Genome-Wide Identification and Analysis of the MADS-Box Transcription Factor Genes in Blueberry (Vaccinium spp.) and Their Expression Pattern during Fruit Ripening
Abstract
1. Introduction
2. Results
2.1. Identification of MADS-Box Genes in the Blueberry Genome
2.2. Phylogenetic Analysis and Classification of MADS-Box Genes
2.3. Chromosomal Locations of MADS-Box Genes
2.4. Structure and Conserved Motif Analyses of MADS-Box Genes
2.5. Cis-Acting Element Analysis of MADS-Box Genes
2.6. Collinearity and Evolutionary Analyses of MADS-Box Genes
2.7. Expression Patterns of MADS-Box Genes during Blueberry Fruit Ripening
3. Discussion
3.1. Gene Duplication Led to the Massive Replication of VcMADS Genes
3.2. Retention and Potential Roles of TM8 Genes in Blueberry
3.3. The Possible Mechanism of Extranuclear VcMADS Protein Involved in Gene Regulation
3.4. Deletion of K-Box Domains in the MIKC* and the FLC Subfamilies
3.5. Potential Roles of MADS-Box Genes in Fruit Ripening in Blueberry
4. Materials and Methods
4.1. Identification of MADS-Box Genes in Blueberry
4.2. Phylogenetic Analysis and Classification of Blueberry MADS-Box Genes
4.3. Chromosomal Location and Conserved Motif Analyses of MADS-Box in Blueberry
4.4. Cis-Acting Element, Collinearity, and Evolutionary Selection Analysis of Blueberry MADS-Box Genes
4.5. Plant Materials
4.6. Expression Pattern of MADS-Box Genes during Blueberry Fruit Ripening
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Passmore, S.; Maine, G.T.; Elble, R.; Christ, C.; Tye, B. Saccharomyces cerevisiae protein involved in plasmid maintenance is necessary for mating of MATα cells. J. Mol. Biol. 1988, 204, 593–606. [Google Scholar] [CrossRef] [PubMed]
- Yanofsky, M.F.; Ma, H.; Bowman, J.L.; Drews, G.N.; Feldmann, K.A.; Meyerowitz, E.M. The protein encoded by the Arabidopsis homeotic gene agamous resembles transcription factors. Nature 1990, 346, 35–39. [Google Scholar] [CrossRef]
- Schwarz-Sommer, Z.; Huijser, P.; Nacken, W.; Saedler, H.; Sommer, H. Genetic control of flower development by homeotic genes in Antirrhinum majus. Science 1990, 250, 931–936. [Google Scholar] [CrossRef] [PubMed]
- Norman, C.; Runswick, M.; Pollock, R.; Treisman, R. Isolation and properties of cDNA clones encoding SRF, a transcription factor that binds to the c-fos serum response element. Cell 1988, 55, 989–1003. [Google Scholar] [CrossRef] [PubMed]
- Tröbner, W.; Ramirez, L.; Motte, P.; Hue, I.; Huijser, P.; Lönnig, W.E.; Saedler, H.; Sommer, H.; Schwarz-Sommer, Z. GLOBOSA: A homeotic gene which interacts with DEFICIENS in the control of Antirrhinum floral organogenesis. EMBO J. 1992, 11, 4693–4704. [Google Scholar] [CrossRef]
- Alvarez-Buylla, E.R.; Pelaz, S.; Liljegren, S.J.; Gold, S.E.; Burgeff, C.; Ditta, G.S.; de Pouplana, L.R.; Martínez-Castilla, L.; Yanofsky, M.F. An ancestral MADS-box gene duplication occurred before the divergence of plants and animals. Proc. Natl. Acad. Sci. USA 2000, 97, 5328–5333. [Google Scholar] [CrossRef]
- De Bodt, S.; Raesm, J.; Florquin, K.; Rombauts, S.; Rouzé, P.; Theissen, G.; van de Peer, Y. Genome wide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol. 2003, 56, 573–586. [Google Scholar] [CrossRef]
- Pařenicová, L.; de Folter, S.; Kieffer, M.; Horner, D.S.; Favalli, C.; Busscher, J.; Cook, H.E.; Ingram, R.M.; Kater, M.M.; Davies, B.; et al. Molecular and phylogenetic analyses of the complete MADS-Box transcription factor family in Arabidopsis: New openings to the MADS world. Plant Cell 2003, 15, 1538–1551. [Google Scholar]
