Advances of Peptides for Plant Immunity
Abstract
1. Introduction
2. Classification of Plant Peptides Related to Disease Resistance
2.1. Small Post-Translationally Modified Peptides
2.1.1. CLE Peptides
2.1.2. CEP Peptides
| Peptide Family | Peptide Name | Organism Species | Functions | References |
|---|---|---|---|---|
| Small post-translationally modified peptides | CLE14 | Arabidopsis thaliana | Suppresses leaf senescence via JUB1-mediated ROS scavenging | [16] |
| CLE42 | Arabidopsis thaliana | Delays leaf senescence by antagonizing ethylene pathway | [17] | |
| CLE2 | Tomato | Inhibits mycorrhizal colonization | [20] | |
| CLE41/44 | Arabidopsis thaliana | Induced by nematodes; inhibits root meristem growth via BAM1 receptors | [22,25,27] | |
| AtCEP5 | Arabidopsis thaliana | Enhances susceptibility to C. tropicale and P. syringae | [25] | |
| AtCEP14 | Arabidopsis thaliana | Boosts P. syringae resistance when overexpressed; activates immunity as synthetic peptide | [26] | |
| AtCEP1/AtCEP4 | Arabidopsis thaliana | Triggers immune responses | [27] | |
| PSK | A. thaliana, tomato, rice, cotton | Suppresses bacterial immunity; enhances necrotroph resistance; interacts with phytohormones | [29,30,31,32] | |
| AtIDA | Arabidopsis thaliana | Induces Ca2+ release, ROS burst, and defense responses; enhances long-term resistance via cellulose biosynthesis | [33,34] | |
| AtIDL6/AtIDL7 | Arabidopsis thaliana | Induced by P. syringae; attenuates stress-induced ROS; promotes pathogen susceptibility | [35,36] | |
| Cysteine-rich peptides | RALF1 | Arabidopsis thaliana | Regulates cell expansion and defense via FER receptor; modulated during pathogen infection | [37,38,39] |
| EPF/EPFL | Maize | Negative regulators of fungal penetration | [40,41] | |
| Snakin-1 | Potato, rice | Boosts resistance to Rhizoctonia solani and X. oryzae | [42,43] | |
| Plant defensins | Arabidopsis thaliana | Broad-spectrum antimicrobial activities against bacteria, fungi | [44] | |
| Non-cysteine-rich/non-PTM peptides | Systemin | Tomato, potato, tobacco | Activates JA biosynthesis and defense genes via SR160 receptor | [6,45,46,47] |
| AtPep1 | Arabidopsis thaliana | Acts as DAMP to induce immunity against Pythium irregulare | [48] | |
| OsPep3 | Rice | Confers resistance to planthopper, rice blast, and bacterial blight | [49] | |
| Other small plant peptides | ZIP1 | Maize | Induces SA accumulation; promotes Botrytis cinerea infection | [50] |
| SCREWs | Arabidopsis thaliana | Regulates stomatal closure to control pathogen entry | [51] | |
| PSY1 | Arabidopsis thaliana | Enhances necrotroph resistance; dual role in growth/defense | [52] | |
| IRP | Rice | Promotes PAL1 expression to regulate defense genes | [14] | |
| PIP1 | Arabidopsis thaliana | Amplifies PTI immunity via RLK7 interaction | [53] | |
| SCOOP12 | Arabidopsis thaliana | Bolsters immunity via MIK2 receptor interaction | [54] | |
| nsLTP | Tobacco, tomato | Enhances resistance against Phytophthora capsici | [55,56,57] |
| Peptide Family | Peptide Name | Amino Acid Sequence | 3D Structure Main Characteristics |
|---|---|---|---|
| Small post-translationally modified peptides | CLE(CLV3) | RLVPSGP * NPLHN (conserved motif: xRxcPsGpDPIHHh) | arch shape (helical arabinose chain) |
| At-CEP | DFRPTNPGNSPGVGH | β-turn-like conformation | |
| At-PSK | YIYTQ | not determined | |
| At-IDL | FGYLPKGVPIPPSAPSKRHN | not determined | |
| Cysteine-rich peptides | RALF | ATRRYISYGALRRNTIPCSRRGASYYNÇRRGAQANPYSRGCSAITRCRRS | not determined |
| EPF(L) | IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR | two antiparallel β-sheets, loop | |
| PEP1 | ATKVKAKQRGKEKVSSGRPGQHN | fully extended conformation | |
| St-Snakin-1 | GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHEÇPÇYRDKKNSKGKSKCP | two predicted longa-helices | |
| At-PDF1.2 | QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC | α-helix, three β-sheets | |
| Non-cysteine-rich/non-PTM peptides | AMP1 | QWGRRCCGWGPGRRYCVRWC | loop structure |
| SYS | AVQSKPPSKRDPPKMQTD | polyproline helix | |
| Other small plant peptides | At-PSY1 | DYGDPSANPKHDPGVP * PS | not determined |
| At-PIP | LASGSSRRGRRH | not determined | |
| At-SCOOP12 | PVRSSQSSQAGGR | not determined | |
| Os-nsLTP | AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH | four α-helices |
