Genome-Wide Identification and Characterization of the Trihelix Transcription Factor Family in Pinus massoniana and Gene Expression Patterns Analysis
Abstract
1. Introduction
2. Results
2.1. Identification of GT Genes in P. massoniana
2.2. Chromosomal Distribution of GT Genes
2.3. Phylogenetic and Protein Domain Analysis of PmGT Proteins
2.4. Cis-Regulatory Elements Analysis of the PmGTs Promoters
2.5. Expression Patterns of PmGTs Under Nematode Stress
2.6. Subcellular Localization Assay
2.7. Expression Patterns in Different Tissues
2.8. Expression Patterns Under Plant Hormones
2.9. Transcriptional Activation
3. Discussion
4. Materials and Methods
4.1. Identification and Analysis of PmGTs
4.2. RNA-Seq Data Analysis and Expression Patterns of PmGTs
4.3. RNA Extraction and qRT-PCR Analysis
4.4. Subcellular Localization Analysis
4.5. Transcriptional-Activation Activity Assay
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Ji, K.S.; Xu, L.A.; Wang, D.B.; Ni, Z.X.; Wang, Z.R. Progress and achievement of genetic improvement on Masson pine (Pinus massoniana Lamb.) in China. J. Nanjing Univ. 2022, 46, 10–22. [Google Scholar]
- Yang, Z.Q. Research progress of high rosin genetic improvement and breeding strategy of Pinus massoniana. Guangxi Sci. 2015, 44, 317–324. [Google Scholar]
- Liang, W.L.; Yu, A.X.; Wang, G.D.; Zheng, F.; Jia, J.L.; Xu, H.H. Chitosan-based nanoparticles of avermectin to control pine wood nematodes. Int. J. Biol. Macromol. 2018, 112, 258–263. [Google Scholar] [CrossRef]
- Feng, J.L.; Li, R.G.; Wang, C.; Yang, H.; Deng, W.J.; Du, G.C.; Guo, Q.Q. Nematicidal phytochemicals against pine wood nematode, Bursaphelenchus xylophilus (Nematoda: Aphelenchoididae). J. Plant Dis. Prot. 2023, 130, 215–223. [Google Scholar] [CrossRef]
- Liu, G.Y.; Lin, X.; Xu, S.Y.; Liu, G.; Liu, Z.Y.; Liu, F.; Mu, W. Efficacy of fluopyram as a candidate trunk-injection agent against Bursaphelenchus xylophilus. Eur. J. Plant Pathol. 2020, 157, 403–411. [Google Scholar] [CrossRef]
- Nagano, Y.; Inaba, T.; Furuhashi, H.; Sasaki, Y. Trihelix DNA-binding protein with specificities for two distinctcis-elements. J. Biol. Chem. 2001, 276, 22238–22243. [Google Scholar] [CrossRef] [PubMed]
- Riechmann, J.L.; Heard, J.; Martin, G.; Reuber, L.; Jiang, C.; Keddie, J.; Adam, L.; Pineda, O.; Ratcliffe, O.J.; Samaha, R.R.; et al. Arabidopsis transcription factors: Genome-wide comparative analysis among eukaryotes. Science 2000, 290, 2105–2110. [Google Scholar] [CrossRef]
- Kaplan-Levy, R.N.; Brewer, P.B.; Quon, T.; Smyth, D.R. The trihelix family of transcription factors-light, stress and development. Trends Plant Sci. 2012, 17, 163–171. [Google Scholar] [CrossRef]
- Sun, W.J.; Chen, Y.; Yao, M.; Zhan, J.Y.; Chen, H.; Zhao, G.; Zou, L.; Xiang, D.B.; Wu, X.Y.; Wan, Y.; et al. Genome-wide characterization of trihelix genes reveals Cqtrihelix23 enhances the salt tolerance in quinoa (Chenopodium quinoa). Physiol. Plant. 2024, 176, e14170. [Google Scholar] [CrossRef]