- Becker, A.; Theißen, G. The major clades of MADS-box genes and their role in the development and evolution of flowering plants. Mol. Phylogenet. Evol. 2003, 29, 464–489. [Google Scholar] [CrossRef]
- Henschel, K.; Kofuji, R.; Hasebe, M.; Saedler, H.; Münster, T.; Theißen, G. Two ancient classes of MIKC-type MADS-box genes are present in the moss physcomitrella patens. Mol. Biol. Evol. 2002, 19, 801–814. [Google Scholar] [CrossRef]
- Kaufmann, K.; Melzer, R.; Theißen, G. MIKC-type MADS-domain proteins: Structural modularity, protein interactions and network evolution in land plants. Gene 2005, 347, 183–198. [Google Scholar] [CrossRef] [PubMed]
- Wang, L.; Yin, X.; Cheng, C.; Wang, H.; Guo, R.; Xu, X.; Zhao, J.; Zheng, Y.; Wang, X. Evolutionary and expression analysis of a MADS-box gene superfamily involved in ovule development of seeded and seedless grapevines. Mol. Genet. Genom. 2015, 290, 825–846. [Google Scholar] [CrossRef]
- Zhao, P.; Zhang, J.; Chen, S.; Wu, J.; Xia, J.; Sun, L.; Ma, S.; Xiang, C. Arabidopsis MADS-box factor AGL16 is a negative regulator of plant response to salt stress by downregulating salt-responsive genes. New Phytol. 2021, 232, 2418–2439. [Google Scholar] [CrossRef] [PubMed]
- Qu, G.; Zheng, T.; Liu, G.; Wang, W.; Zang, L.; Liu, H.; Yang, C. Overexpression of a MADS-box gene from birch (Betula platyphylla) promotes flowering and enhances chloroplast development in transgenic tobacco. PLoS ONE 2013, 8, e63398. [Google Scholar] [CrossRef] [PubMed]
- Tiwari, S.; Spielman, M.; Schulz, R.; Oakey, R.J.; Kelsey, G.; Salazar, A.; Zhang, K.; Pennell, R.; Scott, R.J. Transcriptional profiles underlying parent-of-origin effects in seeds of Arabidopsis thaliana. BMC Plant Biol. 2010, 10, 72. [Google Scholar] [CrossRef]
- Day, R.C.; Herridge, R.P.; Ambrose, B.A.; Macknight, R.C. Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol. 2008, 148, 1964–1984. [Google Scholar] [CrossRef]
- Masiero, S.; Colombo, L.; Grini, P.E.; Schnittger, A.; Kater, M.M. The emerging importance of type I MADS-Box transcription factors for plant reproduction. Plant Cell 2011, 23, 865–872. [Google Scholar] [CrossRef]
- Causier, B.; Schwarz-Sommer, Z.; Davies, B. Floral organ identity: 20 years of ABCs. Semin. Cell Dev. Biol. 2010, 21, 73–79. [Google Scholar] [CrossRef]
- Litt, A.; Kramer, E.M. The ABC model and the diversification of floral organ identity. Semin. Cell Dev. Biol. 2010, 21, 129–137. [Google Scholar] [CrossRef]
- Theißen, G.; Melzer, R.; Rümpler, F. MADS-domain transcription factors and the floral quartet model of flower development: Linking plant development and evolution. Development 2016, 143, 3259–3271. [Google Scholar] [CrossRef]
- Moser, M.; Asquini, E.; Miolli, G.V.; Weigl, K.; Hanke, M.; Flachowsky, H.; Si-Ammour, A. The MADS-Box gene MdDAM1 controls growth cessation and bud dormancy in apple. Front. Plant Sci. 2020, 11, 1003. [Google Scholar] [CrossRef] [PubMed]
- Chen, R.; Ma, J.; Luo, D.; Hou, X.; Ma, F.; Zhang, Y.; Meng, Y.; Zhang, H.; Guo, W. CaMADS, a MADS-box transcription factor from pepper, plays an important role in the response to cold, salt, and osmotic stress. Plant Sci. 2019, 280, 164–174. [Google Scholar] [CrossRef]
- Zhao, W.; Zhang, L.; Xu, Z.; Fu, L.; Pang, H.; Ma, Y.; Min, D. Genome-Wide analysis of MADS-Box genes in foxtail millet (Setaria italica L.) and functional assessment of the role of SiMADS51 in the drought stress response. Front. Plant Sci. 2021, 12, 659474. [Google Scholar] [CrossRef] [PubMed]
