Secretion. Pancreas 2012, 41, 15–21. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  146. Dadi, P.K.; Vierra, N.C.; Ustione, A.; Piston, D.W.; Colbran, R.J.; Jacobson, D.A. Inhibition of Pancreatic β-Cell Ca 2+ /Calmodulin-dependent Protein Kinase II Reduces Glucose-stimulated Calcium Influx and Insulin Secretion, Impairing Glucose Tolerance. J. Biol. Chem. 2014, 289, 12435–12445. [Google Scholar] [CrossRef] [Scilit]
  147. Schwetz, T.A.; Ustione, A.; Piston, D.W. Neuropeptide Y and somatostatin inhibit insulin secretion through different mechanisms. Am. J. Physiol. Metab. 2013, 304, E211–E221. [Google Scholar] [CrossRef] [Scilit]
  148. Prentki, M.; Glennon, M.C.; Geschwind, J.-F.; Matschinsky, F.M.; Corkey, B.E. Cyclic AMP raises cytosolic Ca 2+ and promotes Ca 2+ influx in a clonal pancreatic β-cell line (HIT T-15). FEBS Lett. 1987, 220, 103–107. [Google Scholar] [CrossRef] [Scilit]
  149. Jacobo, S.M.P.; Guerra, M.L.; Jarrard, R.E.; Przybyla, J.A.; Liu, G.; Watts, V.J.; Hockerman, G.H. The Intracellular II-III Loops of Cav1.2 and Cav1.3 Uncouple L-Type Voltage-Gated Ca2+ Channels from Glucagon-Like Peptide-1 Potentiation of Insulin Secretion in INS-1 Cells via Displacement from Lipid Rafts. J. Pharmacol. Exp. Ther. 2009, 330, 283–293. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  150. Gilon, P.; Yakel, J.; Gromada, J.; Zhu, Y.; Henquin, J.C.; Rorsman, P. G protein-dependent inhibition of L-type Ca2+ currents by acetylcholine in mouse pancreatic B-cells. J. Physiol. 1997, 499, 65–76. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  151. Colsoul, B.; Vennekens, R.; Nilius, B. Transient Receptor Potential Cation Channels in Pancreatic β Cells. In Reviews of Physiology, Biochemistry and Pharmacology 161; Springer: Berlin/Heidelberg, Germany, 2011; Volume 159, pp. 87–110. ISBN 978-3-540-73800-8. [Google Scholar]
  152. Jacobson, D.A.; Philipson, L.H. Action potentials and insulin secretion: new insights into the role of Kv channels. Diabetes Obes. Metab. 2007, 9, 89–98. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  153. Marigo, V.; Courville, K.; Hsu, W.H.; Feng, J.M.; Cheng, H. TRPM4 impacts on Ca2+ signals during agonist-induced insulin secretion in pancreatic β-cells. Mol. Cell. Endocrinol. 2009, 299, 194–203. [Google Scholar] [CrossRef] [Scilit]
  154. Jacobson, D.A.; Philipson, L.H. TRP Channels of the Pancreatic Beta Cell. In Transient Receptor Potential (TRP) Channels; Springer: Berlin/Heidelberg, Germany, 2007; Volume 179, pp. 409–424. ISBN 9783540348894. [Google Scholar]
  155. Benemei, S.; Patacchini, R.; Trevisani, M.; Geppetti, P. TRP channels. Curr. Opin. Pharmacol. 2015, 22, 18–23. [Google Scholar] [CrossRef] [Scilit]
  156. Dong, X.-P.; Wang, X.; Xu, H. TRP channels of intracellular membranes. J. Neurochem. 2010, 113, 313–328. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  157. Li, M.; Yu, Y.; Yang, J. Structural biology of TRP channels. Advances in Experimental. Med. Biol. 2011, 704, 1–23. [Google Scholar]
  158. Nilius, B.; Owsianik, G.; Voets, T. Transient receptor potential channels meet phosphoinositides. EMBO J. 2008, 27, 2809–2816. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  159. Jara-Oseguera, A.; Llorente, I.; Rosenbaum, T.; Islas, L.D. Properties of the Inner Pore Region of TRPV1 Channels Revealed by Block with Quaternary Ammoniums. J. Gen. Physiol. 2008, 132, 547–562. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  160. Siemens, J.; Zhou, S.; Piskorowski, R.; Nikai, T.; Lumpkin, E.A.; Basbaum, A.I.; King, D.; Julius, D. Spider toxins activate the capsaicin receptor to produce inflammatory pain. Nature 2006, 444, 208–212. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  161. Togashi, K.; Hara, Y.; Tominaga, T.; Higashi, T.; Konishi, Y.; Mori, Y.; Tominaga, M. TRPM2 activation by cyclic ADP-ribose at body temperature is involved in insulin secretion. EMBO J. 2006, 25, 1804–1815. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  162. Uchida, K.; Dezaki, K.; Damdindorj, B.; Inada, H.; Shiuchi, T.; Mori, Y.; Yada, T.; Minokoshi, Y.; Tominaga, M. Lack of TRPM2 Impaired Insulin Secretion and Glucose Metabolisms in Mice. Diabetes 2011, 60, 119–126. [Google Scholar] [CrossRef] [Scilit]
  163. Uchida, K.; Tominaga, M. TRPM2 modulates insulin secretion in pancreatic β-cells. Islets 2011, 3, 209–211. [Google Scholar] [CrossRef] [Scilit]
  164. Colsoul, B.; Schraenen, A.; Lemaire, K.; Quintens, R.; Van Lommel, L.; Segal, A.; Owsianik, G.; Talavera, K.; Voets, T.; Margolskee, R.F.; et al. Loss of high-frequency glucose-induced Ca2+ oscillations in pancreatic islets correlates with impaired glucose tolerance in Trpm5-/- mice. Proc. Natl. Acad. Sci. USA 2010, 107, 5208–5213. [Google Scholar] [CrossRef] [Scilit]
  165. Shigeto, M.; Ramracheya, R.; Tarasov, A.I.; Cha, C.Y.; Chibalina, M.V.; Hastoy, B.; Philippaert, K.; Reinbothe, T.; Rorsman, N.; Salehi, A.; et al. GLP-1 stimulates insulin secretion by PKC-dependent TRPM4 and TRPM5 activation. J. Clin. Invest. 2015, 125, 4714–4728. [Google Scholar] [CrossRef] [Scilit]
  166. Nakagawa, Y.; Nagasawa, M.; Yamada, S.; Hara, A.; Mogami, H.; Nikolaev, V.O.; Lohse, M.J.; Shigemura, N.; Ninomiya, Y.; Kojima, I. Sweet Taste Receptor Expressed in Pancreatic β-Cells Activates the Calcium and Cyclic AMP Signaling Systems and Stimulates Insulin Secretion. PLoS ONE 2009, 4, e5106. [Google Scholar] [CrossRef] [Scilit]
  167. Brixel, L.R.; Monteilh-Zoller, M.K.; Ingenbrandt, C.S.; Fleig, A.; Penner, R.; Enklaar, T.; Zabel, B.U.; Prawitt, D. TRPM5 regulates glucose-stimulated insulin secretion. Pflügers Arch. - Eur. J. Physiol. 2010, 460, 69–76. [Google Scholar] [CrossRef] [Scilit]
  168. Wang, P.; Yan, Z.; Zhong, J.; Chen, J.; Ni, Y.; Li, L.; Ma, L.; Zhao, Z.; Liu, D.; Zhu, Z. Transient Receptor Potential Vanilloid 1 Activation Enhances Gut Glucagon-Like Peptide-1 Secretion and Improves Glucose Homeostasis. Diabetes 2012, 61, 2155–2165. [Google Scholar] [CrossRef] [Scilit]
  169. Gyulkhandanyan, A.V.; Lee, S.C.; Bikopoulos, G.; Dai, F.; Wheeler, M.B. The Zn 2+ -transporting Pathways in Pancreatic β-Cells. J. Biol. Chem. 2006, 281, 9361–9372. [Google Scholar] [CrossRef] [Scilit]
  170. Wagner, T.F.J.; Loch, S.; Lambert, S.; Straub, I.; Mannebach, S.; Mathar, I.; Düfer, M.; Lis, A.; Flockerzi, V.; Philipp, S.E.; et al. Transient receptor potential M3 channels are ionotropic steroid receptors in pancreatic β cells. Nat. Cell Biol. 2008, 10, 1421–1430. [Google Scholar] [CrossRef] [Scilit]
  171. Held, K.; Kichko, T.; De Clercq, K.; Klaassen, H.; Van Bree, R.; Vanherck, J.-C.; Marchand, A.; Reeh, P.W.; Chaltin, P.; Voets, T.; et al. Activation of TRPM3 by a potent synthetic ligand reveals a role in peptide release. Proc. Natl. Acad. Sci. USA 2015, 112, E1363–E1372. [Google Scholar] [CrossRef] [Scilit]
  172. Casas, S.; Novials, A.; Reimann, F.; Gomis, R.; Gribble, F.M. Calcium elevation in mouse pancreatic beta cells evoked by extracellular human islet amyloid polypeptide involves activation of the mechanosensitive ion channel TRPV4. Diabetologia 2008, 51, 2252–2262. [Google Scholar] [CrossRef] [Scilit]