2.1.3. PSK Peptides
2.1.4. IDA/IDL Peptides
2.2. Cysteine-Rich Peptides
2.2.1. RALF Peptides
2.2.2. EPF/EPFL Peptides
2.2.3. Antimicrobial Peptides (AMPs)
2.3. Non-Cysteine-Rich/Non-PTM Peptides
2.3.1. Systemin
2.3.2. Plant Elicitor Peptides
2.4. Other Small Peptides for Plant Immunity
3. Mechanisms of Plant Peptides in Disease Resistance
3.1. Direct Antimicrobial Effects
3.2. Activation of Plant Immune Responses
3.3. Peptides Interact with Defensive Signaling Pathways
3.4. Differences Between Plant Immunopeptides and Other Peptides
4. Applications of Plant Peptides in Disease Resistance
5. Conclusions and Perspectives
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Pieterse, C.M.; Van der Does, D.; Zamioudis, C.; Leon-Reyes, A.; Van Wees, S.C. Hormonal modulation of plant immunity. Annu. Rev. Cell Dev. Biol. 2012, 28, 489–521. [Google Scholar] [CrossRef]
- Yuan, M.; Ngou, B.P.M.; Ding, P.; Xin, X.F. PTI-ETI crosstalk: An integrative view of plant immunity. Curr. Opin. Plant Biol. 2021, 62, 102030. [Google Scholar] [CrossRef]
- Igarashi, D.; Tsuda, K.; Katagiri, F. The peptide growth factor, phytosulfokine, attenuates pattern-triggered immunity. Plant J. 2012, 71, 194–204. [Google Scholar] [CrossRef]
- Zhang, P.; Zhao, J.; Zhang, W.; Guo, Y.; Zhang, K. Sulfated peptides: Key players in plant development, growth, and stress responses. Front. Plant Sci. 2024, 15, 1474111. [Google Scholar] [CrossRef]
- Kumar, S.; Behera, L.; Kumari, R.; Bag, D.; Sowmya, V.; Keswani, C.; Minkina, T.; Bouket, A.C.; Dutta, P.; Nehela, Y.; et al. Unraveling the role of antimicrobial peptides in plant resistance against phytopathogens. Discov. Sustain. 2024, 5, 243. [Google Scholar] [CrossRef]
- Pearce, G.; Strydom, D.; Johnson, S.; Ryan, C.A. A polypeptide from tomato leaves induces wound-inducible proteinase inhibitor proteins. Science 1991, 253, 895–897. [Google Scholar] [CrossRef]
- Czyzewicz, N.; Yue, K.; Beeckman, T.; De Smet, I. Message in a bottle: Small signalling peptide outputs during growth and development. J. Exp. Bot. 2013, 64, 5281–5296. [Google Scholar] [CrossRef]
- Reichardt, S.; Piepho, H.P.; Stintzi, A.; Schaller, A. Peptide signaling for drought-induced tomato flower drop. Science 2020, 367, 1482–1485. [Google Scholar] [CrossRef]
- Meng, L.; Buchanan, B.B.; Feldman, L.J.; Luan, S. A putative nuclear CLE-like (De-La-Peña, #447) peptide precursor regulates root growth in Arabidopsis. Mol. Plant 2012, 5, 955–957. [Google Scholar] [CrossRef][Green Version]
- Schardon, K.; Hohl, M.; Graff, L.; Pfannstiel, J.; Schulze, W.; Stintzi, A.; Schaller, A. Precursor processing for plant peptide hormone maturation by subtilisin-like serine proteinases. Science 2016, 354, 1594–1597. [Google Scholar] [CrossRef]
- Tavormina, P.; De Coninck, B.; Nikonorova, N.; De Smet, I.; Cammue, B.P.A. The Plant Peptidome: An Expanding Repertoire of Structural Features and Biological Functions. Plant Cell 2015, 27, 2095–2118. [Google Scholar] [CrossRef]
- Matsubayashi, Y.; Sakagami, Y. Peptide hormones in plants. Annu. Rev. Plant Biol. 2006, 57, 649–674. [Google Scholar] [CrossRef]
- Pieterse, C.M.; Leon-Reyes, A.; Van der Ent, S.; Van Wees, S.C. Networking by small-molecule hormones in plant immunity. Nat. Chem. Biol. 2009, 5, 308–316. [Google Scholar] [CrossRef]
- Wang, P.; Yao, S.; Kosami, K.i.; Guo, T.; Li, J.; Zhang, Y.; Fukao, Y.; Kaneko-Kawano, T.; Zhang, H.; She, Y.M.; et al. Identification of endogenous small peptides involved in rice immunity through transcriptomics- and proteomics-based screening. Plant Biotechnol. J. 2019, 18, 415–428. [Google Scholar] [CrossRef]
- Betsuyaku, S.; Sawa, S.; Yamada, M. The Function of the CLE Peptides in Plant Development and Plant-Microbe Interactions. Arab. Book. 2011, 9, e0149. [Google Scholar] [CrossRef]
- Zhang, Z.; Liu, C.; Li, K.; Li, X.; Xu, M.; Guo, Y. CLE14 functions as a “brake signal” to suppress age-dependent and stress-induced leaf senescence by promoting JUB1-mediated ROS scavenging in Arabidopsis. Mol. Plant 2022, 15, 179–188. [Google Scholar] [CrossRef]
- Zhang, Y.; Tan, S.; Gao, Y.; Kan, C.; Wang, H.-L.; Yang, Q.; Xia, X.; Ishida, T.; Sawa, S.; Guo, H.; et al. CLE42 delays leaf senescence by antagonizing ethylene pathway in Arabidopsis. New Phytol. 2022, 235, 550–562. [Google Scholar] [CrossRef]