- Li, P.; Zhang, Q.; He, D.; Zhou, Y.; Ni, H.; Tian, D.; Chang, G.; Jing, Y.; Lin, R.; Huang, J.; et al. AGAMOUS-LIKE67 Cooperates with the histone mark reader EBS to modulate seed germination under high temperature. Plant Physiol. 2020, 184, 529–545. [Google Scholar] [CrossRef] [PubMed]
- Li, S.; Chen, K.; Grierson, D. A critical evaluation of the role of ethylene and MADS transcription factors in the network controlling fleshy fruit ripening. New Phytol. 2019, 221, 1724–1741. [Google Scholar] [CrossRef]
- Daminato, M.; Guzzo, F.; Casadoro, G. A SHATTERPROOF-like gene controls ripening in non-climacteric strawberries, and auxin and abscisic acid antagonistically affect its expression. J. Exp. Bot. 2013, 64, 3775–3786. [Google Scholar] [CrossRef]
- Vrebalov, J.; Ruezinsky, D.; Padmanabhan, V.; White, R.; Medrano, D.; Drake, R.; Schuch, W.; Giovannoni, J. A MADS-Box gene necessary for fruit ripening at the tomato ripening-inhibitor (Rin) locus. Science 2002, 296, 343–346. [Google Scholar] [CrossRef]
- Duan, W.; Song, X.; Liu, T.; Huang, Z.; Ren, J.; Hou, X.; Li, Y. Genome-wide analysis of the MADS-box gene family in Brassica rapa (Chinese cabbage). Mol. Genet. Genom. 2015, 290, 239–255. [Google Scholar] [CrossRef]
- Wang, Y.; Zhang, J.; Hu, Z.; Guo, X.; Tian, S.; Chen, G. Genome-Wide analysis of the MADS-Box transcription factor family in Solanum lycopersicum. Int. J. Mol. Sci. 2019, 20, 2961. [Google Scholar] [CrossRef]
- Shao, Z.; He, M.; Zeng, Z.; Chen, Y.; Hanna, A.; Zhu, H. Genome-Wide identification and expression analysis of the MADS-Box gene family in sweet potato [Ipomoea batatas (L.) Lam]. Front. Genet. 2021, 12, 750137. [Google Scholar] [CrossRef]
- Qu, Y.; Bi, C.; He, B.; Ye, N.; Yin, T.; Xu, L. Genome-wide identification and characterization of the MADS-box gene family in Salix suchowensis. PeerJ 2019, 7, e8019. [Google Scholar] [CrossRef] [PubMed]
- Ma, J.; Yang, Y.; Luo, W.; Yang, C.; Ding, P.; Liu, Y.; Qiao, L.; Chang, Z.; Geng, H.; Wang, P.; et al. Genome-wide identification and analysis of the MADS-box gene family in bread wheat (Triticum aestivum L.). PLoS ONE 2017, 12, e181443. [Google Scholar] [CrossRef] [PubMed]
- Zhao, D.; Chen, Z.; Xu, L.; Zhang, L.; Zou, Q. Genome-Wide analysis of the MADS-Box gene family in maize: Gene structure, evolution, and relationships. Genes 2021, 12, 1956. [Google Scholar] [CrossRef] [PubMed]
- Sun, F.; Fang, H.; Wen, X.; Zhang, L. Phylogenetic and expression analysis of MADS-box genes in Rhododendron ovatum. Chin. Bull. Bot. 2022. [Google Scholar] [CrossRef]
- Colle, M.; Leisner, C.P.; Wai, C.M.; Ou, S.; Bird, K.A.; Wang, J.; Wisecaver, J.H.; Yocca, A.E.; Alger, E.I.; Tang, H.; et al. Haplotype-phased genome and evolution of phytonutrient pathways of tetraploid blueberry. Gigascience 2019, 8, giz012. [Google Scholar] [CrossRef]
- Yang, F.; Nie, S.; Liu, H.; Shi, T.; Tian, X.; Zhou, S.; Bao, Y.; Jia, K.; Guo, J.; Zhao, W.; et al. Chromosome-level genome assembly of a parent species of widely cultivated azaleas. Nat. Commun. 2020, 11, 5269. [Google Scholar] [CrossRef]
- Wang, Y.; Nie, F.; Shahid, M.Q.; Baloch, F.S. Molecular footprints of selection effects and whole genome duplication (WGD) events in three blueberry species: Detected by transcriptome dataset. BMC Plant Biol. 2020, 20, 250. [Google Scholar] [CrossRef]
