Regulating Phase Transition in Neurodegenerative Diseases by Nuclear Import Receptors
Abstract
:Simple Summary
Abstract
1. Introduction
2. Components and Mechanism of Nucleocytoplasmic Transport
2.1. Nuclear Import of Proteins with Nuclear Localization Signal by NIR
2.2. Nuclear Export of Proteins with Nuclear Export Signal by Exportin
3. LLPS of NIR Cargoes Implicated in Neurodegenerative Diseases
3.1. FUS
3.2. TDP-43
3.3. hnRNPA1
4. Impaired Nucleocytoplasmic Transport in Neurodegenerative Diseases
4.1. Impaired NCT in ALS and FTLD
4.2. Impaired NCT in Alzheimer’s Disease
4.3. Impaired NCT in Huntington’s Disease
4.4. NCT Impairments in Ageing
4.5. Selective Neuronal Vulnerability to Nucleocytoplasmic Transport Deficits in Neuro-Degenerative Diseases
4.6. Restoring Nucleocytoplasmic Transport by Small Molecules for the Treatment of Neurodegenerative Diseases
5. Effect of NIRs on LLPS of NIR Cargoes
6. Enhancing Chaperone Activities of Nuclear Import Receptors
7. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Banani, S.F.; Lee, H.O.; Hyman, A.A.; Rosen, M.K. Biomolecular condensates: Organizers of cellular biochemistry. Nat. Rev. Mol. Cell Biol. 2017, 18, 285–298. [Google Scholar] [CrossRef] [PubMed]
- Peng, P.H.; Hsu, K.W.; Wu, K.J. Liquid-liquid phase separation (LLPS) in cellular physiology and tumor biology. Am. J. Cancer Res. 2021, 11, 3766–3776. [Google Scholar] [PubMed]
- Li, H.R.; Chiang, W.C.; Chou, P.C.; Wang, W.J.; Huang, J.R. TAR DNA-binding protein 43 (TDP-43) liquid-liquid phase separation is mediated by just a few aromatic residues. J. Biol. Chem. 2018, 293, 6090–6098. [Google Scholar] [CrossRef] [Green Version]
- De-Paula, V.J.; Radanovic, M.; Diniz, B.S.; Forlenza, O.V. Alzheimer’s disease. Subcell Biochem. 2012, 65, 329–352. [Google Scholar] [CrossRef]
- Polymeropoulos, M.H.; Higgins, J.J.; Golbe, L.I.; Johnson, W.G.; Ide, S.E.; Di Iorio, G.; Sanges, G.; Stenroos, E.S.; Pho, L.T.; Schaffer, A.A.; et al. Mapping of a gene for Parkinson’s disease to chromosome 4q21-q23. Science 1996, 274, 1197–1199. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Neumann, M.; Sampathu, D.M.; Kwong, L.K.; Truax, A.C.; Micsenyi, M.C.; Chou, T.T.; Bruce, J.; Schuck, T.; Grossman, M.; Clark, C.M.; et al. Ubiquitinated TDP-43 in frontotemporal lobar degeneration and amyotrophic lateral sclerosis. Science 2006, 314, 130–133. [Google Scholar] [CrossRef] [Green Version]
- Zhao, M.; Kim, J.R.; van Bruggen, R.; Park, J. RNA-Binding Proteins in Amyotrophic Lateral Sclerosis. Mol. Cells 2018, 41, 818–829. [Google Scholar] [CrossRef] [PubMed]
- Tesei, G.; Schulze, T.K.; Crehuet, R.; Lindorff-Larsen, K. Accurate model of liquid-liquid phase behavior of intrinsically disordered proteins from optimization of single-chain properties. Proc. Natl. Acad. Sci. USA 2021, 118, e2111696118. [Google Scholar] [CrossRef]
- Nott, T.J.; Petsalaki, E.; Farber, P.; Jervis, D.; Fussner, E.; Plochowietz, A.; Craggs, T.D.; Bazett-Jones, D.P.; Pawson, T.; Forman-Kay, J.D.; et al. Phase transition of a disordered nuage protein generates environmentally responsive membraneless organelles. Mol. Cells 2015, 57, 936–947. [Google Scholar] [CrossRef] [Green Version]
- Schuster, B.S.; Dignon, G.L.; Tang, W.S.; Kelley, F.M.; Ranganath, A.K.; Jahnke, C.N.; Simpkins, A.G.; Regy, R.M.; Hammer, D.A.; Good, M.C.; et al. Identifying sequence perturbations to an intrinsically disordered protein that determine its phase-separation behavior. Proc. Natl. Acad. Sci. USA 2020, 117, 11421–11431. [Google Scholar] [CrossRef] [PubMed]
- Prasad, A.; Bharathi, V.; Sivalingam, V.; Girdhar, A.; Patel, B.K. Molecular Mechanisms of TDP-43 Misfolding and Pathology in Amyotrophic Lateral Sclerosis. Front. Mol. Neurosci. 2019, 12, 25. [Google Scholar] [CrossRef] [PubMed]
- Vernon, R.M.; Chong, P.A.; Tsang, B.; Kim, T.H.; Bah, A.; Farber, P.; Lin, H.; Forman-Kay, J.D. Pi-Pi contacts are an overlooked protein feature relevant to phase separation. Elife 2018, 7, e31486. [Google Scholar] [CrossRef]
- Krainer, G.; Welsh, T.J.; Joseph, J.A.; Espinosa, J.R.; Wittmann, S.; de Csillery, E.; Sridhar, A.; Toprakcioglu, Z.; Gudiskyte, G.; Czekalska, M.A.; et al. Reentrant liquid condensate phase of proteins is stabilized by hydrophobic and non-ionic interactions. Nat. Commun. 2021, 12, 1085. [Google Scholar] [CrossRef] [PubMed]
- Maharana, S.; Wang, J.; Papadopoulos, D.K.; Richter, D.; Pozniakovsky, A.; Poser, I.; Bickle, M.; Rizk, S.; Guillen-Boixet, J.; Franzmann, T.M.; et al. RNA buffers the phase separation behavior of prion-like RNA binding proteins. Science 2018, 360, 918–921. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kim, H.J.; Kim, N.C.; Wang, Y.D.; Scarborough, E.A.; Moore, J.; Diaz, Z.; MacLea, K.S.; Freibaum, B.; Li, S.; Molliex, A.; et al. Mutations in prion-like domains in hnRNPA2B1 and hnRNPA1 cause multisystem proteinopathy and ALS. Nature 2013, 495, 467–473. [Google Scholar] [CrossRef]
- Molliex, A.; Temirov, J.; Lee, J.; Coughlin, M.; Kanagaraj, A.P.; Kim, H.J.; Mittag, T.; Taylor, J.P. Phase separation by low complexity domains promotes stress granule assembly and drives pathological fibrillization. Cell 2015, 163, 123–133. [Google Scholar] [CrossRef] [Green Version]
- Murakami, T.; Qamar, S.; Lin, J.Q.; Schierle, G.S.; Rees, E.; Miyashita, A.; Costa, A.R.; Dodd, R.B.; Chan, F.T.; Michel, C.H.; et al. ALS/FTD Mutation-Induced Phase Transition of FUS Liquid Droplets and Reversible Hydrogels into Irreversible Hydrogels Impairs RNP Granule Function. Neuron 2015, 88, 678–690. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Patel, A.; Lee, H.O.; Jawerth, L.; Maharana, S.; Jahnel, M.; Hein, M.Y.; Stoynov, S.; Mahamid, J.; Saha, S.; Franzmann, T.M.; et al. A Liquid-to-Solid Phase Transition of the ALS Protein FUS Accelerated by Disease Mutation. Cell 2015, 162, 1066–1077. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Harrison, A.F.; Shorter, J. RNA-binding proteins with prion-like domains in health and disease. Biochem. J. 2017, 474, 1417–1438. [Google Scholar] [CrossRef] [Green Version]
- Guo, Q.; Shi, X.; Wang, X. RNA and liquid-liquid phase separation. Noncoding RNA Res. 2021, 6, 92–99. [Google Scholar] [CrossRef]
- Saito, Y.; Kimura, W. Roles of Phase Separation for Cellular Redox Maintenance. Front. Genet. 2021, 12, 691946. [Google Scholar] [CrossRef] [PubMed]