- Hou, S.; Liu, D.; Huang, S.; Luo, D.; Liu, Z.; Xiang, Q.; Wang, P.; Mu, R.; Han, Z.; Chen, S.; et al. The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes. Nat. Commun. 2021, 12, 5494. [Google Scholar] [CrossRef]
- Najafi, J.; Brembu, T.; Vie, A.K.; Viste, R.; Winge, P.; Somssich, I.E.; Bones, A.M. PAMP-INDUCED SECRETED PEPTIDE 3 modulates immunity in Arabidopsis. J. Exp. Bot. 2020, 71, 850–864. [Google Scholar] [CrossRef]
- Wulf, K.; Sun, J.; Wang, C.; Ho-Plagaro, T.; Kwon, C.-T.; Velandia, K.; Correa-Lozano, A.; Tamayo-Navarrete, M.I.; Reid, J.B.; García Garrido, J.M.; et al. The Role of CLE Peptides in the Suppression of Mycorrhizal Colonization of Tomato. Plant Cell Physiol. 2024, 65, 107–119. [Google Scholar] [CrossRef]
- Wang, J.; Lee, C.; Replogle, A.; Joshi, S.; Korkin, D.; Hussey, R.; Baum, T.J.; Davis, E.L.; Wang, X.; Mitchum, M.G. Dual roles for the variable domain in protein trafficking and host-specific recognition of Heterodera glycines CLE effector proteins. New Phytol. 2010, 187, 1003–1017. [Google Scholar] [CrossRef]
- Lu, S.-W.; Chen, S.; Wang, J.; Yu, H.; Chronis, D.; Mitchum, M.G.; Wang, X. Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis. Mol. Plant-Microbe Interact. 2009, 22, 1128–1142. [Google Scholar] [CrossRef][Green Version]
- Ogilvie, H.A.; Imin, N.; Djordjevic, M.A. Diversification of the C-TERMINALLY ENCODED PEPTIDE (CEP) gene family in angiosperms, and evolution of plant-family specific CEP genes. BMC Genom. 2014, 15, 870. [Google Scholar] [CrossRef]
- Taleski, M.; Jin, M.; Chapman, K.; Taylor, K.; Winning, C.; Frank, M.; Imin, N.; Djordjevic, M.A. CEP hormones at the nexus of nutrient acquisition and allocation, root development, and plant–microbe interactions. J. Exp. Bot. 2023, 75, 538–552. [Google Scholar] [CrossRef]
- Fitrianti, A.N.; Mai, T.L.; Phuong, L.T.; Monden, H.; Shiiba, N.; Matsui, H.; Noutoshi, Y.; Yamamoto, M.; Ichinose, Y.; Shiraishi, T.; et al. CEP peptide induces susceptibility of Arabidopsis thaliana to non-adapted pathogens. J. Gen. Plant Pathol. 2022, 88, 287–292. [Google Scholar] [CrossRef]
- Wang, X.; Yu, W.; Yuan, Q.; Chen, X.; He, Y.; Zhou, J.; Xun, Q.; Wang, G.; Li, J.; Meng, X. The pathogen-induced peptide CEP14 is perceived by the receptor-like kinase CEPR2 to promote systemic disease resistance in Arabidopsis. Plant Physiol. 2024, 197, kiae549. [Google Scholar] [CrossRef]
- Rzemieniewski, J.; Leicher, H.; Lee, H.K.; Broyart, C.; Nayem, S.; Wiese, C.; Maroschek, J.; Camgöz, Z.; Olsson Lalun, V.; Djordjevic, M.A.; et al. CEP signaling coordinates plant immunity with nitrogen status. Nat. Commun. 2024, 15, 10686. [Google Scholar] [CrossRef]
- Bucataru, C.; Ciobanasu, C. Antimicrobial peptides: Opportunities and challenges in overcoming resistance. Microbiol. Res. 2024, 286, 127822. [Google Scholar] [CrossRef]
- Mosher, S.; Seybold, H.; Rodriguez, P.; Stahl, M.; Davies, K.A.; Dayaratne, S.; Morillo, S.A.; Wierzba, M.; Favery, B.; Keller, H.; et al. The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner. Plant J. 2013, 73, 469–482. [Google Scholar] [CrossRef]
- Ding, S.; Lv, J.; Hu, Z.; Wang, J.; Wang, P.; Yu, J.; Foyer, C.H.; Shi, K. Phytosulfokine peptide optimizes plant growth and defense via glutamine synthetase GS2 phosphorylation in tomato. EMBO J. 2023, 42, e111858. [Google Scholar] [CrossRef]
- Guo, H.; Nolan, T.M.; Song, G.; Liu, S.; Xie, Z.; Chen, J.; Schnable, P.S.; Walley, J.W.; Yin, Y. FERONIA Receptor Kinase Contributes to Plant Immunity by Suppressing Jasmonic Acid Signaling in Arabidopsis thaliana. Curr. Biol. 2018, 28, 3316–3324.e6. [Google Scholar] [CrossRef]
- Yang, W.; Zhang, B.; Qi, G.; Shang, L.; Liu, H.; Ding, X.; Chu, Z. Identification of the phytosulfokine receptor 1 (OsPSKR1) confers resistance to bacterial leaf streak in rice. Planta 2019, 250, 1603–1612. [Google Scholar] [CrossRef]
- Lalun, V.O.; Breiden, M.; Galindo-Trigo, S.; Smakowska-Luzan, E.; Simon, R.G.W.; Butenko, M.A. A dual function of the IDA peptide in regulating cell separation and modulating plant immunity at the molecular level. eLife 2024, 12, RP87912. [Google Scholar] [CrossRef]
- Butenko, M.A.; Patterson, S.E.; Grini, P.E.; Stenvik, G.-E.; Amundsen, S.S.; Mandal, A.; Aalen, R.B. INFLORESCENCE DEFICIENT IN ABSCISSION Controls Floral Organ Abscission in Arabidopsis and Identifies a Novel Family of Putative Ligands in Plants. Plant Cell 2003, 15, 2296–2307. [Google Scholar] [CrossRef]