  173. Skrzypski, M.; Kakkassery, M.; Mergler, S.; Grötzinger, C.; Khajavi, N.; Sassek, M.; Szczepankiewicz, D.; Wiedenmann, B.; Nowak, K.W.; Strowski, M.Z. Activation of TRPV4 channel in pancreatic INS-1E beta cells enhances glucose-stimulated insulin secretion via calcium-dependent mechanisms. FEBS Lett. 2013, 587, 3281–3287. [Google Scholar] [CrossRef] [Scilit]
  174. Islam, M.S. TRP Channels of Islets. In Encyclopedia of Biological Chemistry; Elsevier: Amsterdam, The Netherlands, 2011; pp. 811–830. ISBN 9780123786319. [Google Scholar]
  175. Zhu, Z.; Luo, Z.; Ma, S.; Liu, D. TRP channels and their implications in metabolic diseases. Pflügers Arch. - Eur. J. Physiol. 2011, 461, 211–223. [Google Scholar] [CrossRef] [Scilit]
  176. Diaz-Garcia, C.; Sanchez-Soto, C.; Hiriart, M. TRPM Channels Phosphorylation as a Potential Bridge Between Old Signals and Novel Regulatory Mechanisms of Insulin Secretion. Curr. Diabetes Rev. 2013, 9, 117–125. [Google Scholar] [CrossRef] [Scilit]
  177. MacDonald, P.E.; Sewing, S.; Wang, J.; Joseph, J.W.; Smukler, S.R.; Sakellaropoulos, G.; Wang, J.; Saleh, M.C.; Chan, C.B.; Tsushima, R.G.; et al. Inhibition of Kv2.1 Voltage-dependent K + Channels in Pancreatic β-Cells Enhances Glucose-dependent Insulin Secretion. J. Biol. Chem. 2002, 277, 44938–44945. [Google Scholar] [CrossRef] [Scilit]
  178. Smith, P.A.; BOKVIST, K.; ARKHAMMAR, P.; BERGGREN, P.-O.; RORSMAN, P. Delayed rectifying and calcium-activated K+ channels and their significance for action potential repolarization in mouse pancreatic beta-cells. J. Gen. Physiol. 1990, 95, 1041–1059. [Google Scholar] [CrossRef] [Scilit]
  179. Ji, J.; Tsuk, S.; Salapatek, A.M.F.; Huang, X.; Chikvashvili, D.; Pasyk, E.A.; Kang, Y.; Sheu, L.; Tsushima, R.; Diamant, N.; et al. The 25-kDa synaptosome-associated protein (SNAP-25) binds and inhibits delayed rectifier potassium channels in secretory cells. J. Biol. Chem. 2002, 277, 20195–20204. [Google Scholar] [CrossRef] [Scilit]
  180. Finol-Urdaneta, R.K.; Remedi, M.S.; Raasch, W.; Becker, S.; Clark, R.B.; Strüver, N.; Pavlov, E.; Nichols, C.G.; French, R.J.; Terlau, H. Block of K v 1.7 potassium currents increases glucose-stimulated insulin secretion. EMBO Mol. Med. 2012, 4, 424–434. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  181. Herrington, J.; Sanchez, M.; Wunderler, D.; Yan, L.; Bugianesi, R.M.; Dick, I.E.; Clark, S.A.; Brochu, R.M.; Priest, B.T.; Kohler, M.G.; et al. Biophysical and pharmacological properties of the voltage-gated potassium current of human pancreatic β-cells. J. Physiol. 2005, 567, 159–175. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  182. Herrington, J.; Zhou, Y.-P.; Bugianesi, R.M.; Dulski, P.M.; Feng, Y.; Warren, V.A.; Smith, M.M.; Kohler, M.G.; Garsky, V.M.; Sanchez, M.; et al. Blockers of the delayed-rectifier potassium current in pancreatic beta-cells enhance glucose-dependent insulin secretion. Diabetes 2006, 55, 1034–1042. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  183. Herrington, J. Gating modifier peptides as probes of pancreatic β-cell physiology. Toxicon 2007, 49, 231–238. [Google Scholar] [CrossRef] [Scilit]
  184. MacDonald, P.E.; Ha, X.F.; Wang, J.; Smukler, S.R.; Sun, A.M.; Gaisano, H.Y.; Salapatek, A.M.F.; Backx, P.H.; Wheeler, M.B. Members of the Kv1 and Kv2 Voltage-Dependent K + Channel Families Regulate Insulin Secretion. Mol. Endocrinol. 2001, 15, 1423–1435. [Google Scholar] [CrossRef]
  185. Roe, M.W.; Worley, J.F.; Mittal, A.A.; Kuznetsov, A.; DasGupta, S.; Mertz, R.J.; Witherspoon, S.M.; Blair, N.; Lancaster, M.E.; McIntyre, M.S.; et al. Expression and Function of Pancreatic β-Cell Delayed Rectifier K + Channels. J. Biol. Chem. 1996, 271, 32241–32246. [Google Scholar] [CrossRef] [Scilit]
  186. Jacobson, D.A.; Kuznetsov, A.; Lopez, J.P.; Kash, S.; Ämmälä, C.E.; Philipson, L.H. Kv2.1 Ablation Alters Glucose-Induced Islet Electrical Activity, Enhancing Insulin Secretion. Cell Metab. 2007, 6, 229–235. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  187. Dunne, M.J.; Ämmälä, C.; Straub, S.G.; Sharp, G.W.G. Electrophysiology of the β Cell and Mechanisms of Inhibition of Insulin Release. In Comprehensive Physiology; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2011. [Google Scholar]
  188. Kalman, K.; Nguyen, A.; Tseng-Crank, J.; Dukes, I.D.; Chandy, G.; Hustad, C.M.; Copeland, N.G.; Jenkins, N.A.; Mohrenweiser, H.; Brandriff, B.; et al. Genomic Organization, Chromosomal Localization, Tissue Distribution, and Biophysical Characterization of a Novel Mammalian Shaker -related Voltage-gated Potassium Channel, Kv1.7. J. Biol. Chem. 1998, 273, 5851–5857. [Google Scholar] [CrossRef] [Scilit]
  189. Kashuba, V.I.; Kvasha, S.M.; Protopopov, A.I.; Gizatullin, R.Z.; Rynditch, A.V.; Wahlestedt, C.; Wasserman, W.W.; Zabarovsky, E.R. Initial isolation and analysis of the human Kv1.7 ( KCNA7 ) gene, a member of the voltage-gated potassium channel gene family. Gene 2001, 268, 115–122. [Google Scholar] [CrossRef] [Scilit]
  190. MacDonald, P.E.; Wheeler, M.B. Voltage-dependent K + channels in pancreatic beta cells: Role, regulation and potential as therapeutic targets. Diabetologia 2003, 46, 1046–1062. [Google Scholar] [CrossRef] [Scilit]
  191. Atwater, B.Y.I.; Ribalet, B.; Rojas, E. MOUSE PANCREATIC f-CELLS: TETRAETHYLAMMONIUM BLOCKAGE OF THE POTASSIUM PERMEABILITY INCREASE INDUCED BY DEPOLARIZATION. J. Physiol. 1979, 288, 561–574. [Google Scholar]
  192. Henquin, J.-C. Tetraethylammonium potentiation of insulin release and inhibition of rubidium efflux in pancreatic islets. Biochem. Biophys. Res. Commun. 1977, 77, 551–556. [Google Scholar] [CrossRef] [Scilit]
  193. Islam, M.S. The Ryanodine Receptor Calcium Channel of -Cells: Molecular Regulation and Physiological Significance. Diabetes 2002, 51, 1299–1309. [Google Scholar] [CrossRef] [Scilit]
  194. Liu, Y.; Zhong, X.; Ding, Y.; Ren, L.; Bai, T.; Liu, M.; Liu, Z.; Guo, Y.; Guo, Q.; Zhang, Y.; et al. Inhibition of voltage-dependent potassium channels mediates cAMP-potentiated insulin secretion in rat pancreatic β cells. Islets 2017, 9, 11–18. [Google Scholar] [CrossRef] [Scilit]
  195. MacDonald, P.E.; Wang, X.; Xia, F.; El-kholy, W.; Targonsky, E.D.; Tsushima, R.G.; Wheeler, M.B. Antagonism of Rat β-Cell Voltage-dependent K + Currents by Exendin 4 Requires Dual Activation of the cAMP/Protein Kinase A and Phosphatidylinositol 3-Kinase Signaling Pathways. J. Biol. Chem. 2003, 278, 52446–52453. [Google Scholar] [CrossRef] [Scilit]
  196. Zhang, Y.; Ding, Y.; Zhong, X.; Guo, Q.; Wang, H.; Gao, J.; Bai, T.; Ren, L.; Guo, Y.; Jiao, X.; et al. Geniposide acutely stimulates insulin secretion in pancreatic β-cells by regulating GLP-1 receptor/cAMP signaling and ion channels. Mol. Cell. Endocrinol. 2016, 430, 89–96. [Google Scholar] [CrossRef] [Scilit]
  197. Gutman, G.A. International Union of Pharmacology. LIII. Nomenclature and Molecular Relationships of Voltage-Gated Potassium Channels. Pharmacol. Rev. 2005, 57, 473–508. [Google Scholar] [CrossRef] [Scilit]