- Guo, L.; Kim, H.J.; Wang, H.; Monaghan, J.; Freyermuth, F.; Sung, J.C.; O’Donovan, K.; Fare, C.M.; Diaz, Z.; Singh, N.; et al. Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains. Cell 2018, 173, 677–692.e620. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yoshizawa, T.; Ali, R.; Jiou, J.; Fung, H.Y.J.; Burke, K.A.; Kim, S.J.; Lin, Y.; Peeples, W.B.; Saltzberg, D.; Soniat, M.; et al. Nuclear Import Receptor Inhibits Phase Separation of FUS through Binding to Multiple Sites. Cell 2018, 173, 693–705.e622. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hofweber, M.; Hutten, S.; Bourgeois, B.; Spreitzer, E.; Niedner-Boblenz, A.; Schifferer, M.; Ruepp, M.D.; Simons, M.; Niessing, D.; Madl, T.; et al. Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation. Cell 2018, 173, 706–719.e713. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Qamar, S.; Wang, G.; Randle, S.J.; Ruggeri, F.S.; Varela, J.A.; Lin, J.Q.; Phillips, E.C.; Miyashita, A.; Williams, D.; Strohl, F.; et al. FUS Phase Separation Is Modulated by a Molecular Chaperone and Methylation of Arginine Cation-pi Interactions. Cell 2018, 173, 720–734.e715. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Diez, L.; Wegmann, S. Nuclear Transport Deficits in Tau-Related Neurodegenerative Diseases. Front. Neurol. 2020, 11, 1056. [Google Scholar] [CrossRef]
- Eftekharzadeh, B.; Daigle, J.G.; Kapinos, L.E.; Coyne, A.; Schiantarelli, J.; Carlomagno, Y.; Cook, C.; Miller, S.J.; Dujardin, S.; Amaral, A.S.; et al. Tau Protein Disrupts Nucleocytoplasmic Transport in Alzheimer’s Disease. Neuron 2018, 99, 925–940.e927. [Google Scholar] [CrossRef] [Green Version]
- Benarroch, E.E. Nucleocytoplasmic transport: Mechanisms and involvement in neurodegenerative disease. Neurology 2019, 92, 757–764. [Google Scholar] [CrossRef]
- Peters, R. Introduction to nucleocytoplasmic transport: Molecules and mechanisms. Methods Mol. Biol. 2006, 322, 235–258. [Google Scholar] [CrossRef]
- Pante, N.; Aebi, U. Exploring nuclear pore complex structure and function in molecular detail. J. Cell Sci. Suppl. 1995, 19, 1–11. [Google Scholar] [CrossRef] [Green Version]
- Davis, L.I. The nuclear pore complex. Annu. Rev. Biochem. 1995, 64, 865–896. [Google Scholar] [CrossRef] [PubMed]
- Callan, H.G.; Randall, J.T.; Tomlin, S.G. An electron microscope study of the nuclear membrane. Nature 1949, 163, 280. [Google Scholar] [CrossRef] [PubMed]
- Fahrenkrog, B.; Aebi, U. The nuclear pore complex: Nucleocytoplasmic transport and beyond. Nat. Rev. Mol. Cell Biol. 2003, 4, 757–766. [Google Scholar] [CrossRef] [PubMed]
- Akey, C.W. Interactions and structure of the nuclear pore complex revealed by cryo-electron microscopy. J. Cell Biol. 1989, 109, 955–970. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Allen, T.D.; Cronshaw, J.M.; Bagley, S.; Kiseleva, E.; Goldberg, M.W. The nuclear pore complex: Mediator of translocation between nucleus and cytoplasm. J. Cell Sci. 2000, 113, 1651–1659. [Google Scholar] [CrossRef]
- Scheer, U.; Dabauvalle, M.C.; Merkert, H.; Benevente, R. The nuclear envelope and the organization of the pore complexes. Cell Biol. Int. Rep. 1988, 12, 669–689. [Google Scholar] [CrossRef] [Green Version]
- Cronshaw, J.M.; Krutchinsky, A.N.; Zhang, W.; Chait, B.T.; Matunis, M.J. Proteomic analysis of the mammalian nuclear pore complex. J. Cell Biol. 2002, 158, 915–927. [Google Scholar] [CrossRef] [Green Version]
- Terry, L.J.; Wente, S.R. Flexible gates: Dynamic topologies and functions for FG nucleoporins in nucleocytoplasmic transport. Eukaryot Cell 2009, 8, 1814–1827. [Google Scholar] [CrossRef] [Green Version]
- Ding, B.; Sepehrimanesh, M. Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration. Int. J. Mol. Sci. 2021, 22, 4165. [Google Scholar] [CrossRef]
- Soniat, M.; Chook, Y.M. Nuclear localization signals for four distinct karyopherin-beta nuclear import systems. Biochem. J. 2015, 468, 353–362. [Google Scholar] [CrossRef]
- Izaurralde, E.; Kutay, U.; von Kobbe, C.; Mattaj, I.W.; Gorlich, D. The asymmetric distribution of the constituents of the Ran system is essential for transport into and out of the nucleus. EMBO J. 1997, 16, 6535–6547. [Google Scholar] [CrossRef] [PubMed]
- Wen, W.; Meinkoth, J.L.; Tsien, R.Y.; Taylor, S.S. Identification of a signal for rapid export of proteins from the nucleus. Cell 1995, 82, 463–473. [Google Scholar] [CrossRef] [Green Version]
- Moore, M.S. Nuclear pores: David and Goliath in nuclear transport. Curr. Biol. 1995, 5, 1339–1341. [Google Scholar] [CrossRef] [Green Version]
- Bischoff, F.R.; Ponstingl, H. Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1. Nature 1991, 354, 80–82. [Google Scholar] [CrossRef] [PubMed]
- La Cour, T.; Kiemer, L.; Molgaard, A.; Gupta, R.; Skriver, K.; Brunak, S. Analysis and prediction of leucine-rich nuclear export signals. Protein Eng. Des. Sel. 2004, 17, 527–536. [Google Scholar] [CrossRef] [Green Version]
- Mahajan, R.; Delphin, C.; Guan, T.; Gerace, L.; Melchior, F. A small ubiquitin-related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2. Cell 1997, 88, 97–107. [Google Scholar] [CrossRef] [Green Version]
- Lu, J.; Wu, T.; Zhang, B.; Liu, S.; Song, W.; Qiao, J.; Ruan, H. Types of nuclear localization signals and mechanisms of protein import into the nucleus. Cell Commun. Signal. 2021, 19, 60. [Google Scholar] [CrossRef]
- Jakel, S.; Mingot, J.M.; Schwarzmaier, P.; Hartmann, E.; Gorlich, D. Importins fulfil a dual function as nuclear import receptors and cytoplasmic chaperones for exposed basic domains. EMBO J. 2002, 21, 377–386. [Google Scholar] [CrossRef]
- Bradley, K.J.; Bowl, M.R.; Williams, S.E.; Ahmad, B.N.; Partridge, C.J.; Patmanidi, A.L.; Kennedy, A.M.; Loh, N.Y.; Thakker, R.V. Parafibromin is a nuclear protein with a functional monopartite nuclear localization signal. Oncogene 2007, 26, 1213–1221. [Google Scholar] [CrossRef] [Green Version]
- Nguyen Ba, A.N.; Pogoutse, A.; Provart, N.; Moses, A.M. NLStradamus: A simple Hidden Markov Model for nuclear localization signal prediction. BMC Bioinformatics 2009, 10, 202. [Google Scholar] [CrossRef] [Green Version]
- Wang, L.; Li, M.; Cai, M.; Xing, J.; Wang, S.; Zheng, C. A PY-nuclear localization signal is required for nuclear accumulation of HCMV UL79 protein. Med. MicroBiol. Immunol. 2012, 201, 381–387. [Google Scholar] [CrossRef] [PubMed]