- Daminato, M.; Masiero, S.; Resentini, F.; Lovisetto, A.; Casadoro, G. Characterization of TM8, a MADS-box gene expressed in tomato flowers. BMC Plant Biol. 2014, 14, 319. [Google Scholar] [CrossRef]
- Coenen, H.; Viaene, T.; Vandenbussche, M.; Geuten, K. TM8 represses developmental timing in Nicotiana benthamiana and has functionally diversified in angiosperms. BMC Plant Biol. 2018, 18, 129. [Google Scholar] [CrossRef]
- Gramzow, L.; En, G.U.N.T. Phylogenomics reveals surprising sets of essential and dispensable clades of MIKC(c)-group MADS-box genes in flowering plants. J. Exp. Zool. Part B Mol. Dev. Evol. 2015, 324, 353–362. [Google Scholar] [CrossRef]
- Fu, X.; Liang, C.; Li, F.; Wang, L.; Wu, X.; Lu, A.; Xiao, G.; Zhang, G. The rules and functions of nucleocytoplasmic shuttling proteins. Int. J. Mol. Sci. 2018, 19, 1445. [Google Scholar] [CrossRef] [PubMed]
- Wang, R.; Wang, R.; Liu, M.; Yuan, W.; Zhao, Z.; Liu, X.; Peng, Y.; Yang, X.; Sun, Y.; Tang, W. Nucleocytoplasmic trafficking and turnover mechanisms of BRASSINAZOLE RESISTANT1 in Arabidopsis thaliana. Proc. Natl. Acad. Sci. USA 2021, 118, e2101838118. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Tang, H.; DeBarry, J.D.; Tan, X.; Li, J.; Wang, X.; Lee, T.; Jin, H.; Marler, B.; Guo, H.; et al. MCScanX: A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, e49. [Google Scholar] [CrossRef] [PubMed]
- Alhindi, T.; Al-Abdallat, A.M. Genome-Wide identification and analysis of the MADS-Box gene family in American beautyberry (Callicarpa americana). Plants 2021, 10, 1805. [Google Scholar] [CrossRef] [PubMed]
- Guan, H.; Wang, H.; Huang, J.; Liu, M.; Chen, T.; Shan, X.; Chen, H.; Shen, J. Genome-Wide identification and expression analysis of MADS-Box family genes in Litchi (Litchi chinensis Sonn.) and their involvement in floral sex determination. Plants 2021, 10, 2142. [Google Scholar] [CrossRef] [PubMed]
- Liu, J.; Liu, M.; Wang, J.; Zhang, J.; Miao, H.; Wang, Z.; Jia, C.; Zhang, J.; Xu, B.; Jin, Z. Transcription factor MaMADS36 plays a central role in regulating banana fruit ripening. J. Exp. Bot. 2021, 72, 7078–7091. [Google Scholar] [CrossRef]
- Seymour, G.B.; Ryder, C.D.; Cevik, V.; Hammond, J.P.; Popovich, A.; King, G.J.; Vrebalov, J.; Giovannoni, J.J.; Manning, K. A SEPALLATA gene is involved in the development and ripening of strawberry (Fragaria × ananassa Duch.) fruit, a non-climacteric tissue. J. Exp. Bot. 2011, 62, 1179–1188. [Google Scholar] [CrossRef]
- Mistry, J.; Finn, R.D.; Eddy, S.R.; Bateman, A.; Punta, M. Challenges in homology search: HMMER3 and convergent evolution of coiled-coil regions. Nucleic Acids Res. 2013, 41, e121. [Google Scholar] [CrossRef]
- El-Gebali, S.; Mistry, J.; Bateman, A.; Eddy, S.R.; Luciani, A.; Potter, S.C.; Qureshi, M.; Richardson, L.J.; Salazar, G.A.; Smart, A.; et al. The Pfam protein families database in 2019. Nucleic Acids Res. 2019, 47, D427–D432. [Google Scholar] [CrossRef]
- Larkin, M.A.; Blackshields, G.; Brown, N.P.; Chenna, R.; McGettigan, P.A.; McWilliam, H.; Valentin, F.; Wallace, I.M.; Wilm, A.; Lopez, R.; et al. Clustal W and Clustal X version 2.0. Bioinformatics 2007, 23, 2947–2948. [Google Scholar] [CrossRef]
- Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New models and efficient methods for phylogenetic inference in the genomic era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [PubMed]