  198. Hardy, A.B.; Fox, J.E.M.; Giglou, P.R.; Wijesekara, N.; Bhattacharjee, A.; Sultan, S.; Gyulkhandanyan, A.V.; Gaisano, H.Y.; MacDonald, P.E.; Wheeler, M.B. Characterization of Erg K + Channels in α- and β-Cells of Mouse and Human Islets. J. Biol. Chem. 2009, 284, 30441–30452. [Google Scholar] [CrossRef] [Scilit]
  199. ROSATI, B.; MARCHETTI, P.; CROCIANI, O.; LECCHI, M.; LUPI, R.; ARCANGELI, A.; OLIVOTTO, M.; WANKE, E. Glucose- and arginine-induced insulin secretion by human pancreatic β-cells: the role of HERG K + channels in firing and release. FASEB J. 2000, 14, 2601–2610. [Google Scholar] [CrossRef] [Scilit]
  200. Liu, S.; Rasmusson, R.L.; Campbell, D.L.; Wang, S.; Strauss, H.C. Activation and inactivation kinetics of an E-4031-sensitive current from single ferret atrial myocytes. Biophys. J. 1996, 70, 2704–2715. [Google Scholar] [CrossRef] [Scilit]
  201. Sanguinetti, M.C.; Jiang, C.; Curran, M.E.; Keating, M.T. A mechanistic link between an inherited and an acquird cardiac arrthytmia: HERG encodes the IKr potassium channel. Cell 1995, 81, 299–307. [Google Scholar] [CrossRef] [Scilit]
  202. Berridge, M.J.; Lipp, P.; Bootman, M.D. The versatility and universality of calcium signalling. Nat. Rev. Mol. Cell Biol. 2000, 1, 11–21. [Google Scholar] [CrossRef] [Scilit]
  203. Gilon, P.; Chae, H.-Y.; Rutter, G.A.; Ravier, M.A. Calcium signaling in pancreatic β-cells in health and in Type 2 diabetes. Cell Calcium 2014, 56, 340–361. [Google Scholar] [CrossRef] [Scilit]
  204. Blaustein, M.P.; Lederer, W.J. Sodium/Calcium Exchange: Its Physiological Implications. Physiol. Rev. 1999, 79, 763–854. [Google Scholar] [CrossRef] [Scilit]
  205. Carafoli, E. [1] Membrane transport of calcium: An overview. In Methods in Enzymology; Academic Press: Cambridge, MA, USA, 1988; Volume 157, pp. 3–11. [Google Scholar]
  206. BLAUSTEIN, M.P.; GOLDMAN, W.F.; FONTANA, G.; KRUEGER, B.K.; SANTIAGO, E.M.; STEELE, T.D.; WEISS, D.N.; YAROWSKY, P.J. Physiological Roles of the Sodium-Calcium Exchanger in Nerve and Muscle. Ann. N. Y. Acad. Sci. 1991, 639, 254–274. [Google Scholar] [CrossRef] [Scilit]
  207. Rutter, G.A.; Hodson, D.J.; Chabosseau, P.; Haythorne, E.; Pullen, T.J.; Leclerc, I. Local and regional control of calcium dynamics in the pancreatic islet. Diabetes Obes. Metab. 2017, 19, 30–41. [Google Scholar] [CrossRef] [Scilit]
  208. DiPolo, R.; Beaugé, L. Ca2+ transport in nerve fibers. Biochim. Biophys. Acta - Rev. Biomembr. 1988, 947, 549–569. [Google Scholar] [CrossRef] [Scilit]
  209. Plasman, P.O.; Lebrun, P.; Herchuelz, A. Characterization of the process of sodium-calcium exchange in pancreatic islet cells. Am. J. Physiol. Metab. 1990, 259, E844–E850. [Google Scholar] [CrossRef] [Scilit]
  210. Van Eylen, F.; Horta, O.D.; Barez, A.; Kamagate, A.; Flatt, P.R.; Macianskiene, R.; Mubagwa, K.; Herchuelz, A. Overexpression of the Na/Ca Exchanger Shapes Stimulus-Induced Cytosolic Ca2+ Oscillations in Insulin-Producing BRIN-BD11 Cells. Diabetes 2002, 51, 366–375. [Google Scholar] [CrossRef] [Scilit]
  211. Herchuelz, A.; Lebrun, P. A role for Na/Ca exchange in the pancreatic B cell. Biochem. Pharmacol. 1993, 45, 7–11. [Google Scholar] [CrossRef] [Scilit]
  212. Van Eylen, F.; Lebeau, C.; Albuquerque-Silva, J.; Herchuelz, A. Contribution of Na/Ca exchange to Ca2+ outflow and entry in the rat pancreatic beta-cell: studies with antisense oligonucleotides. Diabetes 1998, 47, 1873–1880. [Google Scholar] [CrossRef] [Scilit]
  213. Thams, P.; Anwar, M.R.; Capito, K. Glucose triggers protein kinase A-dependent insulin secretion in mouse pancreatic islets through activation of the K+ATP channel-dependent pathway. Eur. J. Endocrinol. 2005, 152, 671–677. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  214. Smith, P.A.; Duchen, M.R.; Ashcroft, F.M. A fluorimetric and amperometric study of calcium and secretion in isolated mouse pancreatic beta-cells. Pflugers Arch. Eur. J. Physiol. 1995, 430, 808–818. [Google Scholar] [CrossRef] [Scilit]
  215. Renström, E.; Eliasson, L.; Rorsman, P. Protein kinase A-dependent and -independent stimulation of exocytosis by cAMP in mouse pancreatic B-cells. J. Physiol. 1997, 502, 105–118. [Google Scholar] [CrossRef] [Scilit]
  216. Gromada, J.; Dissing, S.; Bokvist, K.; Renstrom, E.; Frokjaer-Jensen, J.; Wulff, B.S.; Rorsman, P. Glucagon-like peptide I increases cytoplasmic calcium in insulin-secreting beta TC3-cells by enhancement of intracellular calcium mobilization. Diabetes 1995, 44, 767–774. [Google Scholar] [CrossRef] [Scilit]
  217. Holz, G.G.; Leech, C.A.; Heller, R.S.; Castonguay, M.; Habener, J.F. cAMP-dependent Mobilization of Intracellular Ca 2+ Stores by Activation of Ryanodine Receptors in Pancreatic β-Cells. J. Biol. Chem. 1999, 274, 14147–14156. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  218. Holz IV, G.G.; Kiihtreiber, W.M.; Habener, J.F. Pancreatic beta-cells are rendered glucose-competent by the insulinotropic hormone glucagon-like peptide-1(7-37). Nature 1993, 361, 362–365. [Google Scholar] [CrossRef] [Scilit]
  219. Britsch, S.; Krippeitdrews, P.; Lang, F.; Gregor, M.; Drews, G. Glucagon-like Peptide-1 Modulates Ca2+ Current But Not K+ATP Current in Intact Mouse Pancreatic B-Cells. Biochem. Biophys. Res. Commun. 1995, 207, 33–39. [Google Scholar] [CrossRef] [Scilit]
  220. Leech, C.A.; Habener, J.F. Insulinotropic Glucagon-like Peptide-1-mediated Activation of Non-selective Cation Currents in Insulinoma Cells Is Mimicked by Maitotoxin. J. Biol. Chem. 1997, 272, 17987–17993. [Google Scholar] [CrossRef] [Scilit]
  221. Carvalho, D.S.; de Almeida, A.A.; Borges, A.F.; Vannucci Campos, D. Treatments for diabetes mellitus type II: New perspectives regarding the possible role of calcium and cAMP interaction. Eur. J. Pharmacol. 2018, 830, 9–16. [Google Scholar] [CrossRef] [Scilit]
  222. Bergantin, L.B.; Caricati-Neto, A. Challenges for the pharmacological treatment of neurological and psychiatric disorders: Implications of the Ca 2+ /cAMP intracellular signalling interaction. Eur. J. Pharmacol. 2016, 788, 255–260. [Google Scholar] [CrossRef] [Scilit]
  223. Tengholm, A.; Gylfe, E. cAMP signalling in insulin and glucagon secretion. Diabetes Obes. Metab. 2017, 19, 42–53. [Google Scholar] [CrossRef] [Scilit]
  224. Tucker, S.J.; Gribble, F.M.; Zhao, C.; Trapp, S.; Ashcroft, F.M. Truncation of Kir6.2 produces ATP-sensitive K+ channels in the absence of the sulphonylurea receptor. Nature 1997, 387, 179–183. [Google Scholar] [CrossRef] [Scilit]
  225. Deacon, C.F.; Lebovitz, H.E. Comparative review of dipeptidyl peptidase-4 inhibitors and sulphonylureas. Diabetes Obes. Metab. 2016, 18, 333–347. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  226. Gaines, K.L.; Hamilton, S.; Boyd, A.E. Characterization of the sulfonylurea receptor on beta cell membranes. J. Biol. Chem. 1988, 263, 2589–2592. [Google Scholar]
  227. Aguilar-Bryan, L.; Nichols, C.; Wechsler, S.; Clement, J.; Boyd, A.; Gonzalez, G.; Herrera-Sosa, H.; Nguy, K.; Bryan, J.; Nelson, D. Cloning of the beta cell high-affinity sulfonylurea receptor: a regulator of insulin secretion. Science 1995, 268, 423–426. [Google Scholar] [CrossRef] [Scilit]