- Willis, A.N.; Dean, S.E.; Habbouche, J.A.; Kempers, B.T.; Ludwig, M.L.; Sayfie, A.D.; Lewis, S.P.; Harrier, S.; DeBruine, Z.J.; Garrett, R.; et al. Nuclear localization signal sequence is required for VACM-1/CUL5-dependent regulation of cellular growth. Cell Tissue Res. 2017, 368, 105–114. [Google Scholar] [CrossRef] [PubMed]
- Don-Salu-Hewage, A.S.; Chan, S.Y.; McAndrews, K.M.; Chetram, M.A.; Dawson, M.R.; Bethea, D.A.; Hinton, C.V. Cysteine (C)-x-C receptor 4 undergoes transportin 1-dependent nuclear localization and remains functional at the nucleus of metastatic prostate cancer cells. PLoS ONE 2013, 8, e57194. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cheng, J.H.; Lai, G.H.; Lien, Y.Y.; Sun, F.C.; Hsu, S.L.; Chuang, P.C.; Lee, M.S. Identification of nuclear localization signal and nuclear export signal of VP1 from the chicken anemia virus and effects on VP2 shuttling in cells. Virol. J. 2019, 16, 45. [Google Scholar] [CrossRef]
- Dang, C.V.; Lee, W.M. Identification of the human c-myc protein nuclear translocation signal. Mol. Cell Biol. 1988, 8, 4048–4054. [Google Scholar] [CrossRef]
- Qu, Q.; Sawa, H.; Suzuki, T.; Semba, S.; Henmi, C.; Okada, Y.; Tsuda, M.; Tanaka, S.; Atwood, W.J.; Nagashima, K. Nuclear entry mechanism of the human polyomavirus JC virus-like particle: Role of importins and the nuclear pore complex. J. Biol. Chem. 2004, 279, 27735–27742. [Google Scholar] [CrossRef] [Green Version]
- Richardson, W.D.; Roberts, B.L.; Smith, A.E. Nuclear location signals in polyoma virus large-T. Cell 1986, 44, 77–85. [Google Scholar] [CrossRef]
- Alves, C.; Freitas, N.; Cunha, C. Characterization of the nuclear localization signal of the hepatitis delta virus antigen. Virology 2008, 370, 12–21. [Google Scholar] [CrossRef] [Green Version]
- Chou, H.C.; Hsieh, T.Y.; Sheu, G.T.; Lai, M.M. Hepatitis delta antigen mediates the nuclear import of hepatitis delta virus RNA. J. Virol. 1998, 72, 3684–3690. [Google Scholar] [CrossRef] [Green Version]
- Henkel, T.; Zabel, U.; van Zee, K.; Muller, J.M.; Fanning, E.; Baeuerle, P.A. Intramolecular masking of the nuclear location signal and dimerization domain in the precursor for the p50 NF-kappa B subunit. Cell 1992, 68, 1121–1133. [Google Scholar] [CrossRef]
- Fagerlund, R.; Kinnunen, L.; Kohler, M.; Julkunen, I.; Melen, K. NF-{kappa}B is transported into the nucleus by importin {alpha}3 and importin {alpha}4. J. Biol. Chem. 2005, 280, 15942–15951. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Florio, T.J.; Lokareddy, R.K.; Yeggoni, D.P.; Sankhala, R.S.; Ott, C.A.; Gillilan, R.E.; Cingolani, G. Differential recognition of canonical NF-kappaB dimers by Importin alpha3. Nat. Commun. 2022, 13, 1207. [Google Scholar] [CrossRef] [PubMed]
- Zabel, U.; Henkel, T.; Silva, M.S.; Baeuerle, P.A. Nuclear uptake control of NF-kappa B by MAD-3, an I kappa B protein present in the nucleus. EMBO J. 1993, 12, 201–211. [Google Scholar] [CrossRef] [PubMed]
- Fontes, M.R.; Teh, T.; Kobe, B. Structural basis of recognition of monopartite and bipartite nuclear localization sequences by mammalian importin-alpha. J. Mol. Biol. 2000, 297, 1183–1194. [Google Scholar] [CrossRef]
- Kalderon, D.; Roberts, B.L.; Richardson, W.D.; Smith, A.E. A short amino acid sequence able to specify nuclear location. Cell 1984, 39, 499–509. [Google Scholar] [CrossRef]
- Shaulsky, G.; Goldfinger, N.; Ben-Ze’ev, A.; Rotter, V. Nuclear accumulation of p53 protein is mediated by several nuclear localization signals and plays a role in tumorigenesis. Mol. Cell Biol. 1990, 10, 6565–6577. [Google Scholar] [CrossRef]
- Kim, I.S.; Kim, D.H.; Han, S.M.; Chin, M.U.; Nam, H.J.; Cho, H.P.; Choi, S.Y.; Song, B.J.; Kim, E.R.; Bae, Y.S.; et al. Truncated form of importin alpha identified in breast cancer cell inhibits nuclear import of p53. J. Biol. Chem. 2000, 275, 23139–23145. [Google Scholar] [CrossRef] [Green Version]
- Zhang, X.; Wang, K.S.; Wang, Z.Q.; Xu, L.S.; Wang, Q.W.; Chen, F.; Wei, D.Z.; Han, Z.G. Nuclear localization signal of ING4 plays a key role in its binding to p53. Biochem. Biophys. Res. Commun. 2005, 331, 1032–1038. [Google Scholar] [CrossRef]
- Yamano, S.; Kimura, M.; Chen, Y.; Imamoto, N.; Ohki, R. Nuclear import of IER5 is mediated by a classical bipartite nuclear localization signal and is required for HSF1 full activation. Exp. Cell Res. 2020, 386, 111686. [Google Scholar] [CrossRef]
- Yan, C.; Luo, H.; Lee, J.D.; Abe, J.; Berk, B.C. Molecular cloning of mouse ERK5/BMK1 splice variants and characterization of ERK5 functional domains. J. Biol. Chem. 2001, 276, 10870–10878. [Google Scholar] [CrossRef] [Green Version]
- James, B.P.; Bunch, T.A.; Krishnamoorthy, S.; Perkins, L.A.; Brower, D.L. Nuclear localization of the ERK MAP kinase mediated by Drosophila alphaPS2betaPS integrin and importin-7. Mol. Biol. Cell 2007, 18, 4190–4199. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Matsuura, Y. Structural and biochemical characterization of the recognition of the 53BP1 nuclear localization signal by importin-alpha. Biochem. Biophys. Res. Commun. 2019, 510, 236–241. [Google Scholar] [CrossRef]
- Picard, D.; Yamamoto, K.R. Two signals mediate hormone-dependent nuclear localization of the glucocorticoid receptor. EMBO J. 1987, 6, 3333–3340. [Google Scholar] [CrossRef] [PubMed]
- Freedman, N.D.; Yamamoto, K.R. Importin 7 and importin alpha/importin beta are nuclear import receptors for the glucocorticoid receptor. Mol. Biol. Cell 2004, 15, 2276–2286. [Google Scholar] [CrossRef] [PubMed]
- Nemergut, M.E.; Macara, I.G. Nuclear import of the ran exchange factor, RCC1, is mediated by at least two distinct mechanisms. J. Cell Biol. 2000, 149, 835–850. [Google Scholar] [CrossRef] [Green Version]
- Lange, A.; Mills, R.E.; Devine, S.E.; Corbett, A.H. A PY-NLS nuclear targeting signal is required for nuclear localization and function of the Saccharomyces cerevisiae mRNA-binding protein Hrp1. J. Biol. Chem. 2008, 283, 12926–12934. [Google Scholar] [CrossRef] [Green Version]
- Springhower, C.E.; Rosen, M.K.; Chook, Y.M. Karyopherins and condensates. Curr. Opin. Cell Biol. 2020, 64, 112–123. [Google Scholar] [CrossRef] [PubMed]
