Conservation of Intronic Sequences in Vertebrate Mitochondrial Solute Carrier Genes (Zebrafish, Chicken, Mouse and Human)
Abstract
:1. Introduction
2. Results
2.1. SLC25A3
2.2. SLC25A12
2.3. SLC25A13
2.4. SLC25A21
- Human MAYPAACLGGSAFHDRHSLLRIVGSGSGLQLQITAAVLR*
- Gorilla MAYPAACLGGSAFHDRHSLLRIVGSGSGLQLQITAAVLRL
- Chicken PIKWLTDELWGRFILFMHSQTSCFKHIFLP*CY*DI
- Anas PIQWLTDELLGQIYIVRAFPDILFQAYIFTLELLRHL
- Zonotrichia PIQWLTDELLGQIYIAHVFPDILFQAYIFILALLRHL
- Chicken MCKNIANRIVKKTSSSIGNPNVFR*NNM
- Mouse MCKNIANGIVKKTSSSLGNPNVLGWNNR
- Human MCKNIANGIVKKTSSSLGNPNVFRWNNR
- Physeter MCKNIANGIVKKTSSSLGNPNVFRWNNR
2.5. SLC25A25
2.6. SLC25A26
2.7. SLC25A29
2.8. SLC25A36
2.9. Percentages of Intronic Conservation
3. Discussion
4. Material and Methods
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Palmieri, F.; Pierri, C.L. Mitochondrial metabolite transport. Essays Biochem. 2010, 47, 37–52. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Palmieri, F. The mitochondrial transporter family SLC25: Identification, properties and physiopathology. Mol. Asp. Med. 2013, 34, 465–484. [Google Scholar] [CrossRef] [PubMed]
- Palmieri, F. Mitochondrial transporters of the SLC25 family and associated diseases: A review. J. Inherit. Metab. Dis. 2014, 37, 565–575. [Google Scholar] [CrossRef] [PubMed]
- Calvello, R.; Cianciulli, A.; Panaro, M.A. Unusual structure and splicing pattern of the vertebrate mitochondrial solute carrier SLC25A3 gene. J. Genet. 2018, 97, 225–233. [Google Scholar] [CrossRef] [PubMed]
- Foote, M.; Hunter, J.P.; Janis, C.M.; Sepkoski, J.J., Jr. Evolutionary and preservational constraints on origins of biologic groups: Divergence times of eutherian mammals. Science 1999, 283, 1310–1314. [Google Scholar] [CrossRef] [PubMed]
- Lee, M.S. Molecular clock calibrations and metazoan divergence dates. J. Mol. Evol. 1999, 49, 385–391. [Google Scholar] [CrossRef] [PubMed]
- Nei, M.; Xu, P.; Glazko, G. Estimation of divergence times from multiprotein sequences for a few mammalian species and several distantly related organisms. Proc. Natl. Acad. Sci. USA 2001, 98, 2497–2502. [Google Scholar] [CrossRef] [Green Version]
- Nobrega, M.A.; Pennacchio, L.A. Comparative genomic analysis as a tool for biological discovery. J. Physiol. 2004, 554, 31–39. [Google Scholar] [CrossRef]
- Broughton, R.E.; Betancur, R.R.; Li, C.; Arratia, G.; Ortí, G. Multi-locus phylogenetic analysis reveals the pattern and tempo of bony fish evolution. PLoS Curr. 2013, 5. [Google Scholar] [CrossRef]
- Cianciulli, A.; Calvello, R.; Panaro, M.A. Determinism and randomness in the evolution of introns and SINE inserts in Mouse and Human mitochondrial solute carrier and cytokine receptor genes. Comput. Biol. Chem. 2015, 55, 49–59. [Google Scholar] [CrossRef]
- Aruscavage, P.J.; Bass, B.L. A phylogenetic analysis reveals an unusual sequence conservation within introns involved in RNA editing. RNA 2000, 6, 257–269. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rahman, L.; Bliskovski, V.; Kaye, F.J.; Zajac-Kaye, M. Evolutionary conservation of a 2-kb intronic sequence flanking a tissue-specific alternative exon in the PTBP2 gene. Genomics 2004, 83, 76–84. [Google Scholar] [CrossRef]
- Buchman, A.R.; Berg, P. Comparison of intron-dependent and intron-independent gene expression. Mol. Cell. Biol. 1988, 8, 4395–4405. [Google Scholar] [CrossRef] [PubMed]
- Bourdon, V.; Harvey, A.; Lonsdale, D.M. Introns and their positions affect the translational activity of mRNA in plant cells. EMBO Rep. 2001, 2, 394–398. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Le Hir, H.; Nott, A.; Moore, M.J. How introns influence and enhance eukaryotic gene expression. Trends Biochem. Sci. 2003, 28, 215–220. [Google Scholar] [CrossRef]
- Nott, A.; Meislin, S.H.; Moore, M.J. A quantitative analysis of intron effects on mammalian gene expression. RNA 2003, 9, 607–617. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhao, C.; Hamilton, T. Introns regulate the rate of unstable mRNA decay. J. Biol. Chem. 2007, 28, 20230–20237. [Google Scholar] [CrossRef] [PubMed]
- Chorev, M.; Joseph Bekker, A.; Goldberger, J.; Carmel, L. Identification of introns harboring functional sequence elements through positional conservation. Sci. Rep. 2017, 7, 4201. [Google Scholar] [CrossRef] [PubMed]
- Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
- Corpet, F. Multiple sequence alignment with hierarchical clustering. Nucleic Acids Res. 1988, 16, 10881–10890. [Google Scholar] [CrossRef] [Green Version]
- Cianciulli, A.; Calvello, R.; Mitolo, V.; Panaro, M.A. Intron evolution of chicken, mouse and human mitochondrial carrier genes. Rend. Lincei 2018, 29, 437–442. [Google Scholar] [CrossRef]
- Fiermonte, G.; Dolce, V.; Palmieri, F. Expression in Escherichia coli, functional characterization, and tissue distribution of isoforms A and B of the phosphate carrier from bovine mitochondria. J. Biol. Chem. 1998, 273, 22782–227847. [Google Scholar] [CrossRef] [PubMed]
Chicken | Mouse | Human | |
---|---|---|---|
Number of nucleotides | 1287 | 1106 | 1209 |
Percentage | 0.273 | 0.234 | 0.254 |
Mouse | Human | |
---|---|---|
Number of nucleotides | 14,987 | 20,601 |
Percentage | 3.203 | 4.403 |
© 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Calvello, R.; Cianciulli, A.; Mitolo, V.; Porro, A.; Panaro, M.A. Conservation of Intronic Sequences in Vertebrate Mitochondrial Solute Carrier Genes (Zebrafish, Chicken, Mouse and Human). Non-Coding RNA 2019, 5, 4. https://doi.org/10.3390/ncrna5010004
Calvello R, Cianciulli A, Mitolo V, Porro A, Panaro MA. Conservation of Intronic Sequences in Vertebrate Mitochondrial Solute Carrier Genes (Zebrafish, Chicken, Mouse and Human). Non-Coding RNA. 2019; 5(1):4. https://doi.org/10.3390/ncrna5010004
Chicago/Turabian StyleCalvello, Rosa, Antonia Cianciulli, Vincenzo Mitolo, Annalisa Porro, and Maria Antonietta Panaro. 2019. "Conservation of Intronic Sequences in Vertebrate Mitochondrial Solute Carrier Genes (Zebrafish, Chicken, Mouse and Human)" Non-Coding RNA 5, no. 1: 4. https://doi.org/10.3390/ncrna5010004