  228. Costello, R.A.; Shivkumar, A. Sulfonylureas; StatPearls Publishing: Tampa, FL, USA; St. Petersburg, FL, USA, 2018. [Google Scholar]
  229. Colagiuri, S.; Matthews, D.; Leiter, L.A.; Chan, S.P.; Sesti, G.; Marre, M. The place of gliclazide MR in the evolving type 2 diabetes landscape: A comparison with other sulfonylureas and newer oral antihyperglycemic agents. Diabetes Res. Clin. Pract. 2018, 143, 1–14. [Google Scholar] [CrossRef] [Scilit]
  230. Babenko, A.P.; Gonzalez, G.; Bryan, J. Pharmaco-topology of Sulfonylurea Receptors: SEPARATE DOMAINS OF THE REGULATORY SUBUNITS OFK ATP CHANNEL ISOFORMS ARE REQUIRED FOR SELECTIVE INTERACTION WITH K+ CHANNEL OPENERS. J. Biol. Chem. 2000, 275, 717–720. [Google Scholar] [CrossRef] [Scilit]
  231. Bonfanti, D.H.; Alcazar, L.P.; Arakaki, P.A.; Martins, L.T.; Agustini, B.C.; de Moraes Rego, F.G.; Frigeri, H.R. ATP-dependent potassium channels and type 2 diabetes mellitus. Clin. Biochem. 2015, 48, 476–482. [Google Scholar] [CrossRef] [Scilit]
  232. Bryan, J.; Crane, A.; Vila-Carriles, W.H.; Babenko, A.P.; Aguilar-Bryan, L. Insulin secretagogues, sulfonylurea receptors and K(ATP) channels. Curr. Pharm. Des. 2005, 11, 2699–2716. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  233. Sturgess, N.; Cook, D.; Ashford, M.; Hales, C.N. THE SULPHONYLUREA RECEPTOR MAY BE AN ATP-SENSITIVE POTASSIUM CHANNEL. Lancet 1985, 326, 474–475. [Google Scholar] [CrossRef] [Scilit]
  234. King, G.F. Venoms as a platform for human drugs: translating toxins into therapeutics. Expert Opin. Biol. Ther. 2011, 11, 1469–1484. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  235. Lewis, R.J.; Garcia, M.L. Therapeutic potential of venom peptides. Nat. Rev. Drug Discov. 2003, 2, 790–802. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  236. Zambelli, V.O.; Pasqualoto, K.F.M.; Picolo, G.; Chudzinski-Tavassi, A.M.; Cury, Y. Harnessing the knowledge of animal toxins to generate drugs. Pharmacol. Res. 2016, 112, 30–36. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  237. Eng, J.; Andrews, P.C.; Kleinman, W.A.; Singh, L.; Raufman, J.P. Purification and structure of exendin-3, a new pancreatic secretagogue isolated from Heloderma horridum venom. J. Biol. Chem. 1990, 265, 20259–20262. [Google Scholar]
  238. Raufman, J.P.; Singh, L.; Eng, J. Exendin-3, a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J. Biol. Chem. 1991, 266, 2897–2902. [Google Scholar]
  239. Malhotra, R.; Singh, L.; Eng, J.; Raufman, J.-P. Exendin-4, a new peptide from Heloderma suspectum venom, potentiates cholecystokinin-induced amylase release from rat pancreatic acini. Regul. Pept. 1992, 41, 149–156. [Google Scholar] [CrossRef] [Scilit]
  240. Göke, R.; Fehmann, H.C.; Linn, T.; Schmidt, H.; Krause, M.; Eng, J.; Göke, B. Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting beta-cells. J. Biol. Chem. 1993, 268, 19650–19655. [Google Scholar]
  241. Parkes, D.G.; Pittner, R.; Jodka, C.; Smith, P.; Young, A. Insulinotropic actions of exendin-4 and glucagon-like peptide-1 in vivo and in vitro. Metabolism 2001, 50, 583–589. [Google Scholar] [CrossRef] [Scilit]
  242. Koole, C.; Savage, E.E.; Christopoulos, A.; Miller, L.J.; Sexton, P.M.; Wootten, D. Minireview: Signal Bias, Allosterism, and Polymorphic Variation at the GLP-1R: Implications for Drug Discovery. Mol. Endocrinol. 2013, 27, 1234–1244. [Google Scholar] [CrossRef] [Scilit]
  243. Yosida, M.; Dezaki, K.; Uchida, K.; Kodera, S.; Lam, N.V.; Ito, K.; Rita, R.S.; Yamada, H.; Shimomura, K.; Ishikawa, S.-e.; et al. Involvement of cAMP/EPAC/TRPM2 Activation in Glucose- and Incretin-Induced Insulin Secretion. Diabetes 2014, 63, 3394–3403. [Google Scholar] [CrossRef] [Scilit]
  244. Tsend-Ayush, E.; He, C.; Myers, M.A.; Andrikopoulos, S.; Wong, N.; Sexton, P.M.; Wootten, D.; Forbes, B.E.; Grutzner, F. Monotreme glucagon-like peptide-1 in venom and gut: one gene – two very different functions. Sci. Rep. 2016, 6, 37744. [Google Scholar] [CrossRef] [Scilit]
  245. Marenah, L.; Shaw, C.; Orr, D.F.; Mcclean, S.; Flatt, P.R. Isolation and characterisation of an unexpected class of insulinotropic peptides in the skin of the frog Agalychnis litodryas. Regul. Pept. 2004, 120, 33–38. [Google Scholar] [CrossRef] [Scilit]
  246. Toyama, M.; Carneiro, E.M.; Marangoni, S.; Barbosa, R.L.; Corso, G.; Boschero, A.C. Biochemical characterization of two crotamine isoforms isolated by a single step RP-HPLC from Crotalus durissus terrificus (South American rattlesnake) venom and their action on insulin secretion by pancreatic islets. Biochim. Biophys. Acta - Gen. Subj. 2000, 1474, 56–60. [Google Scholar] [CrossRef] [Scilit]
  247. Toyama, D.O.; Boschero, A.C.; Martins, M.A.; Fonteles, M.C.; Monteiro, H.S.; Toyama, M.H. Structure-Function Relationship of New Crotamine Isoform from the Crotalus durissus cascavella. Protein J. 2005, 24, 9–19. [Google Scholar] [CrossRef] [Scilit]
  248. Tamarina, N.A.; Kuznetsov, A.; Fridlyand, L.E.; Philipson, L.H. Delayed-rectifier (K V 2.1) regulation of pancreatic β-cell calcium responses to glucose: inhibitor specificity and modeling. Am. J. Physiol. Metab. 2005, 289, E578–E585. [Google Scholar]
  249. Nguyen, T.T.N.; Folch, B.; Létourneau, M.; Vaudry, D.; Truong, N.H.; Doucet, N.; Chatenet, D.; Fournier, A. Cardiotoxin-I: An Unexpectedly Potent Insulinotropic Agent. ChemBioChem 2012, 13, 1805–1812. [Google Scholar] [CrossRef] [Scilit]
  250. Abdel-wahab, Y.H.A.; Marenah, L.; Flatt, P.R.; Conlon, J.M. Insulin Releasing Properties of the Temporin Family of Antimicrobial Peptides. Protein Pept. Lett. 2007, 14, 702–707. [Google Scholar] [CrossRef] [Scilit]
  251. Abdel-Wahab, Y.H.A.; Power, G.J.; Ng, M.T.; Flatt, P.R.; Conlon, J.M. Insulin-releasing properties of the frog skin peptide pseudin-2 and its [Lys18]-substituted analoguee. Biol. Chem. 2008, 389, 143–149. [Google Scholar] [CrossRef] [Scilit]
  252. Abdel-wahab, Y.H.A.; Marenah, L.; Orr, D.F.; Shaw, C.; Flatt, P.R. Isolation and structural characterisation of a novel 13-amino acid insulin-releasing peptide from the skin secretion of Agalychnis calcarifer. Biol. Chem. 2005, 386, 581–587. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  253. Abdel-wahab, Y.H.A.; Patterson, S.; Flatt, P.R.; Conlon, J.M. Brevinin-2-related Peptide and its [D4K] Analogue Stimulate Insulin Brevinin-2-related Peptide and its [D4K] Analogue Stimulate Insulin Release In Vitro and Improve Glucose Tolerance in Mice Fed a High Fat Diet. Horm. Metab. Res. 2010, 42, 652–656. [Google Scholar] [CrossRef] [Scilit]
  254. Conlon, J.M.; Al-ghaferi, N.; Ahmed, E.; Meetani, M.A.; Leprince, J.; Nielsen, P.F. Orthologs of magainin, PGLa, procaerulein-derived, and proxenopsin-derived peptides from skin secretions of the octoploid frog Xenopus amieti (Pipidae). Peptides 2010, 31, 989–994. [Google Scholar] [CrossRef] [Scilit]