- Vie, A.K.; Najafi, J.; Liu, B.; Winge, P.; Butenko, M.A.; Hornslien, K.S.; Kumpf, R.; Aalen, R.B.; Bones, A.M.; Brembu, T. The IDA/IDA-LIKE and PIP/PIP-LIKE gene families in Arabidopsis: Phylogenetic relationship, expression patterns, and transcriptional effect of the PIPL3 peptide. J. Exp. Bot. 2015, 66, 5351–5365. [Google Scholar] [CrossRef]
- Wang, X.; Hou, S.; Wu, Q.; Lin, M.; Acharya, B.R.; Wu, D.; Zhang, W. IDL6-HAE/HSL2 impacts pectin degradation and resistance to Pseudomonas syringae pv tomato DC3000 in Arabidopsis leaves. Plant J. 2017, 89, 250–263. [Google Scholar] [CrossRef]
- Pearce, G.; Moura, D.S.; Stratmann, J.; Ryan, C.A., Jr. RALF, a 5-kDa ubiquitous polypeptide in plants, arrests root growth and development. Proc. Natl. Acad. Sci. USA 2001, 98, 12843–12847. [Google Scholar] [CrossRef]
- Zhang, X.; Peng, H.; Zhu, S.; Xing, J.; Li, X.; Zhu, Z.; Zheng, J.; Wang, L.; Wang, B.; Chen, J.; et al. Nematode-Encoded RALF Peptide Mimics Facilitate Parasitism of Plants through the FERONIA Receptor Kinase. Mol. Plant 2020, 13, 1434–1454. [Google Scholar] [CrossRef]
- Zhang, X.; Yang, Z.; Wu, D.; Yu, F. RALF-FERONIA Signaling: Linking Plant Immune Response with Cell Growth. Plant Commun. 2020, 1, 100084. [Google Scholar] [CrossRef]
- Liu, R.; Xu, K.; Li, Y.; Zhao, W.; Ji, H.; Lei, X.; Ma, T.; Ye, J.; Zhang, J.; Du, H.; et al. Investigation on the Potential Functions of ZmEPF/EPFL Family Members in Response to Abiotic Stress in Maize. Int. J. Mol. Sci. 2024, 25, 7196. [Google Scholar] [CrossRef]
- Xia, H.; Wang, Q.; Chen, Z.; Sun, X.; Zhao, F.; Zhang, D.; Fei, J.; Zhao, R.; Yin, Y. Identification and Functional Analysis of the EPF/EPFL Gene Family in Maize (Zea mays L.): Implications for Drought Stress Response. Agronomy 2024, 14, 1734. [Google Scholar]
- Almasia, N.I.; Nahirñak, V.; Hopp, H.E.; Vazquez-Rovere, C. Potato Snakin-1: An antimicrobial player of the trade-off between host defense and development. Plant Cell Rep. 2020, 39, 839–849. [Google Scholar] [CrossRef]
- Das, K.; Datta, K.; Sarkar, S.N.; Datta, S.K. Expression of antimicrobial peptide snakin-1 confers effective protection in rice against sheath blight pathogen, Rhizoctonia solani. Plant Biotechnol. Rep. 2021, 15, 39–54. [Google Scholar] [CrossRef]
- Hsiao, P.-Y.; Cheng, C.-P.; Koh, K.W.; Chan, M.-T. The Arabidopsis defensin gene, AtPDF1.1, mediates defence against Pectobacterium carotovorum subsp. carotovorum via an iron-withholding defence system. Sci. Rep. 2017, 7, 9175. [Google Scholar] [CrossRef]
- Ryan, C.A. The systemin signaling pathway: Differential activation of plant defensive genes. Biochim. Biophys. Acta 2000, 1477, 112–121. [Google Scholar] [CrossRef]
- Bhattacharya, R.; Koramutla, M.K.; Negi, M.; Pearce, G.; Ryan, C.A. Hydroxyproline-rich glycopeptide signals in potato elicit signalling associated with defense against insects and pathogens. Plant Sci. 2013, 207, 88–97. [Google Scholar] [CrossRef]
- Pearce, G. Systemin, hydroxyproline-rich systemin and the induction of protease inhibitors. Curr. Protein Pept. Sci. 2011, 12, 399–408. [Google Scholar] [CrossRef]
- Huffaker, A.; Pearce, G.; Ryan, C.A. An endogenous peptide signal in Arabidopsis activates components of the innate immune response. Proc. Natl. Acad. Sci. USA 2006, 103, 10098–10103. [Google Scholar] [CrossRef]
- Shen, W.; Zhang, X.; Liu, J.; Tao, K.; Li, C.; Xiao, S.; Zhang, W.; Li, J.-F. Plant elicitor peptide signalling confers rice resistance to piercing-sucking insect herbivores and pathogens. Plant Biotechnol. J. 2022, 20, 991–1005. [Google Scholar] [CrossRef]
- Ziemann, S.; van der Linde, K.; Lahrmann, U.; Acar, B.; Kaschani, F.; Colby, T.; Kaiser, M.; Ding, Y.; Schmelz, E.; Huffaker, A.; et al. An apoplastic peptide activates salicylic acid signalling in maize. Nat. Plants 2018, 4, 172–180. [Google Scholar] [CrossRef]
- Liu, Z.; Hou, S.; Rodrigues, O.; Wang, P.; Luo, D.; Munemasa, S.; Lei, J.; Liu, J.; Ortiz-Morea, F.A.; Wang, X.; et al. Phytocytokine signalling reopens stomata in plant immunity and water loss. Nature 2022, 605, 332–339. [Google Scholar] [CrossRef]