- Niu, C.; Zhang, J.; Gao, F.; Yang, L.; Jia, M.; Zhu, H.; Gong, W. FUS-NLS/Transportin 1 complex structure provides insights into the nuclear targeting mechanism of FUS and the implications in ALS. PLoS ONE 2012, 7, e47056. [Google Scholar] [CrossRef]
- Kaffman, A.; Rank, N.M.; O’Shea, E.K. Phosphorylation regulates association of the transcription factor Pho4 with its import receptor Pse1/Kap121. Genes Dev. 1998, 12, 2673–2683. [Google Scholar] [CrossRef] [Green Version]
- Jakel, S.; Gorlich, D. Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells. EMBO J. 1998, 17, 4491–4502. [Google Scholar] [CrossRef] [Green Version]
- Ohshima, K.; Takeda, S.; Hirose, M.; Akiyama, Y.; Iguchi, K.; Hoshino, M.; Yamaguchi, K.; Mochizuki, T. Structure-function relationship of the nuclear localization signal sequence of parathyroid hormone-related protein. Biomed. Res. 2012, 33, 191–199. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shibata, A.; Machida, J.; Yamaguchi, S.; Kimura, M.; Tatematsu, T.; Miyachi, H.; Nakayama, A.; Shimozato, K.; Tokita, Y. Identification of nuclear localization signals in the human homeoprotein MSX1. Biochem. Cell Biol. 2018, 96, 483–489. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ye, J.; Zhong, L.; Xiong, L.; Li, J.; Yu, L.; Dan, W.; Yuan, Z.; Yao, J.; Zhong, P.; Liu, J.; et al. Nuclear import of NLS- RARalpha is mediated by importin alpha/beta. Cell Signal. 2020, 69, 109567. [Google Scholar] [CrossRef] [PubMed]
- Goldfarb, D.S.; Corbett, A.H.; Mason, D.A.; Harreman, M.T.; Adam, S.A. Importin alpha: A multipurpose nuclear-transport receptor. Trends Cell Biol. 2004, 14, 505–514. [Google Scholar] [CrossRef]
- Herold, A.; Truant, R.; Wiegand, H.; Cullen, B.R. Determination of the functional domain organization of the importin alpha nuclear import factor. J. Cell Biol. 1998, 143, 309–318. [Google Scholar] [CrossRef] [Green Version]
- Pumroy, R.A.; Cingolani, G. Diversification of importin-alpha isoforms in cellular trafficking and disease states. Biochem. J. 2015, 466, 13–28. [Google Scholar] [CrossRef] [Green Version]
- Chook, Y.M.; Suel, K.E. Nuclear import by karyopherin-betas: Recognition and inhibition. Biochim. Biophys. Acta 2011, 1813, 1593–1606. [Google Scholar] [CrossRef] [Green Version]
- Kimura, M.; Morinaka, Y.; Imai, K.; Kose, S.; Horton, P.; Imamoto, N. Extensive cargo identification reveals distinct biological roles of the 12 importin pathways. Elife 2017, 6, 807. [Google Scholar] [CrossRef] [Green Version]
- Strom, A.C.; Weis, K. Importin-beta-like nuclear transport receptors. Genome Biol. 2001, 2, REVIEWS3008. [Google Scholar] [CrossRef] [Green Version]
- Adam, E.J.; Adam, S.A. Identification of cytosolic factors required for nuclear location sequence-mediated binding to the nuclear envelope. J. Cell Biol. 1994, 125, 547–555. [Google Scholar] [CrossRef] [Green Version]
- Gorlich, D.; Kostka, S.; Kraft, R.; Dingwall, C.; Laskey, R.A.; Hartmann, E.; Prehn, S. Two different subunits of importin cooperate to recognize nuclear localization signals and bind them to the nuclear envelope. Curr. Biol. 1995, 5, 383–392. [Google Scholar] [CrossRef] [Green Version]
- Lee, B.J.; Cansizoglu, A.E.; Suel, K.E.; Louis, T.H.; Zhang, Z.; Chook, Y.M. Rules for nuclear localization sequence recognition by karyopherin beta 2. Cell 2006, 126, 543–558. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rexach, M.; Blobel, G. Protein import into nuclei: Association and dissociation reactions involving transport substrate, transport factors, and nucleoporins. Cell 1995, 83, 683–692. [Google Scholar] [CrossRef] [Green Version]
- Guo, L.; Fare, C.M.; Shorter, J. Therapeutic Dissolution of Aberrant Phases by Nuclear-Import Receptors. Trends Cell Biol. 2019, 29, 308–322. [Google Scholar] [CrossRef] [PubMed]
- Stewart, M. Molecular mechanism of the nuclear protein import cycle. Nat. Rev. Mol. Cell Biol. 2007, 8, 195–208. [Google Scholar] [CrossRef] [PubMed]
- Fukuda, M.; Asano, S.; Nakamura, T.; Adachi, M.; Yoshida, M.; Yanagida, M.; Nishida, E. CRM1 is responsible for intracellular transport mediated by the nuclear export signal. Nature 1997, 390, 308–311. [Google Scholar] [CrossRef]
- Fung, H.Y.; Fu, S.C.; Chook, Y.M. Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals. Elife 2017, 6, e23961. [Google Scholar] [CrossRef]
- Fung, H.Y.; Fu, S.C.; Brautigam, C.A.; Chook, Y.M. Structural determinants of nuclear export signal orientation in binding to exportin CRM1. Elife 2015, 4, e10034. [Google Scholar] [CrossRef]
- Hutten, S.; Kehlenbach, R.H. CRM1-mediated nuclear export: To the pore and beyond. Trends Cell Biol. 2007, 17, 193–201. [Google Scholar] [CrossRef]
- Michael, W.M.; Choi, M.; Dreyfuss, G. A nuclear export signal in hnRNP A1: A signal-mediated, temperature-dependent nuclear protein export pathway. Cell 1995, 83, 415–422. [Google Scholar] [CrossRef] [Green Version]
- Xu, D.; Farmer, A.; Collett, G.; Grishin, N.V.; Chook, Y.M. Sequence and structural analyses of nuclear export signals in the NESdb database. Mol. Biol. Cell 2012, 23, 3677–3693. [Google Scholar] [CrossRef] [PubMed]
- Pemberton, L.F.; Blobel, G.; Rosenblum, J.S. Transport routes through the nuclear pore complex. Curr. Opin. Cell Biol. 1998, 10, 392–399. [Google Scholar] [CrossRef]
- Lipowsky, G.; Bischoff, F.R.; Schwarzmaier, P.; Kraft, R.; Kostka, S.; Hartmann, E.; Kutay, U.; Gorlich, D. Exportin 4: A mediator of a novel nuclear export pathway in higher eukaryotes. EMBO J. 2000, 19, 4362–4371. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xu, D.; Farmer, A.; Chook, Y.M. Recognition of nuclear targeting signals by Karyopherin-beta proteins. Curr. Opin. Struct. Biol. 2010, 20, 782–790. [Google Scholar] [CrossRef] [Green Version]
- Stuven, T.; Hartmann, E.; Gorlich, D. Exportin 6: A novel nuclear export receptor that is specific for profilin.actin complexes. EMBO J. 2003, 22, 5928–5940. [Google Scholar] [CrossRef] [Green Version]
- Pinarbasi, E.S.; Cagatay, T.; Fung, H.Y.J.; Li, Y.C.; Chook, Y.M.; Thomas, P.J. Active nuclear import and passive nuclear export are the primary determinants of TDP-43 localization. Sci. Rep. 2018, 8, 7083. [Google Scholar] [CrossRef] [Green Version]
- Winton, M.J.; Igaz, L.M.; Wong, M.M.; Kwong, L.K.; Trojanowski, J.Q.; Lee, V.M. Disturbance of nuclear and cytoplasmic TAR DNA-binding protein (TDP-43) induces disease-like redistribution, sequestration, and aggregate formation. J. Biol. Chem. 2008, 283, 13302–13309. [Google Scholar] [CrossRef] [Green Version]