  255. Ojo, O.O.; Conlon, J.M.; Flatt, P.R.; Abdel-wahab, Y.H.A. Frog skin peptides (tigerinin-1R, magainin-AM1, -AM2, CPF-AM1, and PGla-AM1) stimulate secretion of glucagon-like peptide 1 (GLP-1) by GLUTag cells. Biochem. Bioph. Res. Commun. 2013, 431, 14–18. [Google Scholar] [CrossRef] [Scilit]
  256. Owolabi, B.O.; Ojo, O.O.; Srinivasan, D.K.; Conlon, J.M.; Flatt, P.R.; Abdel-Wahab, Y.H.A. In vitro and in vivo insulinotropic properties of the multifunctional frog skin peptide hymenochirin-1B: a structure-activity study. Amino Acids 2016, 48, 535–547. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  257. Zahid, O.K.; Mechkarska, M.; Ojo, O.O.; Abdel-wahab, Y.H.A.; Flatt, P.R.; Meetani, M.A.; Michael, J. Caerulein-and xenopsin-related peptides with insulin-releasing activities from skin secretions of the clawed frogs, Xenopus borealis and Xenopus amieti (Pipidae). Gen. Comp. Endocrinol. 2011, 172, 314–320. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  258. Marenah, L.; Flatt, P.R.; Orr, D.F.; Shaw, C. Skin secretions of Rana saharica frogs reveal antimicrobial peptides esculentins-1 and -1B and brevinins-1E and -2EC with novel insulin releasing activity. J. Endocrinol. 2006, 188, 1–9. [Google Scholar] [CrossRef] [Scilit]
  259. Baptista-Saidemberg, N.B.; Saidemberg, D.M.; Ribeiro, R.A.; Arcuri, H.A.; Palma, M.S.; Carneiro, E.M. Agelaia MP-I: A peptide isolated from the venom of the social wasp, Agelaia pallipes pallipes, enhances insulin secretion in mice pancreatic islets. Toxicon 2012, 60, 596–602. [Google Scholar] [CrossRef] [Scilit]
  260. Safavi-Hemami, H.; Gajewiak, J.; Karanth, S.; Robinson, S.D.; Ueberheide, B.; Douglass, A.D.; Schlegel, A.; Imperial, J.S.; Watkins, M.; Bandyopadhyay, P.K.; et al. Specialized insulin is used for chemical warfare by fish-hunting cone snails. Proc. Natl. Acad. Sci. USA 2015, 112, 1743–1748. [Google Scholar] [CrossRef] [Scilit]
  261. Menting, J.G.; Gajewiak, J.; MacRaild, C.A.; Chou, D.H.-C.; Disotuar, M.M.; Smith, N.A.; Miller, C.; Erchegyi, J.; Rivier, J.E.; Olivera, B.M.; et al. A minimized human insulin-receptor-binding motif revealed in a Conus geographus venom insulin. Nat. Struct. Mol. Biol. 2016, 23, 916–920. [Google Scholar] [CrossRef] [Scilit]
  262. Martins, R.D.; Alves, R.S.; Martins, A.M.C.; Barbosa, P.S.F.; Evangelista, J.S.A.M.; Evangelista, J.J.F.; Ximenes, R.M.; Toyama, M.H.; Toyama, D.O.; Souza, A.J.F.; et al. Purification and characterization of the biological effects of phospholipase A2 from sea anemone Bunodosoma caissarum. Toxicon 2009, 54, 413–420. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  263. Morgan, N.G.; Montague, W. Stimulation of insulin secretion from isolated rat islets of Langerhans by melittin. Biosci. Rep. 1984, 4, 665–671. [Google Scholar] [CrossRef] [Scilit]
  264. Morgan, N.G.; Rumford, G.M.; Montague, W. Studies on the mechanism by which melittin stimulates insulin secretion from isolated rat islets of Langerhans. Biochim. Biophys. Acta - Mol. Cell Res. 1985, 845, 526–532. [Google Scholar] [CrossRef] [Scilit]
  265. Metz, S.A. Lack of specificity of melittin as a probe for insulin release mediated by endogenous phospholipase A2 or lipoxygenase. Biochem. Pharmacol. 1986, 35, 3371–3381. [Google Scholar] [CrossRef] [Scilit]
  266. Fagundes, F.H.R.; Aparício, R.; dos Santos, M.L.; Diz Filho, E.B.S.; Oliveira, S.C.B.; Toyama, D.O.; Toyama, M.H. A catalytically inactive Lys49 PLA2 isoform from Bothrops jararacussu venom that stimulates insulin secretion in pancreatic beta cells. Protein Pept. Lett. 2011, 18, 1133–1139. [Google Scholar] [CrossRef] [Scilit]
  267. Juhl, K.; Efanov, A.M.; Olsen, H.L.; Gromada, J. Secretory phospholipase A 2 is released from pancreatic. Biochem. Bioph. Res. Commun. 2003, 310, 274–279. [Google Scholar] [CrossRef] [Scilit]
  268. Ojo, O.O.; Abdel-wahab, Y.H.A.; Flatt, P.R.; Conlon, J.M. Insulinotropic Actions of the Frog Skin Host-Defense Peptide Alyteserin-2a: A Structure – Activity Study. Chem. Biol. Drug. Des. 2013, 82, 196–204. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  269. Ojo, O.O.; Srinivasan, D.K.; Owolabi, B.O.; Vasu, S. Esculentin-2CHa-Related Peptides Modulate Islet Cell Function and Improve Glucose Tolerance in Mice with Diet-Induced Obesity and Insulin Resistance. PLoS ONE 2015, 1–17. [Google Scholar] [CrossRef] [Scilit]
  270. Toyama, M.H.; Carneiro, E.M.; Marangoni, S.; Amaral, M.E.C.; Velloso, L.A.; Boschero, A.C. Isolation and characterization of a convulxin-like protein from Crotalus durissus collilineatus venom. J. Protein Chem. 2001, 20, 585–591. [Google Scholar] [CrossRef] [Scilit]
  271. Lang, J. Ca2+-independent insulin exocytosis induced by alpha -latrotoxin requires latrophilin, a G protein-coupled receptor. EMBO J. 1998, 17, 648–657. [Google Scholar] [CrossRef] [Scilit]
  272. Silva, A.M.; Liu-Gentry, J.; Dickey, A.S.; Barnett, D.W.; Misler, S. α-Latrotoxin increases spontaneous and depolarization-evoked exocytosis from pancreatic islet β-cells. J. Physiol. 2005, 565, 783–799. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  273. Lajus, S.; Vacher, P.; Huber, D.; Dubois, M.; Benassy, M.-N.; Ushkaryov, Y.; Lang, J. α-Latrotoxin Induces Exocytosis by Inhibition of Voltage-dependent K + Channels and by Stimulation of L-type Ca 2+ Channels via Latrophilin in β-Cells. J. Biol. Chem. 2006, 281, 5522–5531. [Google Scholar] [CrossRef] [Scilit]
  274. Jones, P.M.; Mann, F.M.; Persaud, S.J.; Wheeler-Jones, C.P.D. Mastoparan stimulates insulin secretion from pancreatic β-cells by effects at a late stage in the secretory pathway. Mol. Cell. Endocrinol. 1993, 94, 97–103. [Google Scholar] [CrossRef] [Scilit]
  275. Komatsu, M.; McDermott, A.M.; Gillison, S.L.; Sharp, G.W.G. Mastoparan stimulates exocytosis at a Ca2+-independent late site in stimulus-secretion coupling. Studies with the RINm5F β-cell line. J. Biol. Chem. 1993, 268, 23297–23306. [Google Scholar]
  276. Eddlestone, G.T.; Komatsu, M.; Shen, L.; Sharp, G.W. Mastoparan increases the intracellular free calcium concentration in two insulin-secreting cell lines by inhibition of ATP-sensitive potassium channels. Mol. Pharmacol. 1995, 47, 787–797. [Google Scholar] [PubMed]
  277. Straub, S.G.; James, R.F.L.; Dunne, M.J.; Sharp, G.W.G. Glucose augmentation of mastoparan-stimulated insulin secretion in rat and human pancreatic islets. Diabetes 1998, 47, 1053–1057. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  278. Daniel, S.; Noda, M.; Cerione, R.A.; Sharp, G.W.G. A Link between Cdc42 and Syntaxin Is Involved in Mastoparan-Stimulated Insulin Release. Biochemistry 2002, 41, 9663–9671. [Google Scholar] [CrossRef] [Scilit]
  279. Amin, R.H.; Chen, H.-Q.; Veluthakal, R.; Silver, R.B.; Li, J.; Li, G.; Kowluru, A. Mastoparan-Induced Insulin Secretion from Insulin-Secreting βTC3 and INS-1 Cells: Evidence for Its Regulation by Rho Subfamily of G Proteins. Endocrinology 2003, 144, 4508–4518. [Google Scholar] [CrossRef] [Scilit]
  280. Kinch, M.S.; Haynesworth, A.; Kinch, S.L.; Hoyer, D. An overview of FDA-approved new molecular entities: 1827–2013. Drug Discov. Today 2014, 19, 1033–1039. [Google Scholar] [CrossRef] [Scilit]