- Ogawa-Ohnishi, M.; Yamashita, T.; Kakita, M.; Nakayama, T.; Ohkubo, Y.; Hayashi, Y.; Yamashita, Y.; Nomura, T.; Noda, S.; Shinohara, H.; et al. Peptide ligand-mediated trade-off between plant growth and stress response. Science 2022, 378, 175–180. [Google Scholar] [CrossRef]
- Hou, S.; Wang, X.; Chen, D.; Yang, X.; Wang, M.; Turrà, D.; Di Pietro, A.; Zhang, W. The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7. PLoS Pathog. 2014, 10, e1004331. [Google Scholar] [CrossRef]
- Gully, K.; Pelletier, S.; Guillou, M.-C.; Ferrand, M.; Aligon, S.; Pokotylo, I.; Perrin, A.; Vergne, E.; Fagard, M.; Ruelland, E.; et al. The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana. J. Exp. Bot. 2019, 70, 1349–1365. [Google Scholar] [CrossRef]
- Liu, W.; Zhang, G.; Liu, C.; Tian, S.; Qiao, G.; Sun, H.; Luo, X.; Wang, S.; Cai, L.; Sun, X. NbTLP1 stabilizes NbPR1 to enhance resistance against Phytophthora capsici via salicylic acid signalling pathway in Nicotiana benthamiana. Plant Biotechnol. J. 2025. [Google Scholar] [CrossRef]
- Wang, J.; Xiang, S.; Wang, X.; Shen, Y.; Liu, C.; Zhu, X.; Liu, W.; Wang, S.; Ma, X.; Huang, J.; et al. High-permeability cellulose nanocrystals mediate systemic zinc redistribution through nsLTP2-dependent immune potentiation in plants. Plant Biotechnol. J. 2025. [Google Scholar] [CrossRef]
- Panda, S.; Singh, N.C.; Sonawane, P.D.; Meir, S.; Kamble, A.C. Jasmonate Responsive SlnsLTP Confers Resistance Against Botrytis cinerea and Verticillium dahliae in Tomato. J. Plant Growth Regul. 2025. [Google Scholar] [CrossRef]
- Matsubayashi, Y.; Hanai, H.; Hara, O.; Sakagami, Y. Active fragments and analogs of the plant growth factor, phytosulfokine: Structure-activity relationships. Biochem. Biophys. Res. Commun. 1996, 225, 209–214. [Google Scholar] [CrossRef]
- Lorbiecke, R.; Sauter, M. Comparative analysis of PSK peptide growth factor precursor homologs. Plant Sci. 2002, 163, 321–332. [Google Scholar] [CrossRef]
- Zhang, H.; Hu, Z.; Lei, C.; Zheng, C.; Wang, J.; Shao, S.; Li, X.; Xia, X.; Cai, X.; Zhou, J.; et al. A Plant Phytosulfokine Peptide Initiates Auxin-Dependent Immunity through Cytosolic Ca(2+) Signaling in Tomato. Plant Cell 2018, 30, 652–667. [Google Scholar] [CrossRef]
- Hu, Z.; Fang, H.; Zhu, C.; Gu, S.; Ding, S.; Yu, J.; Shi, K. Ubiquitylation of PHYTOSULFOKINE RECEPTOR 1 modulates the defense response in tomato. Plant Physiol. 2023, 192, 2507–2522. [Google Scholar] [CrossRef]
- Zhang, L.; Liu, J.; Cheng, J.; Sun, Q.; Zhang, Y.; Liu, J.; Li, H.; Zhang, Z.; Wang, P.; Cai, C.; et al. lncRNA7 and lncRNA2 modulate cell wall defense genes to regulate cotton resistance to Verticillium wilt. Plant Physiol. 2022, 189, 264–284. [Google Scholar] [CrossRef]
- Stenvik, G.-E.; Tandstad, N.M.; Guo, Y.; Shi, C.-L.; Kristiansen, W.; Holmgren, A.; Clark, S.E.; Aalen, R.B.; Butenko, M.A. The EPIP Peptide of INFLORESCENCE DEFICIENT IN ABSCISSION Is Sufficient to Induce Abscission in Arabidopsis through the Receptor-Like Kinases HAESA and HAESA-LIKE2. Plant Cell 2008, 20, 1805–1817. [Google Scholar] [CrossRef]
- Wang, P.; Wu, T.; Jiang, C.; Huang, B.; Li, Z. Brt9SIDA/IDALs as peptide signals mediate diverse biological pathways in plants. Plant Sci. 2023, 330, 111642. [Google Scholar] [CrossRef]
- Santiago, J.; Brandt, B.; Wildhagen, M.; Hohmann, U.; Hothorn, L.A.; Butenko, M.A.; Hothorn, M. Mechanistic insight into a peptide hormone signaling complex mediating floral organ abscission. eLife 2016, 5, e15075. [Google Scholar] [CrossRef]
- Roman, A.-O.; Jimenez-Sandoval, P.; Augustin, S.; Broyart, C.; Hothorn, L.A.; Santiago, J. HSL1 and BAM1/2 impact epidermal cell development by sensing distinct signaling peptides. Nat. Commun. 2022, 13, 876. [Google Scholar] [CrossRef]
- Vie, A.K.; Najafi, J.; Winge, P.; Cattan, E.; Wrzaczek, M.; Kangasjärvi, J.; Miller, G.; Brembu, T.; Bones, A.M. The IDA-LIKE peptides IDL6 and IDL7 are negative modulators of stress responses in Arabidopsis thaliana. J. Exp. Bot. 2017, 68, 3557–3571. [Google Scholar] [CrossRef]
- de Bang, T.C.; Lundquist, P.K.; Dai, X.; Boschiero, C.; Zhuang, Z.; Pant, P.; Torres-Jerez, I.; Roy, S.; Nogales, J.; Veerappan, V.; et al. Genome-Wide Identification of Medicago Peptides Involved in Macronutrient Responses and Nodulation. Plant Physiol. 2017, 175, 1669–1689. [Google Scholar] [CrossRef]