- Wang, X.H.; Li, Q.T.; Chen, H.W.; Zhang, W.K.; Ma, B.; Chen, S.Y.; Zhang, J.S. Trihelix transcription factor GT-4 mediates salt tolerance via interaction with TEM2 in Arabidopsis. BMC Plant Biol. 2014, 14, 339. [Google Scholar] [CrossRef]
- Wang, L.W.; He, M.W.; Guo, S.R.; Zhong, M.; Shu, S.; Sun, J. NaCl stress induces CsSAMs gene expression in Cucumis sativus by mediating the binding of CsGT-3b to the GT-1 element within the CsSAMs promoter. Planta 2017, 245, 889–908. [Google Scholar] [CrossRef]
- Feng, C.; Song, X.; Tang, H.R. Molecular cloning and expression analysis of GT-2-like genes in strawberry. 3 Biotech. 2019, 9, 105. [Google Scholar] [CrossRef]
- Liu, X.S.; Wu, D.C.; Shan, T.F.; Xu, S.B.; Qin, R.Y.; Li, H.; Negm, M.; Wu, D.X.; Li, J. The trihelix transcription factor OsGTγ-2 is involved adaption to salt stress in rice. Plant Mol. Biol. 2020, 103, 545–560. [Google Scholar] [CrossRef] [PubMed]
- Yu, C.Y.; Song, L.L.; Song, J.W.; Ouyang, B.; Guo, L.J.; Shang, L.L.; Wang, T.T.; Li, H.X.; Zhang, J.H.; Ye, Z.B. ShCIGT, a trihelix family gene, mediates cold and drought tolerance by interacting with SnRK1 in tomato. Plant Sci. 2018, 270, 140–149. [Google Scholar] [CrossRef] [PubMed]
- Mano, N.A.; Shaikh, M.A.; Widhalm, J.R.; Yoo, C.Y.; Mickelbart, M.V. Transcriptional repression of GTL1 under water-deficit stress promotes anthocyanin biosynthesis to enhance drought tolerance. Plant Direct 2024, 8, e594. [Google Scholar] [CrossRef]
- Yoo, C.Y.; Pence, H.E.; Jin, J.B.; Miura, K.; Gosney, M.J.; Hasegawa, P.M.; Mickelbart, M.V. The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1. Plant Cell 2010, 22, 4128–4141. [Google Scholar] [CrossRef]
- Zheng, X.; Liu, H.P.; Ji, H.T.; Wang, Y.N.; Dong, B.D.; Qiao, Y.Z.; Liu, M.Y.; Li, X. The wheat GT factor TaGT2L1D negatively regulates drought tolerance and plant development. Sci. Rep. 2016, 6, 27042. [Google Scholar] [CrossRef]
- Völz, R.; Kim, S.K.; Mi, J.; Mariappan, K.G.; Guo, X.; Bigeard, J.; Alejandro, S.; Pflieger, D.; Rayapuram, N.; Al-Babili, S.; et al. The Trihelix transcription factor GT2-like 1 (GTL1) promotes salicylic acid metabolism, and regulates bacterial-triggered immunity. PLoS Genet. 2018, 14, e1007708. [Google Scholar] [CrossRef]
- Park, H.C.; Kim, M.L.; Kang, Y.H.; Jeon, J.M.; Yoo, J.H.; Kim, M.C.; Park, C.Y.; Jeong, J.C.; Moon, B.C.; Lee, J.H.; et al. Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor. Plant Physiol. 2004, 135, 2150–2161. [Google Scholar] [CrossRef]
- García-Cano, E.; Magori, S.; Sun, Q.; Ding, Z.; Lazarowitz, S.G.; Citovsky, V. Interaction of Arabidopsis Trihelix-Domain Transcription Factors VFP3 and VFP5 with Agrobacterium Virulence Protein VirF. PLoS ONE 2015, 10, e0142128. [Google Scholar] [CrossRef][Green Version]