  281. Cury, Y.; Picolo, G. Animal toxins as analgesics-an overview. Drug News Perspect. 2006, 19, 381–392. [Google Scholar]
  282. Harvey, A.L. Toxins and drug discovery. Toxicon 2014, 92, 193–200. [Google Scholar] [CrossRef] [Scilit]
  283. Bhavsar, S.; Mudaliar, S.; Cherrington, A. Evolution of Exenatide as a Diabetes Therapeutic. Curr. Diabetes Rev. 2013, 9, 161–193. [Google Scholar]
  284. Hui, H.; Zhao, X.; Perfetti, R. Structure and function studies of glucagon-like peptide-1 (GLP-1): the designing of a novel pharmacological agent for the treatment of diabetes. Diabetes. Metab. Res. Rev. 2005, 21, 313–331. [Google Scholar] [CrossRef] [Scilit]
  285. Rajagopalan, S.; Zhong, J.; Goud, A. Emerging utility of once-weekly exenatide in patients with type 2 diabetes. Diabetes, Metab. Syndr. Obes. Targets Ther. 2015, 62, 505. [Google Scholar] [CrossRef] [Scilit]
  286. DeFronzo, R.A.; Okerson, T.; Viswanathan, P.; Guan, X.; Holcombe, J.H.; MacConell, L. Effects of exenatide versus sitagliptin on postprandial glucose, insulin and glucagon secretion, gastric emptying, and caloric intake: a randomized, cross-over study. Curr. Med. Res. Opin. 2008, 24, 2943–2952. [Google Scholar] [CrossRef] [Scilit]
  287. Pinelli, N.R.; Jantz, A.; Smith, Z.; Abouhassan, A.; Ayar, C.; Jaber, N.A.; Clarke, A.W.; Commissaris, R.L.; Jaber, L.A. Effect of Administration Time of Exenatide on Satiety Responses, Blood Glucose, and Adverse Events in Healthy Volunteers. J. Clin. Pharmacol. 2011, 51, 165–172. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  288. Edwards, C.M.B.; Stanley, S.A.; Davis, R.; Brynes, A.E.; Frost, G.S.; Seal, L.J.; Ghatei, M.A.; Bloom, S.R. Exendin-4 reduces fasting and postprandial glucose and decreases energy intake in healthy volunteers. Am. J. Physiol. Metab. 2001, 281, E155–E161. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  289. Fehse, F.; Trautmann, M.; Holst, J.J.; Halseth, A.E.; Nanayakkara, N.; Nielsen, L.L.; Fineman, M.S.; Kim, D.D.; Nauck, M.A. Exenatide augments first- and second-phase insulin secretion in response to intravenous glucose in subjects with type 2 diabetes. J. Clin. Endocrinol. Metab. 2005, 90, 5991–5997. [Google Scholar] [CrossRef] [Scilit]
  290. Molina Vega, M.; Araceli, M.G.; Tinahones, F.J. Pharmacokinetic drug evaluation of exenatide for the treatment of type 2 diabetes. Expert Opin. Drug Metab. Toxicol. 2018, 14, 207–217. [Google Scholar] [CrossRef] [Scilit]
  291. Knop, F.K.; Brønden, A.; Vilsbøll, T. Exenatide: pharmacokinetics, clinical use, and future directions. Expert Opin. Pharmacother. 2017, 18, 555–571. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  292. Robinson, S.D.; Safavi-Hemami, H. Venom peptides as pharmacological tools and therapeutics for diabetes. Neuropharmacology 2017, 127, 79–86. [Google Scholar] [CrossRef] [Scilit]
  293. Redwan, E.M. Animal-Derived Pharmaceutical Proteins. J. Immunoass. Immunochem. 2009, 30, 262–290. [Google Scholar] [CrossRef] [Scilit]
  294. Graaf, C.d.; Donnelly, D.; Wootten, D.; Lau, J.; Sexton, P.M.; Miller, L.J.; Ahn, J.-M.; Liao, J.; Fletcher, M.M.; Yang, D.; et al. Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes. Pharmacol. Rev. 2016, 68, 954–1013. [Google Scholar] [CrossRef] [Scilit]
  295. Ramu, Y.; Xu, Y.; Lu, Z. A novel high-affinity inhibitor against the human ATP-sensitive Kir6.2 channel. J. Gen. Physiol. 2018, 150, 969–976. [Google Scholar] [CrossRef] [Scilit]
  296. Moreno, M.; Giralt, E. Three Valuable Peptides from Bee and Wasp Venoms for Therapeutic and Biotechnological Use: Melittin, Apamin and Mastoparan. Toxins 2015, 7, 1126–1150. [Google Scholar] [CrossRef] [Scilit]
  297. Conlon, J.M.; Mechkarska, M.; Abdel-Wahab, Y.H.; Flatt, P.R. Peptides from frog skin with potential for development into agents for Type 2 diabetes therapy. Peptides 2018, 100, 275–281. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  298. Mclaughlin, C.M.; Lampis, S.; Mechkarska, M.; Coquet, L.; Jouenne, T.; King, J.D.; Mangoni, M.L.; Lukic, M.L.; Scorciapino, M.A.; Conlon, J.M. Purification, Conformational Analysis, and Properties of a Family of Tigerinin Peptides from Skin Secretions of the Crowned Bullfrog Hoplobatrachus occipitalis. J. Nat. Prod. 2016, 79, 2350–2356. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  299. Manzo, G.; Scorciapino, M.A.; Srinivasan, D.; Attoub, S.; Mangoni, M.L.; Rinaldi, A.C.; Casu, M.; Flatt, P.R.; Conlon, J.M. Conformational Analysis of the Host-Defense Peptides Pseudhymenochirin-1Pb and -2Pa and Design of Analogues with Insulin-Releasing Activities and Reduced Toxicities. J. Nat. Prod. 2015, 78, 3041–3048. [Google Scholar] [CrossRef] [Scilit]
  300. Ojo, O.O.; Flatt, P.R.; Mechkarska, M.; Conlon, J.M. Tigerinin-1R: a potent, non-toxic insulin-releasing peptide isolated from the skin of the Asian frog, Hoplobatrachus rugulosus. Diabetes Obes. Metab. 2011, 13, 1114–1122. [Google Scholar] [CrossRef] [Scilit]
  301. Srinivasan, D.; Ojo, O.O.; Abdel-wahab, Y.H.A.; Flatt, P.R.; Guilhaudis, L.; Conlon, J.M. Insulin-releasing and cytotoxic properties of the frog skin peptide, tigerinin-1R: a structure – activity study. Peptides 2014, 55, 23–31. [Google Scholar] [CrossRef] [Scilit]
  302. Attoub, S.; Mechkarska, M.; Sonnevend, A.; Radosavljevic, G.; Jovanovic, I.; Lukic, M.L.; Conlon, J.M. Peptides Esculentin-2CHa: A host-defense peptide with differential cytotoxicity against bacteria, erythrocytes and tumor cells. Peptides 2013, 39, 95–102. [Google Scholar] [CrossRef] [Scilit]
  303. Mo, G.-X.; Bai, X.-W.; Li, Z.-J.; Yan, X.-W.; He, X.-Q.; Rong, M.-Q. A Novel Insulinotropic Peptide from the Skin Secretions of Amolops loloensis Frog. Nat. Prod. Bioprospect. 2014, 4, 309–313. [Google Scholar] [CrossRef] [Scilit]
  304. Marenah, L.; Flatt, P.R.; Orr, D.F.; Clean, S.M.; Shaw, C. Brevinin-1 and multiple insulin-releasing peptides in the skin of the frog Rana palustris. J. Endocrinol. 2004, 181, 347–354. [Google Scholar] [CrossRef] [Scilit]
  305. Conlon, J.M.; Abdel-wahab, Y.H.A.; Flatt, P.R.; Vaudry, H.; Jouenne, T.; Condamine, E. A glycine-leucine-rich peptide structurally related to the plasticins from skin secretions of the frog Leptodactylus laticeps (Leptodactylidae). Peptides 2009, 30, 888–892. [Google Scholar] [CrossRef] [Scilit]
  306. Mechkarska, M.; Ojo, O.O.; Meetani, M.A.; Coquet, L.; Jouenne, T.; Abdel-wahab, Y.H.A.; Flatt, P.R.; King, J.D.; Conlon, J.M. Peptidomic analysis of skin secretions from the bullfrog Lithobates catesbeianus (Ranidae) identifies multiple peptides with potent insulin-releasing activity. Peptides 2011, 32, 203–208. [Google Scholar] [CrossRef] [Scilit]
  307. Conlon, J.M.; Power, G.J.; Abdel-wahab, Y.H.A.; Flatt, P.R.; Jiansheng, H.; Coquet, L.; Leprince, J.; Jouenne, T.; Vaudry, H. A potent, non-toxic insulin-releasing peptide isolated from an extract of the skin of the Asian frog, Hylarana guntheri (Anura:Ranidae). Regul. Pept. 2008, 151, 153–159. [Google Scholar] [CrossRef] [Scilit]