- Chen, J.; Yu, F.; Liu, Y.; Du, C.; Li, X.; Zhu, S.; Wang, X.; Lan, W.; Rodriguez, P.L.; Liu, X.; et al. FERONIA interacts with ABI2-type phosphatases to facilitate signaling cross-talk between abscisic acid and RALF peptide in Arabidopsis. Proc. Natl. Acad. Sci. USA 2016, 113, E5519–E5527. [Google Scholar] [CrossRef]
- He, Y.-H.; Chen, S.-Y.; Chen, X.-Y.; Xu, Y.-P.; Liang, Y.; Cai, X.-Z. RALF22 promotes plant immunity and amplifies the Pep3 immune signal. J. Integr. Plant Biol. 2023, 65, 2519–2534. [Google Scholar] [CrossRef]
- Shen, W.; Yuan, M.; Chen, L.; Zhang, X. Comparative analysis of rapid alkalinization factor peptide-triggered plant immunity in citrus and closely related species. Plant Physiol. Biochem. 2025, 224, 109941. [Google Scholar] [CrossRef]
- Yang, Z.; Xing, J.; Wang, L.; Liu, Y.; Qu, J.; Tan, Y.; Fu, X.; Lin, Q.; Deng, H.; Yu, F. Mutations of two FERONIA-like receptor genes enhance rice blast resistance without growth penalty. J. Exp. Bot. 2020, 71, 2112–2126. [Google Scholar] [CrossRef]
- Thynne, E.; Saur, I.M.L.; Simbaqueba, J.; Ogilvie, H.A.; Gonzalez-Cendales, Y.; Mead, O.; Taranto, A.; Catanzariti, A.M.; McDonald, M.C.; Schwessinger, B.; et al. Fungal phytopathogens encode functional homologues of plant rapid alkalinization factor (RALF) peptides. Mol. Plant Pathol. 2017, 18, 811–824. [Google Scholar] [CrossRef]
- Zhang, X.; Long, H.; Zhang, J.; Shen, B.; Hou, Y. Damage Assessment and Progressive Collapse Resistance of a Long-Span Prestressed Double-Layer Composite Torsional Reticulated Shell. Symmetry 2020, 12, 1434. [Google Scholar]
- Masachis, S.; Segorbe, D.; Turrà, D.; Leon-Ruiz, M.; Fürst, U.; El Ghalid, M.; Leonard, G.; López-Berges, M.S.; Richards, T.A.; Felix, G.; et al. A fungal pathogen secretes plant alkalinizing peptides to increase infection. Nat. Microbiol. 2016, 1, 16043. [Google Scholar] [CrossRef]
- Zhao, C.; Zayed, O.; Yu, Z.; Jiang, W.; Zhu, P.; Hsu, C.-C.; Zhang, L.; Tao, W.A.; Lozano-Durán, R.; Zhu, J.-K. Leucine-rich repeat extensin proteins regulate plant salt tolerance in Arabidopsis. Proc. Natl. Acad. Sci. USA 2018, 115, 13123–13128. [Google Scholar] [CrossRef]
- Zhao, C.; Jiang, W.; Zayed, O.; Liu, X.; Tang, K.; Nie, W.; Li, Y.; Xie, S.; Li, Y.; Long, T.; et al. The LRXs-RALFs-FER module controls plant growth and salt stress responses by modulating multiple plant hormones. Natl. Sci. Rev. 2021, 8, nwaa149. [Google Scholar] [CrossRef]
- Mamaeva, A.; Makeeva, A.; Ganaeva, D. The Small Key to the Treasure Chest: Endogenous Plant Peptides Involved in Symbiotic Interactions. Plants 2025, 14, 378. [Google Scholar] [CrossRef]
- Takata, N.; Yokota, K.; Ohki, S.; Mori, M.; Taniguchi, T.; Kurita, M. Evolutionary relationship and structural characterization of the EPF/EPFL gene family. PLoS ONE 2013, 8, e65183. [Google Scholar] [CrossRef]
- Liu, S.; Chen, T.; Li, X.; Cui, J.; Tian, Y. Genome-wide identification and expression analysis of EPF/EPFL gene family in Populus trichocarpa. Front. Genet. 2024, 15, 1432376. [Google Scholar] [CrossRef]
- Hancock, R.E.W.; Chapple, D.S. Peptide Antibiotics. Antimicrob. Agents Chemother. 1999, 43, 1317–1323. [Google Scholar] [CrossRef]
- Seyfi, R.; Kahaki, F.A.; Ebrahimi, T.; Montazersaheb, S.; Eyvazi, S.; Babaeipour, V.; Tarhriz, V. Antimicrobial Peptides (AMPs): Roles, Functions and Mechanism of Action. Int. J. Pept. Res. Ther. 2020, 26, 1451–1463. [Google Scholar] [CrossRef]
- Zhang, L.-j.; Gallo, R.L. Antimicrobial peptides. Curr. Biol. 2016, 26, R14–R19. [Google Scholar] [CrossRef]
- Van de Velde, W.; Zehirov, G.; Szatmari, A.; Debreczeny, M.; Ishihara, H.; Kevei, Z.; Farkas, A.; Mikulass, K.; Nagy, A.; Tiricz, H.; et al. Plant peptides govern terminal differentiation of bacteria in symbiosis. Science 2010, 327, 1122–1126. [Google Scholar] [CrossRef]
- Morais, T.P.; Zaini, P.A.; Chakraborty, S.; Gouran, H.; Carvalho, C.P.; Almeida-Souza, H.O.; Souza, J.B.; Santos, P.S.; Goulart, L.R.; Luz, J.M.Q.; et al. The plant-based chimeric antimicrobial protein SlP14a-PPC20 protects tomato against bacterial wilt disease caused by Ralstonia solanacearum. Plant Sci. 2019, 280, 197–205. [Google Scholar] [CrossRef]
- Broekaert, W.F.; Terras, F.R.; Cammue, B.P.; Osborn, R.W. Plant defensins: Novel antimicrobial peptides as components of the host defense system. Plant Physiol. 1995, 108, 1353–1358. [Google Scholar] [CrossRef]