- Tripti; Kumar, A.; Usmani, Z.; Kumar, V. Anshumali Biochar and flyash inoculated with plant growth promoting rhizobacteria act as potential biofertilizer for luxuriant growth and yield of tomato plant. J. Environ. Manag. 2017, 190, 20–27. [Google Scholar] [CrossRef] [PubMed]
- Wang, R.; Hong, G.; Han, B. Transcript abundance of rml1, encoding a putative GT1-like factor in rice, is up-regulated by Magnaporthe grisea and down-regulated by light. Gene 2004, 324, 105–115. [Google Scholar] [CrossRef]
- Zhang, Q.; Zhong, T.E.L.; Xu, M.; Dai, W.; Sun, S.; Ye, J. GT Factor ZmGT-3b Is Associated with Regulation of Photosynthesis and Defense Response to Fusarium graminearum Infection in Maize Seedling. Front. Plant Sci. 2021, 12, 724133. [Google Scholar] [CrossRef]
- Mao, H.; Zhang, W.; Lv, J.; Yang, J.; Yang, S.; Jia, B.; Song, J.; Wu, M.; Pei, W.; Ma, J.; et al. Overexpression of cotton Trihelix transcription factor GhGT-3b_A04 enhances resistance to Verticillium dahliae and affects plant growth in Arabidopsis thaliana. J. Plant Physiol. 2023, 283, 153947. [Google Scholar] [CrossRef]
- Fan, J.; Jiang, F.; Sun, H.; He, T.; Liu, Y.; Jiao, G.; Ahmad, B.; Bokhari, S.A.M.; Chen, Q.; Wen, Z. Expression Analysis of Trihelix Transcription Factor Family in Strawberries and Functional Characterization of FvTrihelix6. Horticulturae 2023, 9, 633. [Google Scholar] [CrossRef]
- Wang, T.; Wang, G.; Zhang, J.; Xuan, J. E3 Ubiquitin Ligase PUB23 in Kiwifruit Interacts with Trihelix Transcription Factor GT1 and Negatively Regulates Immune Responses against Pseudomonas syringae pv. actinidiae. Int. J. Mol. Sci. 2024, 25, 1930. [Google Scholar] [CrossRef] [PubMed]
- Ning, X.; Sun, J.; Feng, S.; Li, T.; Ren, Z.; Li, R. Genome Identification and Disease resistant Expression Pattern Analysis of Trihelix Family of Betula platyphylla. Acta Bot. Boreal.-Occident. Sin. 2022, 42, 920–929. [Google Scholar]
- Wang, Z.; Liu, Q.; Wang, H.; Zhang, H.; Xu, X.; Li, C.; Yang, C. Comprehensive analysis of trihelix genes and their expression under biotic and abiotic stresses in Populus trichocarpa. Sci. Rep. 2016, 6, 36274. [Google Scholar] [CrossRef]
- Tan, L.; Rasool, A.; Almutairy, L.A.; Azeem, F.; Jehan, I.; Masroor, A.; Attia, K.A.; Fiaz, S.; Shah, A.A. Trihelix transcription factors are involved in drought stress response of Mangifera indica. Mol. Biol. Rep. 2025, 52, 776. [Google Scholar] [CrossRef]
- Wang, J.; Ouyang, Y.W.; Wei, Y.Z.; Kou, J.J.; Zhang, X.H.; Zhang, H.N. Identification and characterization of trihelix transcription factors and expression changes during flower development in Pineapple. Horticulturae 2022, 8, 894. [Google Scholar] [CrossRef]
- Li, J.M.; Zhang, M.H.; Sun, J.; Mao, X.R.; Wang, J.; Wang, J.G.; Liu, H.L.; Zheng, H.L.; Zhen, Z.; Zhao, H.W.; et al. Genome-wide characterization and identification of trihelix transcription factor and expression profiling in response to abiotic stresses in rice (Oryza sativa L.). Int. J. Mol. Sci. 2019, 20, 251. [Google Scholar] [CrossRef]