- Kino, Y.; Washizu, C.; Aquilanti, E.; Okuno, M.; Kurosawa, M.; Yamada, M.; Doi, H.; Nukina, N. Intracellular localization and splicing regulation of FUS/TLS are variably affected by amyotrophic lateral sclerosis-linked mutations. Nucleic Acids Res. 2011, 39, 2781–2798. [Google Scholar] [CrossRef]
- Ederle, H.; Funk, C.; Abou-Ajram, C.; Hutten, S.; Funk, E.B.E.; Kehlenbach, R.H.; Bailer, S.M.; Dormann, D. Nuclear egress of TDP-43 and FUS occurs independently of Exportin-1/CRM1. Sci. Rep. 2018, 8, 7084. [Google Scholar] [CrossRef]
- Brangwynne, C.P.; Eckmann, C.R.; Courson, D.S.; Rybarska, A.; Hoege, C.; Gharakhani, J.; Julicher, F.; Hyman, A.A. Germline P granules are liquid droplets that localize by controlled dissolution/condensation. Science 2009, 324, 1729–1732. [Google Scholar] [CrossRef]
- Mao, Y.S.; Zhang, B.; Spector, D.L. Biogenesis and function of nuclear bodies. Trends Genet. 2011, 27, 295–306. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Azaldegui, C.A.; Vecchiarelli, A.G.; Biteen, J.S. The emergence of phase separation as an organizing principle in bacteria. Biophys J. 2021, 120, 1123–1138. [Google Scholar] [CrossRef] [PubMed]
- Mittag, T.; Parker, R. Multiple Modes of Protein-Protein Interactions Promote RNP Granule Assembly. J. Mol. Biol. 2018, 430, 4636–4649. [Google Scholar] [CrossRef] [PubMed]
- Brocca, S.; Grandori, R.; Longhi, S.; Uversky, V. Liquid-Liquid Phase Separation by Intrinsically Disordered Protein Regions of Viruses: Roles in Viral Life Cycle and Control of Virus-Host Interactions. Int. J. Mol. Sci. 2020, 21, 9045. [Google Scholar] [CrossRef]
- Wang, J.; Choi, J.M.; Holehouse, A.S.; Lee, H.O.; Zhang, X.; Jahnel, M.; Maharana, S.; Lemaitre, R.; Pozniakovsky, A.; Drechsel, D.; et al. A Molecular Grammar Governing the Driving Forces for Phase Separation of Prion-like RNA Binding Proteins. Cell 2018, 174, 688–699.e616. [Google Scholar] [CrossRef] [Green Version]
- Gao, Z.; Zhang, W.; Chang, R.; Zhang, S.; Yang, G.; Zhao, G. Liquid-Liquid Phase Separation: Unraveling the Enigma of Biomolecular Condensates in Microbial Cells. Front. MicroBiol. 2021, 12, 751880. [Google Scholar] [CrossRef]
- Carey, J.L.; Guo, L. Liquid-Liquid Phase Separation of TDP-43 and FUS in Physiology and Pathology of Neurodegenerative Diseases. Front. Mol. Biosci. 2022, 9, 826719. [Google Scholar] [CrossRef]
- Ambadipudi, S.; Biernat, J.; Riedel, D.; Mandelkow, E.; Zweckstetter, M. Liquid-liquid phase separation of the microtubule-binding repeats of the Alzheimer-related protein Tau. Nat. Commun. 2017, 8, 275. [Google Scholar] [CrossRef] [Green Version]
- Martin, E.W.; Holehouse, A.S. Intrinsically disordered protein regions and phase separation: Sequence determinants of assembly or lack thereof. Emerg. Top. Life Sci. 2020, 4, 307–329. [Google Scholar] [CrossRef]
- Efimova, A.D.; Ovchinnikov, R.K.; Roman, A.Y.; Maltsev, A.V.; Grigoriev, V.V.; Kovrazhkina, E.A.; Skvortsova, V.I. The FUS protein: Physiological functions and a role in amyotrophic lateral sclerosis. Mol. Biol. 2017, 51, 387–399. [Google Scholar] [CrossRef]
- Fujii, R.; Takumi, T. TLS facilitates transport of mRNA encoding an actin-stabilizing protein to dendritic spines. J. Cell Sci. 2005, 118, 5755–5765. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Crozat, A.; Aman, P.; Mandahl, N.; Ron, D. Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma. Nature 1993, 363, 640–644. [Google Scholar] [CrossRef] [PubMed]
- Iko, Y.; Kodama, T.S.; Kasai, N.; Oyama, T.; Morita, E.H.; Muto, T.; Okumura, M.; Fujii, R.; Takumi, T.; Tate, S.; et al. Domain architectures and characterization of an RNA-binding protein, TLS. J. Biol. Chem. 2004, 279, 44834–44840. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vance, C.; Rogelj, B.; Hortobagyi, T.; De Vos, K.J.; Nishimura, A.L.; Sreedharan, J.; Hu, X.; Smith, B.; Ruddy, D.; Wright, P.; et al. Mutations in FUS, an RNA processing protein, cause familial amyotrophic lateral sclerosis type 6. Science 2009, 323, 1208–1211. [Google Scholar] [CrossRef] [Green Version]
- Kwiatkowski, T.J., Jr.; Bosco, D.A.; Leclerc, A.L.; Tamrazian, E.; Vanderburg, C.R.; Russ, C.; Davis, A.; Gilchrist, J.; Kasarskis, E.J.; Munsat, T.; et al. Mutations in the FUS/TLS gene on chromosome 16 cause familial amyotrophic lateral sclerosis. Science 2009, 323, 1205–1208. [Google Scholar] [CrossRef] [Green Version]
- Schwartz, J.C.; Wang, X.; Podell, E.R.; Cech, T.R. RNA seeds higher-order assembly of FUS protein. Cell Rep. 2013, 5, 918–925. [Google Scholar] [CrossRef] [Green Version]
- Owen, I.; Shewmaker, F. The Role of Post-Translational Modifications in the Phase Transitions of Intrinsically Disordered Proteins. Int. J. Mol. Sci. 2019, 20, 5501. [Google Scholar] [CrossRef] [Green Version]
- Monahan, Z.; Ryan, V.H.; Janke, A.M.; Burke, K.A.; Rhoads, S.N.; Zerze, G.H.; O’Meally, R.; Dignon, G.L.; Conicella, A.E.; Zheng, W.; et al. Phosphorylation of the FUS low-complexity domain disrupts phase separation, aggregation, and toxicity. EMBO J. 2017, 36, 2951–2967. [Google Scholar] [CrossRef]
- Hofweber, M.; Dormann, D. Friend or foe-Post-translational modifications as regulators of phase separation and RNP granule dynamics. J. Biol. Chem. 2019, 294, 7137–7150. [Google Scholar] [CrossRef] [Green Version]
- Owen, I.; Rhoads, S.; Yee, D.; Wyne, H.; Gery, K.; Hannula, I.; Sundrum, M.; Shewmaker, F. The prion-like domain of Fused in Sarcoma is phosphorylated by multiple kinases affecting liquid- and solid-phase transitions. Mol. Biol. Cell 2020, 31, 2522–2536. [Google Scholar] [CrossRef]
- Li, H.R.; Chen, T.C.; Hsiao, C.L.; Shi, L.; Chou, C.Y.; Huang, J.R. The physical forces mediating self-association and phase-separation in the C-terminal domain of TDP-43. Biochim. Biophys. Acta Proteins Proteom. 2018, 1866, 214–223. [Google Scholar] [CrossRef] [PubMed]