- Bruix, M.; Jiménez, M.A.; Santoro, J.; González, C.; Colilla, F.J.; Méndez, E.; Rico, M. Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: A structural motif common to toxic arthropod proteins. Biochemistry 1993, 32, 715–724. [Google Scholar] [CrossRef]
- Zhu, S.; Gao, B.; Tytgat, J. Phylogenetic distribution, functional epitopes and evolution of the CSalphabeta superfamily. Cell. Mol. Life Sci. 2005, 62, 2257–2269. [Google Scholar] [CrossRef]
- Vriens, K.; Cammue, B.P.A.; Thevissen, K. Antifungal plant defensins: Mechanisms of action and production. Molecules 2014, 19, 12280–12303. [Google Scholar] [CrossRef]
- Su, Z.; Yu, H.; Lv, T.; Chen, Q.; Luo, H.; Zhang, H. Progress in the classification, optimization, activity, and application of antimicrobial peptides. Front. Microbiol. 2025, 16, 1582863. [Google Scholar] [CrossRef]
- Iwai, T.; Kaku, H.; Honkura, R.; Nakamura, S.; Ochiai, H.; Sasaki, T.; Ohashi, Y. Enhanced Resistance to Seed-Transmitted Bacterial Diseases in Transgenic Rice Plants Overproducing an Oat Cell-Wall-Bound Thionin. Mol. Plant-Microbe Interact. 2002, 15, 515–521. [Google Scholar] [CrossRef]
- Ji, H.; Gheysen, G.; Ullah, C.; Verbeek, R.; Shang, C.; De Vleesschauwer, D.; Höfte, M.; Kyndt, T. The role of thionins in rice defence against root pathogens. Mol. Plant Pathol. 2015, 16, 870–881. [Google Scholar] [CrossRef]
- Loeza-Ángeles, H.; Sagrero-Cisneros, E.; Lara-Zárate, L.; Villagómez-Gómez, E.; López-Meza, J.E.; Ochoa-Zarzosa, A. Thionin Thi2.1 from Arabidopsis thaliana expressed in endothelial cells shows antibacterial, antifungal and cytotoxic activity. Biotechnol. Lett. 2008, 30, 1713–1719. [Google Scholar] [CrossRef]
- Yang, M.; Jiao, J.; Liu, Y.; Li, M.; Xia, Y.; Hou, F.; Huang, C.; Zhang, H.; Wang, M.; Shi, J.; et al. Genome-wide investigation of defensin genes in apple (Malus × domestica Borkh.) and in vivo analyses show that MdDEF25 confers resistance to Fusarium solani. J. Integr. Agric. (JIA) 2025, 24, 161–175. [Google Scholar] [CrossRef]
- Castaldi, V.; Langella, E.; Buonanno, M.; Di Lelio, I.; Aprile, A.M.; Molisso, D.; Criscuolo, M.C.; D’Andrea, L.D.; Romanelli, A.; Amoresano, A.; et al. Intrinsically disordered Prosystemin discloses biologically active repeat motifs. Plant Sci. 2024, 340, 111969. [Google Scholar] [CrossRef]
- Ryan, C.A.; Pearce, G. Systemin: A polypeptide signal for plant defensive genes. Annu. Rev. Cell Dev. Biol. 1998, 14, 1–17. [Google Scholar] [CrossRef]
- Doares, S.H.; Narvaez-Vasquez, J.; Conconi, A.; Ryan, C.A. Salicylic Acid Inhibits Synthesis of Proteinase Inhibitors in Tomato Leaves Induced by Systemin and Jasmonic Acid. Plant Physiol. 1995, 108, 1741–1746. [Google Scholar] [CrossRef]
- Zhang, H.; Zhang, H.; Lin, J. Systemin-mediated long-distance systemic defense responses. New Phytol. 2020, 226, 1573–1582. [Google Scholar] [CrossRef]
- Coppola, M.; Corrado, G.; Coppola, V.; Cascone, P.; Martinelli, R.; Digilio, M.C.; Pennacchio, F.; Rao, R. Prosystemin Overexpression in Tomato Enhances Resistance to Different Biotic Stresses by Activating Genes of Multiple Signaling Pathways. Plant Mol. Biol. Rep. 2015, 33, 1270–1285. [Google Scholar] [CrossRef]
- McGurl, B.; Pearce, G.; Orozco-Cardenas, M.; Ryan, C.A. Structure, expression, and antisense inhibition of the systemin precursor gene. Science 1992, 255, 1570–1573. [Google Scholar] [CrossRef]
- Ryan, C.A.; Pearce, G. Systemins: A functionally defined family of peptide signals that regulate defensive genes in Solanaceae species. Proc. Natl. Acad. Sci. USA 2003, 100 (Suppl. 2), 14577–14580. [Google Scholar] [CrossRef]
- Cho, H.; Seo, D.; Kim, M.; Nam, B.E.; Ahn, S.; Kang, M.; Bang, G.; Kwon, C.-T.; Joo, Y.; Oh, E. SERKs serve as co-receptors for SYR1 to trigger systemin-mediated defense responses in tomato. J. Integr. Plant Biol. 2024, 66, 2273–2287. [Google Scholar] [CrossRef]
- Yamaguchi, Y.; Pearce, G.; Ryan, C.A. The cell surface leucine-rich repeat receptor for AtPep1, an endogenous peptide elicitor in Arabidopsis, is functional in transgenic tobacco cells. Proc. Natl. Acad. Sci. USA 2006, 103, 10104–10109. [Google Scholar] [CrossRef]
- Yamaguchi, Y.; Huffaker, A.; Bryan, A.C.; Tax, F.E.; Ryan, C.A. PEPR2 Is a Second Receptor for the Pep1 and Pep2 Peptides and Contributes to Defense Responses in Arabidopsis Plant Cell 2010, 22, 508–522. 22. [CrossRef]