  308. Conlon, J.M.; Musale, V.; Attoub, S.; Mangoni, L.; Leprince, J.; Coquet, L.; Jouenne, T.; Abdel-wahab, Y.H.A.; Flatt, R.; Rinaldi, A.C. Cytotoxic peptides with insulin-releasing activities from skin secretions of the Italian stream frog Rana italica ( Ranidae ). J. Pept. Sci. 2017, 23, 769–776. [Google Scholar] [CrossRef] [Scilit]
  309. Moore, S.W.M.; Bhat, V.K.; Flatt, P.R.; Gault, V.A.; McClean, S. Isolation and characterisation of insulin-releasing compounds from Crotalus adamanteus, Crotalus vegrandis and Bitis nasicornis venom. Toxicon 2015, 101, 48–54. [Google Scholar] [CrossRef] [Scilit]
  310. Nogueira, T.C.A.; Ferreira, F.; Toyama, M.H.; Stoppiglia, L.F.; Marangoni, S.; Boschero, A.C.; Carneiro, E.M. Characterization of the insulinotropic action of a phospholipase A2 isolated from Crotalus durissus collilineatus rattlesnake venom on rat pancreatic islets. Toxicon 2005, 45, 243–248. [Google Scholar] [CrossRef] [Scilit]
  311. Dutertre, S.; Lewis, R.J. Use of Venom Peptides to Probe Ion Channel Structure and Function. J. Biol. Chem. 2010, 285, 13315–13320. [Google Scholar] [CrossRef] [Scilit]
  312. Wan, E.; Kushner, J.S.; Zakharov, S.; Nui, X.; Chudasama, N.; Kelly, C.; Waase, M.; Doshi, D.; Liu, G.; Iwata, S.; et al. Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice. FASEB J. 2013, 27, 1859–1867. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  313. Banerjee, A.; Lee, A.; Campbell, E.; MacKinnon, R. Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K+ channel. Elife 2013, 2, 1–22. [Google Scholar] [CrossRef] [Scilit]
Table 1. Insulin release mechanism modulated by toxins isolated from animal venoms.
Table 1. Insulin release mechanism modulated by toxins isolated from animal venoms.
Mode of ActionToxinsSpeciesSequenceaaSummaryRef.
Specific Mechanism
GLP-1 receptor AgonistExendin-4 (Exenatide; Byetta ™)Heloderma SuspectumHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS39Highly stable GLP-1 analogue, promotes glucose-dependent
insulin secretion, inhibits glucagon secretion and suppresses appetite; Increase in cAMP signaling in pancreatic acinar cells with superior selectivity; Ex-4 may stimulate β-cells cooperatively by inhibiting KATP channels and activating TRPM2 channels (potential target for T2D); Human GLP-1 and ex-4 show relative bias for cAMP and intracellular Ca2 mobilization (involved in promotion of insulin release)
[237,238,239,240,241,242,243]
Platypus GLP-1 (pGLP-1)Ornithorhynchus AnatinusHSEGTFTNDVTRLLEEKATSEFIAWLLKGLE31Stable GLP-1 analogue with distinct signal bias; stimulates insulin release in cultured rodent islets; Resistance to DPP-4 cleavage; Biophysical characteristics that may offer valuable insight in the development of new anti-diabetic agents[244]
Echidna GLP-1 (eGLP-1)Tachyglossus AculeatusHFDGVYTDYFSRYLEEKATNEFIDWLLKGQE31
Insulinotropic peptideFSIPAgalychnis litodryasAVWKDFLKNIGKAAGKAVLNSVTDMVNE28Clinical phase 3; Type 2 diabetes[245]
Modulate Na+ channel inactivation.TsTx-VTityus serrulatusKKDGYPVEGDNCAFACFGYDNAYCDKUIKDKKADDGYCYWSPDCYCYGLPEHILKEPTKTSGRC64Membrane depolarization and increased relative duration of electrical activity during the active phase.[119]
Crotamine
Two isoforms (F2 – F3)
Crotalus durissus terrificusYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG42Increases the peak of Na+ currents and inhibits the direct transition of the channel from closed to inactivated states; Insulin secretion in dose-dependent manner.[246]
Cro 2Crotalus durissus cascavellaYKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRKCCKKGSGK.43Cro 2 binding to open state of the Na+ channels, induces a dose-dependent manner of insulin secretion; The most important region for the binding of Cro 2 to the Na+ channels involved the C-terminal region.[247]
BK channel blockerIberiotoxin (IbTx)Buthus tamulusZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ37Increases action potential amplitude, enhances insulin secretion by 70% and increases resting membrane conductance.[39]
Kv2.1 channel blockerHanatoxin (HaTX)Grammostola roseaECRYLFGGCKTTSDCCKHLGCKFRDKYCAWDFTFS35Inhibits the delayed rectifier current by 65% at +20 mV; Induces a right shift in the current-voltage (I-V) relationship; Affects oscillatory [Ca2]int responses in mouse and human islets in the presence of glucose.[181,248]
Kv2.1 and Kv2.2 channel blocker (β cell IDR )Guangxitoxin-1 (GxTX-1)Chilobrachys GuangxiensisEGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP36Inhibits 90% of the β cell IDR; Increases [Ca2]int and stimulated insulin secretion in a glucose-dependent manner.[182]
KV1.7 channel blockerConkunitzin-S1 (Conk-S1)Striated coneKDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT
(amidation of the C-terminal)
60Conk-S1 as a specific blocker of Kv1.7 and indicates that Kv1.7 activity contributes actively to the control of GSIS in pancreatic β cells without affecting basal glucose;[180]
Non-specific Mechanism
K+ channel Blocker (by similarity)Cardiotoxin-I (CTX-I)Naja kaouthiaLKCNKLIPIASKTCPAGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN60Stimulates insulin secretion in a concentration-dependent manner in the absence and presence of glucose without affecting cell viability and integrity; Increases the mobilization of [Ca2]int; Insulinotropic activity does not involve GLP-1R signaling.[249]
KATP channel independent pathwayTemporin-1OeR. ornativentrisILPLLGNLLNGLL.NH213Stimulates in vitro insulin release from BRIN-BD11 rat insulinoma derived cells; does not stimulate release of the cytosolic enzyme LDH.[250]
Temporin-1Va
Temporin-1Vc
Temporin-1Vb
R. virgatipesFLSSIGKILGNLL.NH2
FLPLVTMLLGKLF.NH2
FLSIIAKVLGSLF.NH2
13Small but significant increases in insulin release with no increased rate of LDH.[250]
Temporin-1DRbR. draytoniiNFLGTLVNLAKKIL.NH214Stimulates in vitro insulin release from BRIN-BD11 rat insulinoma-derived cells; does not stimulate release of the cytosolic enzyme LDH.[250]
Temporin-1TGbR. tagoiAVDLAKIANKVLSSLF.NH216Stimulates in vitro insulin release from BRIN-BD11 rat insulinoma derived cells; does not stimulate release of the cytosolic enzyme LDH.[250]
Ca2+-independent pathwaysPseudin-2Pseudis paradoxaGLNALKKVFQGIHEAIKLINNHVQ24Stimulates insulin release from BRIN-BD11.[251]
GLP-1 receptor AgonistRK-13Agalychnis calcariferRRKPLFPLIPRPK13Stimulated insulin release in a dose-dependent, glucose-sensitive manner, exerting its effects through a cyclic AMP-protein kinase A pathway independent of pertussis toxin-sensitive G proteins.[252]
GLP-1 receptor AgonistBrevinin-2-Related PeptideLithobates septentrionalsGIWDTIKSMGKVFAGKILQNL.NH221The rate of insulin release increased to 222 % of basal rate.[253]
Magainin-AM1
Magainin-AM2
Xenopus amietiGIKEFAHSLGKFGKAFLGEIMKS
GVSKILHSAGKFGKAFLGEIMKS
23All peptides produced a significant increase over the basal rate of insulin release; Magainin-AM2 was the most potent peptide and Magainin-AM1 stimulated GLP-1 release.[254,255]
Hymenochirin–1BHymenochirus
boettgeri
IKLSPETKDNLKKVLKGAIKGAIAVAKMV.NH229This peptide produced a concentration-dependent increase in the rate of insulin release from BRIN-BD11 cells without cytotoxicity[256]