- Fang, Y.J.; Xie, K.B.; Hou, X.; Hu, H.H.; Xiong, L.Z. Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. Mol. Genet. Genom. 2010, 283, 157–169. [Google Scholar] [CrossRef]
- Morffy, N.; Van den Broeck, L.; Miller, C.; Emenecker, R.J.; Bryant, J.A., Jr.; Lee, T.M.; Sageman-Furnas, K.; Wilkinson, E.G.; Pathak, S.; Kotha, S.R.; et al. Identification of plant transcriptional activation domains. Nature 2024, 632, 166–173. [Google Scholar] [CrossRef]
- Ding, L.N.; Li, Y.T.; Wu, Y.Z.; Li, T.; Geng, R.; Cao, J.; Zhang, W.; Tan, X.L. Plant Disease Resistance-Related Signaling Pathways: Recent Progress and Future Prospects. Int. J. Mol. Sci. 2022, 23, 16200. [Google Scholar] [CrossRef]
- Yadav, V.; Zhang, F.C.; Wang, H.; Zhang, C.; Zhang, S.L.; Zhang, J.; Xu, N.; Zhou, X.M.; Zhong, H.X.; Wu, X.Y. Identification of trihelix transcription factors in grapevine and expression dynamics in response to biotic stress and hormone treatment. Physiol. Mol. Plant Pathol. 2025, 137, 102628. [Google Scholar] [CrossRef]
- Chen, C.Y.; Ding, W.B.; Zhang, H.J.; Qi, Y.R.; Wang, W.X. Genome-Wide Identification and Characterization of the trihelix transcription factor family in Polygonatum kingianum and gene expression pattern analysis under meja treatment. Plant Mol. Biol. Rep. 2025, 43, 2382–2393. [Google Scholar] [CrossRef]
- Xi, J.; Qiu, Y.J.; Du, L.Q.; Poovaiah, B.W. Plant-specific trihelix transcription factor AtGT2L interacts with calcium/calmodulin and responds to cold and salt stresses. Plant Sci. 2012, 185, 274–280. [Google Scholar] [CrossRef] [PubMed]
- Lou, X.; Yao, S.; Chen, P.Z.; Wang, D.B.; Agassin, R.H.; Hou, Y.Q.; Zhang, C.; Ji, K.S. Transcriptome identification of R2R3-MYB gene family members in Pinus massoniana and PmMYB4 response to drought stress. Forests 2023, 14, 410. [Google Scholar] [CrossRef]
- Wang, D.B.; Qiu, Z.M.; Xu, T.; Yao, S.; Chen, M.J.; Li, Q.Z.; Agassin, R.H.; Ji, K.S. Transcriptomic identification of potential C2H2 zinc finger protein transcription factors in Pinus massoniana in response to biotic and abiotic stresses. Int. J. Mol. Sci. 2024, 25, 8361. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Zhu, P.H.; Wu, F.; Wang, X.F.; Zhang, J.F.; Ji, K.S. Identification and Characterization of the basic helix-loop-helix transcription factor family in Pinus massoniana. Forests 2020, 11, 1292. [Google Scholar] [CrossRef]
- Wang, D.B.; Yao, S.; Agassin, R.H.; Zhang, M.Y.; Lou, X.; Huang, Z.C.; Zhang, J.F.; Ji, K.S. Transcriptome-Wide identification of CCCH-type zinc finger proteins family in Pinus massoniana and RR-TZF proteins in stress response. Genes 2022, 13, 1639. [Google Scholar] [CrossRef] [PubMed]