- Conicella, A.E.; Dignon, G.L.; Zerze, G.H.; Schmidt, H.B.; D’Ordine, A.M.; Kim, Y.C.; Rohatgi, R.; Ayala, Y.M.; Mittal, J.; Fawzi, N.L. TDP-43 alpha-helical structure tunes liquid-liquid phase separation and function. Proc. Natl. Acad. Sci. USA 2020, 117, 5883–5894. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Conicella, A.E.; Zerze, G.H.; Mittal, J.; Fawzi, N.L. ALS Mutations Disrupt Phase Separation Mediated by alpha-Helical Structure in the TDP-43 Low-Complexity C-Terminal Domain. Structure 2016, 24, 1537–1549. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- McGurk, L.; Gomes, E.; Guo, L.; Mojsilovic-Petrovic, J.; Tran, V.; Kalb, R.G.; Shorter, J.; Bonini, N.M. Poly(ADP-Ribose) Prevents Pathological Phase Separation of TDP-43 by Promoting Liquid Demixing and Stress Granule Localization. Mol. Cell 2018, 71, 703–717.e709. [Google Scholar] [CrossRef] [Green Version]
- Nanaura, H.; Kawamukai, H.; Fujiwara, A.; Uehara, T.; Aiba, Y.; Nakanishi, M.; Shiota, T.; Hibino, M.; Wiriyasermkul, P.; Kikuchi, S.; et al. C9orf72-derived arginine-rich poly-dipeptides impede phase modifiers. Nat. Commun. 2021, 12, 5301. [Google Scholar] [CrossRef]
- Barmada, S.J.; Serio, A.; Arjun, A.; Bilican, B.; Daub, A.; Ando, D.M.; Tsvetkov, A.; Pleiss, M.; Li, X.; Peisach, D.; et al. Autophagy induction enhances TDP43 turnover and survival in neuronal ALS models. Nat. Chem. Biol. 2014, 10, 677–685. [Google Scholar] [CrossRef] [Green Version]
- Clarke, J.P.; Thibault, P.A.; Salapa, H.E.; Levin, M.C. A Comprehensive Analysis of the Role of hnRNP A1 Function and Dysfunction in the Pathogenesis of Neurodegenerative Disease. Front. Mol. Biosci. 2021, 8, 659610. [Google Scholar] [CrossRef]
- Siomi, H.; Dreyfuss, G. A nuclear localization domain in the hnRNP A1 protein. J. Cell Biol. 1995, 129, 551–560. [Google Scholar] [CrossRef]
- Rebane, A.; Aab, A.; Steitz, J.A. Transportins 1 and 2 are redundant nuclear import factors for hnRNP A1 and HuR. RNA 2004, 10, 590–599. [Google Scholar] [CrossRef] [Green Version]
- Ding, J.; Hayashi, M.K.; Zhang, Y.; Manche, L.; Krainer, A.R.; Xu, R.M. Crystal structure of the two-RRM domain of hnRNP A1 (UP1) complexed with single-stranded telomeric DNA. Genes Dev. 1999, 13, 1102–1115. [Google Scholar] [CrossRef] [Green Version]
- Jean-Philippe, J.; Paz, S.; Caputi, M. hnRNP A1: The Swiss army knife of gene expression. Int. J. Mol. Sci. 2013, 14, 18999–19024. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pinol-Roma, S.; Dreyfuss, G. Shuttling of pre-mRNA binding proteins between nucleus and cytoplasm. Nature 1992, 355, 730–732. [Google Scholar] [CrossRef]
- Mili, S.; Shu, H.J.; Zhao, Y.; Pinol-Roma, S. Distinct RNP complexes of shuttling hnRNP proteins with pre-mRNA and mRNA: Candidate intermediates in formation and export of mRNA. Mol. Cell Biol. 2001, 21, 7307–7319. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Guil, S.; Caceres, J.F. The multifunctional RNA-binding protein hnRNP A1 is required for processing of miR-18a. Nat. Struct. Mol. Biol. 2007, 14, 591–596. [Google Scholar] [CrossRef] [PubMed]
- Michlewski, G.; Caceres, J.F. Antagonistic role of hnRNP A1 and KSRP in the regulation of let-7a biogenesis. Nat. Struct. Mol. Biol. 2010, 17, 1011–1018. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Martin, E.W.; Thomasen, F.E.; Milkovic, N.M.; Cuneo, M.J.; Grace, C.R.; Nourse, A.; Lindorff-Larsen, K.; Mittag, T. Interplay of folded domains and the disordered low-complexity domain in mediating hnRNPA1 phase separation. Nucleic Acids Res. 2021, 49, 2931–2945. [Google Scholar] [CrossRef]
- Gui, X.; Luo, F.; Li, Y.; Zhou, H.; Qin, Z.; Liu, Z.; Gu, J.; Xie, M.; Zhao, K.; Dai, B.; et al. Structural basis for reversible amyloids of hnRNPA1 elucidates their role in stress granule assembly. Nat. Commun. 2019, 10, 2006. [Google Scholar] [CrossRef] [Green Version]
- Chou, C.C.; Zhang, Y.; Umoh, M.E.; Vaughan, S.W.; Lorenzini, I.; Liu, F.; Sayegh, M.; Donlin-Asp, P.G.; Chen, Y.H.; Duong, D.M.; et al. TDP-43 pathology disrupts nuclear pore complexes and nucleocytoplasmic transport in ALS/FTD. Nat. Neurosci. 2018, 21, 228–239. [Google Scholar] [CrossRef] [Green Version]
- Sakuma, S.; D’Angelo, M.A. The roles of the nuclear pore complex in cellular dysfunction, aging and disease. Semin. Cell Dev. Biol. 2017, 68, 72–84. [Google Scholar] [CrossRef]
- Jackson, W.S.; Tallaksen-Greene, S.J.; Albin, R.L.; Detloff, P.J. Nucleocytoplasmic transport signals affect the age at onset of abnormalities in knock-in mice expressing polyglutamine within an ectopic protein context. Hum. Mol. Genet. 2003, 12, 1621–1629. [Google Scholar] [CrossRef] [Green Version]
- Ruz, C.; Alcantud, J.L.; Vives Montero, F.; Duran, R.; Bandres-Ciga, S. Proteotoxicity and Neurodegenerative Diseases. Int. J. Mol. Sci. 2020, 21, 5646. [Google Scholar] [CrossRef]
- Giampetruzzi, A.; Danielson, E.W.; Gumina, V.; Jeon, M.; Boopathy, S.; Brown, R.H.; Ratti, A.; Landers, J.E.; Fallini, C. Modulation of actin polymerization affects nucleocytoplasmic transport in multiple forms of amyotrophic lateral sclerosis. Nat. Commun. 2019, 10, 3827. [Google Scholar] [CrossRef] [Green Version]
- Bennett, C.L.; Dastidar, S.G.; Ling, S.C.; Malik, B.; Ashe, T.; Wadhwa, M.; Miller, D.B.; Lee, C.; Mitchell, M.B.; van Es, M.A.; et al. Senataxin mutations elicit motor neuron degeneration phenotypes and yield TDP-43 mislocalization in ALS4 mice and human patients. Acta Neuropathol. 2018, 136, 425–443. [Google Scholar] [CrossRef]
- Hirano, M.; Quinzii, C.M.; Mitsumoto, H.; Hays, A.P.; Roberts, J.K.; Richard, P.; Rowland, L.P. Senataxin mutations and amyotrophic lateral sclerosis. Amyotroph Lateral Scler 2011, 12, 223–227. [Google Scholar] [CrossRef]
- Tran, D.; Chalhoub, A.; Schooley, A.; Zhang, W.; Ngsee, J.K. A mutation in VAPB that causes amyotrophic lateral sclerosis also causes a nuclear envelope defect. J. Cell Sci. 2012, 125, 2831–2836. [Google Scholar] [CrossRef] [Green Version]
- Aizawa, H.; Yamashita, T.; Kato, H.; Kimura, T.; Kwak, S. Impaired Nucleoporins Are Present in Sporadic Amyotrophic Lateral Sclerosis Motor Neurons that Exhibit Mislocalization of the 43-kDa TAR DNA-Binding Protein. J. Clin. Neurol. 2019, 15, 62–67. [Google Scholar] [CrossRef]
- Roczniak-Ferguson, A.; Ferguson, S.M. Pleiotropic requirements for human TDP-43 in the regulation of cell and organelle homeostasis. Life Sci. Alliance 2019, 2, e201900358. [Google Scholar] [CrossRef] [Green Version]
- Cornelison, G.L.; Levy, S.A.; Jenson, T.; Frost, B. Tau-induced nuclear envelope invagination causes a toxic accumulation of mRNA in Drosophila. Aging Cell 2019, 18, e12847. [Google Scholar] [CrossRef] [Green Version]