- Letunic, I.; Bork, P. Interactive Tree of Life (iTOL) v5: An online tool for phylogenetic tree display and annotation. Nucleic Acids Res. 2021, 49, W293–W296. [Google Scholar] [CrossRef] [PubMed]
- Bailey, T.L.; Boden, M.; Buske, F.A.; Frith, M.; Grant, C.E.; Clementi, L.; Ren, J.; Li, W.W.; Noble, W.S. MEME SUITE: Tools for motif discovery and searching. Nucleic Acids Res. 2009, 37, W202–W208. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant. 2020, 13, 1194–1202. [Google Scholar] [CrossRef]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; Van de Peer, Y.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef]
- Krzywinski, M.; Schein, J.; Birol, I.; Connors, J.; Gascoyne, R.; Horsman, D.; Jones, S.J.; Marra, M.A. Circos: An information aesthetic for comparative genomics. Genome Res. 2009, 19, 1639–1645. [Google Scholar] [CrossRef]
- Zhang, Z. KaKs_Calculator 3.0: Calculating selective pressure on coding and non-coding sequences. Genom. Proteom. Bioinform. 2021, 20, 536–540. [Google Scholar] [CrossRef]
- Zifkin, M.; Jin, A.; Ozga, J.A.; Zaharia, L.I.; Schernthaner, J.P.; Gesell, A.; Abrams, S.R.; Kennedy, J.A.; Constabel, C.P. Gene expression and metabolite profiling of developing highbush blueberry fruit indicates transcriptional regulation of flavonoid metabolism and activation of abscisic acid metabolism. Plant Physiol. 2012, 158, 200–224. [Google Scholar] [CrossRef]
Motif | Length | Amino Acid Sequence |
---|---|---|
1 | 28 | RIENKTNRQVTFSKRRNGLFKKASELSV |
2 | 21 | LCDAEVALIVFSPTGKLYEFG |
3 | 21 | ELSVEELEQLEKQLETSLKEI |
4 | 15 | SSSVRGIIERYLSMS |
5 | 29 | MLTHEGYLTQRIASEIKRNDKAKKKNDMK |
6 | 41 | QQDHTLEEKEAQFWQQEAAKLKAKJEALZRSQRNLLGEDLG |
7 | 8 | MGRGKIEL |
8 | 29 | KKTQLLKDZIQELQRKEKLLEZENKTLLK |
9 | 29 | NIVVAQRNENLRLLNMQLTNAQAELEAEK |
10 | 29 | YQQDIPCGPSWVISDLEIASPEHHVAGNM |
11 | 41 | MQSGPQWFTDWVNNPNENMGFGGDDQMMLPFGDGHSAMWSS |
12 | 29 | PPPPPPPPLEEREGGPHQQAAAPPPPPPP |
13 | 15 | QEDMNKIYEGSLDLG |
14 | 41 | AZQKIDEYRBYPVPEQKKRLLELEGFINNRLEKJEEKVTKK |
15 | 37 | QEPSEEIATVALTNSREDSDVETELFIGQPLGRIKPT |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Wang, X.; Huang, Q.; Shen, Z.; Baron, G.C.; Li, X.; Lu, X.; Li, Y.; Chen, W.; Xu, L.; Lv, J.; et al. Genome-Wide Identification and Analysis of the MADS-Box Transcription Factor Genes in Blueberry (Vaccinium spp.) and Their Expression Pattern during Fruit Ripening. Plants 2023, 12, 1424. https://doi.org/10.3390/plants12071424
Wang X, Huang Q, Shen Z, Baron GC, Li X, Lu X, Li Y, Chen W, Xu L, Lv J, et al. Genome-Wide Identification and Analysis of the MADS-Box Transcription Factor Genes in Blueberry (Vaccinium spp.) and Their Expression Pattern during Fruit Ripening. Plants. 2023; 12(7):1424. https://doi.org/10.3390/plants12071424
Chicago/Turabian StyleWang, Xuxiang, Qiaoyu Huang, Zhuli Shen, Ghislain Christel Baron, Xiaoyi Li, Xiaoying Lu, Yongqiang Li, Wenrong Chen, Lishan Xu, Jinchao Lv, and et al. 2023. "Genome-Wide Identification and Analysis of the MADS-Box Transcription Factor Genes in Blueberry (Vaccinium spp.) and Their Expression Pattern during Fruit Ripening" Plants 12, no. 7: 1424. https://doi.org/10.3390/plants12071424
APA StyleWang, X., Huang, Q., Shen, Z., Baron, G. C., Li, X., Lu, X., Li, Y., Chen, W., Xu, L., Lv, J., Li, W., Zong, Y., & Guo, W. (2023). Genome-Wide Identification and Analysis of the MADS-Box Transcription Factor Genes in Blueberry (Vaccinium spp.) and Their Expression Pattern during Fruit Ripening. Plants, 12(7), 1424. https://doi.org/10.3390/plants12071424