- Chen, H.; Qin, X.H.; Chen, Y.H.; Zhang, H.Y.; Feng, Y.H.; Tan, J.H.; Chen, X.H.; Hu, L.; Xie, J.K.; Xie, J.B.; et al. Chromosome-level genome assembly of Pinus massoniana provides insights into conifer adaptive evolution. GigaScience 2025, 14, giaf056. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.Y.; Wu, Y.; Li, J.W.; Wang, X.; Zeng, Z.H.; Xu, J.; Liu, Y.L.; Feng, J.T.; Chen, H.; He, Y.H.; et al. TBtools-II: A “one for all, all for one” bioinformatics platform for biological big-data mining. Mol. Plant. 2023, 16, 1733–1742. [Google Scholar] [CrossRef]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; Van de Peer, Y.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef] [PubMed]










| Trihelix Subfamily | N-Terminal Trihelix Domain | 4th Alpha Helix Domain | Central Alpha Helix Domain | C-Terminal Long α-Helical Domain | Third Amino Acid Residue |
|---|---|---|---|---|---|
| GT-1 | 1 | 1 | 0 | 1 | Trp |
| GT-2 | 2 | 2 | 1 | 0 | C-terminal Trp; N-terminal Phe |
| SH4 | 1 | 0 | 0 | 1 | Trp |
| GTγ | 1 | 1 | 0 | 1 | Phe |
| SIP1 | 1 | 1 | 0 | 1 | Ile |
| Motif | Length | Motif Consensus | Motif Logo |
|---|---|---|---|
| Motif 1 | 21 | AKQCKDKWENLKKRYKKEKDG | ![]() |
| Motif 2 | 41 | ETLALJKIRAEMDSRFRDSKRKKTLWEEISRKLAEKGYRRS | ![]() |
| Motif 3 | 34 | QARLEREDZLRAQERALAASRDAAFIALLQKLTG | ![]() |
| Motif 4 | 50 | DPNSKRWPKPEVLALIRLRSEMEPRFQESGPKGPLWEEISAAMAALGYSR | ![]() |
| Motif 5 | 50 | TADKKMANFFEELLKQFMZQQERMZQKFLEAIEKREQERMJREEAWKRQE | ![]() |
| Motif 6 | 15 | SSKWPFFKELDEJLR | ![]() |
| Motif 7 | 21 | NRGNLKKKDWEEVAKAVNARC | ![]() |
| Motif 8 | 21 | RDEWSETAVDTLLDAYEEKCL | ![]() |
| Motif 9 | 29 | NPVRELADAJRSFAEVYERIENAKMEMFK | ![]() |
| Motif 10 | 50 | NNKMIISNLKMAEEGRMKRHEKYCNLFERRMEMDEKYLNHHAMNVQRMIN | ![]() |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Liu, P.; Wang, D.; Xu, S.; Sun, S.; Yang, M.; Chen, M.; Ji, K. Genome-Wide Identification and Characterization of the Trihelix Transcription Factor Family in Pinus massoniana and Gene Expression Patterns Analysis. Plants 2025, 14, 3635. https://doi.org/10.3390/plants14233635
Liu P, Wang D, Xu S, Sun S, Yang M, Chen M, Ji K. Genome-Wide Identification and Characterization of the Trihelix Transcription Factor Family in Pinus massoniana and Gene Expression Patterns Analysis. Plants. 2025; 14(23):3635. https://doi.org/10.3390/plants14233635
Chicago/Turabian StyleLiu, Pengzhou, Dengbao Wang, Shaojun Xu, Shuo Sun, Manli Yang, Meijing Chen, and Kongshu Ji. 2025. "Genome-Wide Identification and Characterization of the Trihelix Transcription Factor Family in Pinus massoniana and Gene Expression Patterns Analysis" Plants 14, no. 23: 3635. https://doi.org/10.3390/plants14233635
APA StyleLiu, P., Wang, D., Xu, S., Sun, S., Yang, M., Chen, M., & Ji, K. (2025). Genome-Wide Identification and Characterization of the Trihelix Transcription Factor Family in Pinus massoniana and Gene Expression Patterns Analysis. Plants, 14(23), 3635. https://doi.org/10.3390/plants14233635