- Sheffield, L.G.; Miskiewicz, H.B.; Tannenbaum, L.B.; Mirra, S.S. Nuclear pore complex proteins in Alzheimer disease. J. Neuropathol. Exp. Neurol. 2006, 65, 45–54. [Google Scholar] [CrossRef] [Green Version]
- Metuzals, J.; Robitaille, Y.; Houghton, S.; Gauthier, S.; Leblanc, R. Paired helical filaments and the cytoplasmic-nuclear interface in Alzheimer’s disease. J. Neurocytol. 1988, 17, 827–833. [Google Scholar] [CrossRef]
- Monroy-Ramirez, H.C.; Basurto-Islas, G.; Mena, R.; Cisneros, B.; Binder, L.I.; Avila, J.; Garcia-Sierra, F. Alterations in the nuclear architecture produced by the overexpression of tau protein in neuroblastoma cells. J. Alzheimers Dis. 2013, 36, 503–520. [Google Scholar] [CrossRef]
- Liu, K.Y.; Shyu, Y.C.; Barbaro, B.A.; Lin, Y.T.; Chern, Y.; Thompson, L.M.; James Shen, C.K.; Marsh, J.L. Disruption of the nuclear membrane by perinuclear inclusions of mutant huntingtin causes cell-cycle re-entry and striatal cell death in mouse and cell models of Huntington’s disease. Hum. Mol. Genet. 2015, 24, 1602–1616. [Google Scholar] [CrossRef] [Green Version]
- Rowland, L.P.; Shneider, N.A. Amyotrophic lateral sclerosis. N. Engl. J. Med. 2001, 344, 1688–1700. [Google Scholar] [CrossRef]
- Mitchell, J.D.; Borasio, G.D. Amyotrophic lateral sclerosis. Lancet 2007, 369, 2031–2041. [Google Scholar] [CrossRef]
- Renton, A.E.; Chio, A.; Traynor, B.J. State of play in amyotrophic lateral sclerosis genetics. Nat. Neurosci. 2014, 17, 17–23. [Google Scholar] [CrossRef]
- Taylor, J.P.; Brown, R.H., Jr.; Cleveland, D.W. Decoding ALS: From genes to mechanism. Nature 2016, 539, 197–206. [Google Scholar] [CrossRef] [Green Version]
- Rabinovici, G.D.; Miller, B.L. Frontotemporal lobar degeneration: Epidemiology, pathophysiology, diagnosis and management. CNS Drugs 2010, 24, 375–398. [Google Scholar] [CrossRef]
- Seltman, R.E.; Matthews, B.R. Frontotemporal lobar degeneration: Epidemiology, pathology, diagnosis and management. CNS Drugs 2012, 26, 841–870. [Google Scholar] [CrossRef]
- Knopman, D.S.; Roberts, R.O. Estimating the number of persons with frontotemporal lobar degeneration in the US population. J. Mol. Neurosci. 2011, 45, 330–335. [Google Scholar] [CrossRef] [Green Version]
- Ferrari, R.; Kapogiannis, D.; Huey, E.D.; Momeni, P. FTD and ALS: A tale of two diseases. Curr. Alzheimer Res. 2011, 8, 273–294. [Google Scholar] [CrossRef]
- Mackenzie, I.R.; Feldman, H.H. Ubiquitin immunohistochemistry suggests classic motor neuron disease, motor neuron disease with dementia, and frontotemporal dementia of the motor neuron disease type represent a clinicopathologic spectrum. J. Neuropathol. Exp. Neurol. 2005, 64, 730–739. [Google Scholar] [CrossRef] [Green Version]
- Abrahams, S.; Goldstein, L.H.; Simmons, A.; Brammer, M.; Williams, S.C.; Giampietro, V.; Leigh, P.N. Word retrieval in amyotrophic lateral sclerosis: A functional magnetic resonance imaging study. Brain 2004, 127, 1507–1517. [Google Scholar] [CrossRef]
- Liscic, R.M.; Grinberg, L.T.; Zidar, J.; Gitcho, M.A.; Cairns, N.J. ALS and FTLD: Two faces of TDP-43 proteinopathy. Eur. J. Neurol. 2008, 15, 772–780. [Google Scholar] [CrossRef]
- Rosen, D.R.; Siddique, T.; Patterson, D.; Figlewicz, D.A.; Sapp, P.; Hentati, A.; Donaldson, D.; Goto, J.; O’Regan, J.P.; Deng, H.X.; et al. Mutations in Cu/Zn superoxide dismutase gene are associated with familial amyotrophic lateral sclerosis. Nature 1993, 362, 59–62. [Google Scholar] [CrossRef]
- DeJesus-Hernandez, M.; Mackenzie, I.R.; Boeve, B.F.; Boxer, A.L.; Baker, M.; Rutherford, N.J.; Nicholson, A.M.; Finch, N.A.; Flynn, H.; Adamson, J.; et al. Expanded GGGGCC hexanucleotide repeat in noncoding region of C9ORF72 causes chromosome 9p-linked FTD and ALS. Neuron 2011, 72, 245–256. [Google Scholar] [CrossRef] [Green Version]
- Wilhelmsen, K.C. Frontotemporal dementia is on the MAPtau. Ann. Neurol. 1997, 41, 139–140. [Google Scholar] [CrossRef]
- Spillantini, M.G.; Murrell, J.R.; Goedert, M.; Farlow, M.R.; Klug, A.; Ghetti, B. Mutation in the tau gene in familial multiple system tauopathy with presenile dementia. Proc. Natl. Acad. Sci. USA 1998, 95, 7737–7741. [Google Scholar] [CrossRef] [Green Version]
- Gass, J.; Cannon, A.; Mackenzie, I.R.; Boeve, B.; Baker, M.; Adamson, J.; Crook, R.; Melquist, S.; Kuntz, K.; Petersen, R.; et al. Mutations in progranulin are a major cause of ubiquitin-positive frontotemporal lobar degeneration. Hum. Mol. Genet. 2006, 15, 2988–3001. [Google Scholar] [CrossRef] [Green Version]
- Cruts, M.; Kumar-Singh, S.; Van Broeckhoven, C. Progranulin mutations in ubiquitin-positive frontotemporal dementia linked to chromosome 17q21. Curr. Alzheimer Res. 2006, 3, 485–491. [Google Scholar] [CrossRef]
- Elden, A.C.; Kim, H.J.; Hart, M.P.; Chen-Plotkin, A.S.; Johnson, B.S.; Fang, X.; Armakola, M.; Geser, F.; Greene, R.; Lu, M.M.; et al. Ataxin-2 intermediate-length polyglutamine expansions are associated with increased risk for ALS. Nature 2010, 466, 1069–1075. [Google Scholar] [CrossRef]
- Maruyama, H.; Morino, H.; Ito, H.; Izumi, Y.; Kato, H.; Watanabe, Y.; Kinoshita, Y.; Kamada, M.; Nodera, H.; Suzuki, H.; et al. Mutations of optineurin in amyotrophic lateral sclerosis. Nature 2010, 465, 223–226. [Google Scholar] [CrossRef]
- Johnson, J.O.; Mandrioli, J.; Benatar, M.; Abramzon, Y.; Van Deerlin, V.M.; Trojanowski, J.Q.; Gibbs, J.R.; Brunetti, M.; Gronka, S.; Wuu, J.; et al. Exome sequencing reveals VCP mutations as a cause of familial ALS. Neuron 2010, 68, 857–864. [Google Scholar] [CrossRef] [Green Version]
- Wu, C.H.; Fallini, C.; Ticozzi, N.; Keagle, P.J.; Sapp, P.C.; Piotrowska, K.; Lowe, P.; Koppers, M.; McKenna-Yasek, D.; Baron, D.M.; et al. Mutations in the profilin 1 gene cause familial amyotrophic lateral sclerosis. Nature 2012, 488, 499–503. [Google Scholar] [CrossRef]
- Deng, H.X.; Chen, W.; Hong, S.T.; Boycott, K.M.; Gorrie, G.H.; Siddique, N.; Yang, Y.; Fecto, F.; Shi, Y.; Zhai, H.; et al. Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. Nature 2011, 477, 211–215. [Google Scholar] [CrossRef] [Green Version]
- Brenner, D.; Muller, K.; Wieland, T.; Weydt, P.; Bohm, S.; Lule, D.; Hubers, A.; Neuwirth, C.; Weber, M.; Borck, G.; et al. NEK1 mutations in familial amyotrophic lateral sclerosis. Brain 2016, 139, e28. [Google Scholar] [CrossRef] [Green Version]