- Lee, M.W.; Huffaker, A.; Crippen, D.; Robbins, R.T.; Goggin, F.L. Plant elicitor peptides promote plant defences against nematodes in soybean. Mol. Plant Pathol. 2018, 19, 858–869. [Google Scholar] [CrossRef]
- Huang, Y.; Nordeen, R.O.; Di, M.; Owens, L.D.; McBeath, J.H. Expression of an Engineered Cecropin Gene Cassette in Transgenic Tobacco Plants Confers Disease Resistance to Pseudomonas syringae pv. tabaci. Phytopathology® 1997, 87, 494–499. [Google Scholar] [CrossRef]
- Che, Y.-Z.; Li, Y.-R.; Zou, H.-S.; Zou, L.-F.; Zhang, B.; Chen, G.-Y. A novel antimicrobial protein for plant protection consisting of a Xanthomonas oryzae harpin and active domains of cecropin A and melittin. Microb. Biotechnol. 2011, 4, 777–793. [Google Scholar] [CrossRef]
- Shi, W.; Li, C.; Li, M.; Zong, X.; Han, D.; Chen, Y. Antimicrobial peptide melittin against Xanthomonas oryzae pv. oryzae, the bacterial leaf blight pathogen in rice. Appl. Microbiol. Biotechnol. 2016, 100, 5059–5067. [Google Scholar] [CrossRef]
- Luo, Y.; Zhang, D.-D.; Dong, X.-W.; Zhao, P.-B.; Chen, L.-L.; Song, X.-Y.; Wang, X.-J.; Chen, X.-L.; Shi, M.; Zhang, Y.-Z. Antimicrobial peptaibols induce defense responses and systemic resistance in tobacco against tobacco mosaic virus. FEMS Microbiol. Lett. 2010, 313, 120–126. [Google Scholar] [CrossRef]
- Ma, B.; Fang, C.; Lu, L.; Wang, M.; Xue, X.; Zhou, Y.; Li, M.; Hu, Y.; Luo, X.; Hou, Z. The antimicrobial peptide thanatin disrupts the bacterial outer membrane and inactivates the NDM-1 metallo-β-lactamase. Nat. Commun. 2019, 10, 3517. [Google Scholar] [CrossRef]
- Kang Hee, K.; Seo Chang, H.; Luchian, T.; Park, Y. Pse-T2, an Antimicrobial Peptide with High-Level, Broad-Spectrum Antimicrobial Potency and Skin Biocompatibility against Multidrug-Resistant Pseudomonas aeruginosa Infection. Antimicrob. Agents Chemother. 2018, 62, e01493-18. [Google Scholar] [CrossRef]
- Li, J.-F.; Zhang, J.-X.; Li, G.; Xu, Y.-Y.; Lu, K.; Wang, Z.-G.; Liu, J.-P. Antimicrobial activity and mechanism of peptide CM4 against Pseudomonas aeruginosa. Food Funct. 2020, 11, 7245–7254. [Google Scholar] [CrossRef]
- Yang, R.; Su, C.; Xue, Z.; Wei, H.; Wang, Z.; Zhu, J.; Meng, J.; Luan, Y. Combination of PAMP-induced peptide signaling and its regulator SpWRKY65 boosts tomato resistance to Phytophthora infestans. Plant J. 2025, 121, e70098. [Google Scholar] [CrossRef]
- Torres Ascurra, Y.C.; Müller, L.M. Signaling peptides control beneficial and pathogenic plant-microbe interactions. J. Exp. Bot. 2025. [Google Scholar] [CrossRef]
- Yamaguchi, K.; Kawasaki, T. Pathogen- and plant-derived peptides trigger plant immunity. Peptides 2021, 144, 170611. [Google Scholar] [CrossRef]
- Yang, R.; Wang, Z.; Zhao, L.; Liu, J.; Meng, J.; Luan, Y. Secreted Peptide SpPIP1 Modulates Disease Resistance and Salt Tolerance in Tomato. J. Agric. Food Chem. 2023, 71, 12264–12279. [Google Scholar] [CrossRef]
- Tang, R.; Tan, H.; Dai, Y.; Li, L.a.; Huang, Y.; Yao, H.; Cai, Y.; Yu, G. Application of antimicrobial peptides in plant protection: Making use of the overlooked merits. Front. Plant Sci. 2023, 14, 1139539. [Google Scholar] [CrossRef]
- Herrera Diaz, A.; Kovacs, I.; Lindermayr, C. Inducible Expression of the De-Novo Designed Antimicrobial Peptide SP1-1 in Tomato Confers Resistance to Xanthomonas campestris pv. vesicatoria. PLoS ONE 2016, 11, e0164097. [Google Scholar] [CrossRef]
- Zhao, P.; Yang, H.; Sun, Y.; Zhang, J.; Gao, K.; Wu, J.; Zhu, C.; Yin, C.; Chen, X.; Liu, Q.; et al. Targeted MYC2 stabilization confers citrus Huanglongbing resistance. Science 2025, 388, 191–198. [Google Scholar] [CrossRef]


Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Liu, M.; Zhang, G.; Wang, S.; Wang, Q. Advances of Peptides for Plant Immunity. Plants 2025, 14, 2452. https://doi.org/10.3390/plants14152452
Liu M, Zhang G, Wang S, Wang Q. Advances of Peptides for Plant Immunity. Plants. 2025; 14(15):2452. https://doi.org/10.3390/plants14152452
Chicago/Turabian StyleLiu, Minghao, Guangzhong Zhang, Suikang Wang, and Quan Wang. 2025. "Advances of Peptides for Plant Immunity" Plants 14, no. 15: 2452. https://doi.org/10.3390/plants14152452
APA StyleLiu, M., Zhang, G., Wang, S., & Wang, Q. (2025). Advances of Peptides for Plant Immunity. Plants, 14(15), 2452. https://doi.org/10.3390/plants14152452