Caerulein-B1Xenopus borealisEQDY(SO3)GTGWMDF11At concentrations ≥30 nM stimulates the rate of insulin secretion from BRIN-BD11 cells with a maximum response (360% of basal rate) at 3 µM[257]
PGLa-AM1
PGLa-AM2
XPF-AM1
CPF-AM1
CPF-AM3
CPF-AM4
CPF-AM2
Xenopus amietiGMASKAGSVLGKVAKVALKAAL.NH2
GMASTAGSVLGKLAKAVAIGAL.NH2
GWASKIAQTLGKMAKVGLQELIQPK
GLGSVLGKALKIGANLL.NH2
GIGSALAKAAKLVAGIV.NH2
GLGSVLGKILKMGANLLGGAPKGA
GLGSLVGNALRIGAKLL.NH2
22
22
25
17
17
24
17
All peptides produced a significant (p < 0.05) increase over the basal rate of release at concentrations P300 nM. Magainin-AM2 was the most potent peptide, producing a significant (p < 0.05) increase at a concentration of 1 nM. CPF-AM1 was the most effective peptide, producing a maximum response 3.2-fold greater than basal rate (p < 0.001) at 3 µM concentration[254,255]
G protein interactionEsculentin-1bPelophylax saharicusGIFSKLAGKKLKNLLISGLKNVGKEVGMDVVRTGIDIAGCKIKGEC46Stimulates insulin release from rat RINm5F insulinoma-derived cells and increases intracellular Ca2+ concentrations[258]
Agelaia MP-I (AMP-I)Agelaia pallipes pallipesINWLKLGKAIIDAL–NH214Increases glucose-induced insulin secretion in a dose-dependent manner and this effect was not due to lysis process; The mechanism involved in this modulation is independent of the KATP and L-type Ca2+ channels, suggesting a different mechanism for this peptide, possibly by a G protein interaction.[259]
Insulin receptor agonistInsulin 1 (Con- Ins G1)Conus geographusGVVgHCCHRPCSNAEFKKYC (A chain)
TFDTOKHRCSGSgITNSYMDLCYR (B chain)
44Con-Ins G1 the smallest insulin identified from a natural source; Injection of Con-Ins G1 into zebrafish produced a rapid drop in blood glucose with a potency comparable to that of human insulin; Con-Ins G1 could be an effective drug for T1D.[260,261]
Phospholipase A2 (PLA2) arachidonic acid releaseBcPLA21Bunodosoma caissarumGATIMPGTLWCGKGNSAADYLQLGVWKDTAHCCRDHDGC39Strongly induces insulin secretion only in presence of high glucose concentration; The enzymatic activity of BcPLA21 is not required for its pharmacological activity.[262]
MelittinApis melliferaGIGAVLKVLTTGLPALISWIKRKRQQ26Stimulates insulin secretion in isolated rat islets in a dose-dependent manner by activating phospholipase A2 in islet cells, causing release of arachidonic acid from membrane phospholipid; The effect on insulin secretion was dependent on extracellular calcium and did not require the presence of glucose.[263,264,265]
BjVIII Lys49-PLA2 phospholipase A2 (sPLA2) isoformBothrops jararacussuSLFELGKMILQETGKNPAKSYGAYGCNCGVLGRGGPKDATDRCCYVHKCCYKKVTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENL
GTYNKKYRYHLKPFCKKADPC
38DATDRCCYVHK48 new isoform Lys49-PLA2
20SYGAYGCNCGVLRGGPK36, the calcium binding region
121Enhances insulin secretion by increasing calcium entry into pancreatic β cells; hyperactivating depolarization-induced exocytosis; does not show significant enzymatic activity; Arachidonic acid induces an increase in insulin secretion, which may be due to potential interaction with K+ channels and the stimulation of adenylyl cyclase guanydyl cyclase, proteinkinase C (PKC),the Ca2+/calmodulin-dependent protein kinase; inhibition of KATP channels[266]
Phospholipase A2 (PLA2) arachidonic acid releasePhospholipase A2Naja mossambica mossambicaNLYQFKNMIHCTVPSRPWWHFADYGCYCGRGGKGTPVDDLDRCCQVHDNCYEKAGKMGCWPYFTLYKYKCSQGKLTCSGGNSKCGAAVCNCDLVAANCFAGARYIDANYNINFKKRCQ118Induces insulin secretion
also involved in block of ATP-dependent K channels, increases cytosolic free Ca2+ and insulin exocytosis; Despite the differing opinions on the mechanism of action of PLA2-induced insulin secretion in β cells, its role as a potent insulin secretagogue is without question.
[267]
Mechanism involving membrane depolarization and increase of intracellular Ca2+Alyteserin-2aAlytes. obstetricansILGKLLSTAAGLLSNL.NH216Significant stimulation of the rate of insulin release from BRIN-BD11.[268]
Esculentin-2CHaLithobates chiricahuensisGFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC37Stimulates insulin secretion from rat BRIN-BD11 clonal pancreatic β cells[269]
PTK-dependent pathwayConvulxin-Like Protein (Cvx-like)Crotalus durissus collilineatusα subunit: GLHCPSDWYAYDGHCYKIFNEEMNWED
β subunit: GFCCPSHWSSYSRYCYKFFSQEMNWEDAEK
57Insulin secretion induced by Cvx-like protein may be mediated by a protein tyrosine kinase-dependent pathway and may involve other membrane receptors, such as GP VI or Scr family proteins.[270]
Exocytosis process mediated by receptorα-Latrotoxin (α -LTX)Latrodectus tredecimguttatusPolypeptide: 21-1199 aa α-LTX receptors are expressed on primary β cells and the toxin induces exocytosis of the peptide hormone insulin in a glucose-dependent manner in both the presence and absence of extracellular Ca2+; rises in cytosolic Ca2+, large conductance of non-selective cation channels; and Ca2+ dependent insulin granule exocytosis; α-LTX induces signaling distinct from pore formation via full-length LPH and phospholipase C to regulate physiologically important K+ and Ca2+ channels as novel targets of its secretory activity.[271,272,273]
Insulinotropic toxin; GTP-binding protein; Exocytosis process; KATP Channel inhibition; Direct activation of Rho proteinMastoparan Versatile peptideVespula lewisiiINLKALAALAKKIL14Mastoparan, an amphiphilic tetradecapeptide, inserts itself into the phospholipid bilayer of the plasma membrane and displays four positive charges near the inner surface of the membrane. This structurally mimics the positively charged loops of hormone receptors that associate with the R-subunit of heterotrimeric GTP-binding proteins; Mastoparan suppresses KATP channel activity and causes depolarization, implicating this pathway in mastoparan-induced [Ca2+]ı elevation; Mastoparan had no effect on cellular CAMP levels.[274,275,276,277,278,279]
aa: amino acid residue.

Share and Cite

MDPI and ACS Style

Sarmiento, B.E.; Santos Menezes, L.F.; Schwartz, E.F. Insulin Release Mechanism Modulated by Toxins Isolated from Animal Venoms: From Basic Research to Drug Development Prospects. Molecules 2019, 24, 1846. https://doi.org/10.3390/molecules24101846

AMA Style

Sarmiento BE, Santos Menezes LF, Schwartz EF. Insulin Release Mechanism Modulated by Toxins Isolated from Animal Venoms: From Basic Research to Drug Development Prospects. Molecules. 2019; 24(10):1846. https://doi.org/10.3390/molecules24101846

Chicago/Turabian Style

Sarmiento, Beatriz Elena, Luis Felipe Santos Menezes, and Elisabeth F. Schwartz. 2019. "Insulin Release Mechanism Modulated by Toxins Isolated from Animal Venoms: From Basic Research to Drug Development Prospects" Molecules 24, no. 10: 1846. https://doi.org/10.3390/molecules24101846

APA Style

Sarmiento, B. E., Santos Menezes, L. F., & Schwartz, E. F. (2019). Insulin Release Mechanism Modulated by Toxins Isolated from Animal Venoms: From Basic Research to Drug Development Prospects. Molecules, 24(10), 1846. https://doi.org/10.3390/molecules24101846

Article Metrics

Back to TopTop