- Johnson, J.O.; Pioro, E.P.; Boehringer, A.; Chia, R.; Feit, H.; Renton, A.E.; Pliner, H.A.; Abramzon, Y.; Marangi, G.; Winborn, B.J.; et al. Mutations in the Matrin 3 gene cause familial amyotrophic lateral sclerosis. Nat. Neurosci. 2014, 17, 664–666. [Google Scholar] [CrossRef]
- Woo, J.A.; Liu, T.; Trotter, C.; Fang, C.C.; De Narvaez, E.; LePochat, P.; Maslar, D.; Bukhari, A.; Zhao, X.; Deonarine, A.; et al. Loss of function CHCHD10 mutations in cytoplasmic TDP-43 accumulation and synaptic integrity. Nat. Commun. 2017, 8, 15558. [Google Scholar] [CrossRef]
- Oakes, J.A.; Davies, M.C.; Collins, M.O. TBK1: A new player in ALS linking autophagy and neuroinflammation. Mol. Brain 2017, 10, 5. [Google Scholar] [CrossRef] [Green Version]
- Nicolas, A.; Kenna, K.P.; Renton, A.E.; Ticozzi, N.; Faghri, F.; Chia, R.; Dominov, J.A.; Kenna, B.J.; Nalls, M.A.; Keagle, P.; et al. Genome-wide Analyses Identify KIF5A as a Novel ALS Gene. Neuron 2018, 97, 1268–1283.e1266. [Google Scholar] [CrossRef] [Green Version]
- Neumann, M.; Mackenzie, I.R.; Cairns, N.J.; Boyer, P.J.; Markesbery, W.R.; Smith, C.D.; Taylor, J.P.; Kretzschmar, H.A.; Kimonis, V.E.; Forman, M.S. TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations. J. Neuropathol. Exp. Neurol. 2007, 66, 152–157. [Google Scholar] [CrossRef] [Green Version]
- Rubino, E.; Rainero, I.; Chio, A.; Rogaeva, E.; Galimberti, D.; Fenoglio, P.; Grinberg, Y.; Isaia, G.; Calvo, A.; Gentile, S.; et al. SQSTM1 mutations in frontotemporal lobar degeneration and amyotrophic lateral sclerosis. Neurology 2012, 79, 1556–1562. [Google Scholar] [CrossRef] [Green Version]
- Dominguez, J.; Yu, J.T.; Tan, Y.J.; Ng, A.; De Guzman, M.F.; Natividad, B.; Daroy, M.L.; Cano, J.; Yu, J.; Lian, M.M.; et al. Novel Optineurin Frameshift Insertion in a Family With Frontotemporal Dementia and Parkinsonism Without Amyotrophic Lateral Sclerosis. Front. Neurol. 2021, 12, 645913. [Google Scholar] [CrossRef]
- Renaud, L.; Picher-Martel, V.; Codron, P.; Julien, J.P. Key role of UBQLN2 in pathogenesis of amyotrophic lateral sclerosis and frontotemporal dementia. Acta Neuropathol. Commun. 2019, 7, 103. [Google Scholar] [CrossRef]
- Harding, O.; Evans, C.S.; Ye, J.; Cheung, J.; Maniatis, T.; Holzbaur, E.L.F. ALS- and FTD-associated missense mutations in TBK1 differentially disrupt mitophagy. Proc. Natl. Acad. Sci. USA 2021, 118, e2025053118. [Google Scholar] [CrossRef]
- Braun, R.J. Ubiquitin-dependent proteolysis in yeast cells expressing neurotoxic proteins. Front. Mol. Neurosci. 2015, 8, 8. [Google Scholar] [CrossRef] [Green Version]
- Budini, M.; Buratti, E.; Morselli, E.; Criollo, A. Autophagy and Its Impact on Neurodegenerative Diseases: New Roles for TDP-43 and C9orf72. Front. Mol. Neurosci. 2017, 10, 170. [Google Scholar] [CrossRef] [Green Version]
- Ramesh, N.; Pandey, U.B. Autophagy Dysregulation in ALS: When Protein Aggregates Get Out of Hand. Front. Mol. Neurosci. 2017, 10, 263. [Google Scholar] [CrossRef] [Green Version]
- Balendra, R.; Isaacs, A.M. C9orf72-mediated ALS and FTD: Multiple pathways to disease. Nat. Rev. Neurol. 2018, 14, 544–558. [Google Scholar] [CrossRef]
- Gasset-Rosa, F.; Lu, S.; Yu, H.; Chen, C.; Melamed, Z.; Guo, L.; Shorter, J.; Da Cruz, S.; Cleveland, D.W. Cytoplasmic TDP-43 De-mixing Independent of Stress Granules Drives Inhibition of Nuclear Import, Loss of Nuclear TDP-43, and Cell Death. Neuron 2019, 102, 339–357.e337. [Google Scholar] [CrossRef] [Green Version]
- Kinoshita, Y.; Ito, H.; Hirano, A.; Fujita, K.; Wate, R.; Nakamura, M.; Kaneko, S.; Nakano, S.; Kusaka, H. Nuclear contour irregularity and abnormal transporter protein distribution in anterior horn cells in amyotrophic lateral sclerosis. J. Neuropathol. Exp. Neurol. 2009, 68, 1184–1192. [Google Scholar] [CrossRef] [Green Version]
- Nagara, Y.; Tateishi, T.; Yamasaki, R.; Hayashi, S.; Kawamura, M.; Kikuchi, H.; Iinuma, K.M.; Tanaka, M.; Iwaki, T.; Matsushita, T.; et al. Impaired cytoplasmic-nuclear transport of hypoxia-inducible factor-1alpha in amyotrophic lateral sclerosis. Brain Pathol. 2013, 23, 534–546. [Google Scholar] [CrossRef]
- Renton, A.E.; Majounie, E.; Waite, A.; Simon-Sanchez, J.; Rollinson, S.; Gibbs, J.R.; Schymick, J.C.; Laaksovirta, H.; van Swieten, J.C.; Myllykangas, L.; et al. A hexanucleotide repeat expansion in C9ORF72 is the cause of chromosome 9p21-linked ALS-FTD. Neuron 2011, 72, 257–268. [Google Scholar] [CrossRef] [Green Version]
- Majounie, E.; Renton, A.E.; Mok, K.; Dopper, E.G.; Waite, A.; Rollinson, S.; Chio, A.; Restagno, G.; Nicolaou, N.; Simon-Sanchez, J.; et al. Frequency of the C9orf72 hexanucleotide repeat expansion in patients with amyotrophic lateral sclerosis and frontotemporal dementia: A cross-sectional study. Lancet Neurol. 2012, 11, 323–330. [Google Scholar] [CrossRef]
- Gijselinck, I.; Van Langenhove, T.; van der Zee, J.; Sleegers, K.; Philtjens, S.; Kleinberger, G.; Janssens, J.; Bettens, K.; Van Cauwenberghe, C.; Pereson, S.; et al. A C9orf72 promoter repeat expansion in a Flanders-Belgian cohort with disorders of the frontotemporal lobar degeneration-amyotrophic lateral sclerosis spectrum: A gene identification study. Lancet Neurol. 2012, 11, 54–65. [Google Scholar] [CrossRef]
- Belzil, V.V.; Bauer, P.O.; Prudencio, M.; Gendron, T.F.; Stetler, C.T.; Yan, I.K.; Pregent, L.; Daughrity, L.; Baker, M.C.; Rademakers, R.; et al. Reduced C9orf72 gene expression in c9FTD/ALS is caused by histone trimethylation, an epigenetic event detectable in blood. Acta Neuropathol. 2013, 126, 895–905. [Google Scholar] [CrossRef] [Green Version]
- O’Rourke, J.G.; Bogdanik, L.; Yanez, A.; Lall, D.; Wolf, A.J.; Muhammad, A.K.; Ho, R.; Carmona, S.; Vit, J.P.; Zarrow, J.; et al. C9orf72 is required for proper macrophage and microglial function in mice. Science 2016, 351, 1324–1329. [Google Scholar] [CrossRef] [Green Version]
- Koppers, M.; Blokhuis, A.M.; Westeneng, H.J.; Terpstra, M.L.; Zundel, C.A.; Vieira de Sa, R.; Schellevis, R.D.; Waite, A.J.; Blake, D.J.; Veldink, J.H.; et al. C9orf72 ablation in mice does not cause motor neuron degeneration or motor deficits. Ann. Neurol. 2015, 78, 426–438. [Google Scholar] [CrossRef] [Green Version]
- Xu, Z.; Poidevin, M.; Li, X.; Li, Y.; Shu, L.; Nelson, D.L.; Li, H.; Hales, C.M.; Gearing, M.; Wingo, T.S.; et al. Expanded GGGGCC repeat RNA associated with amyotrophic lateral sclerosis and frontotemporal dementia causes neurodegeneration. Proc. Natl. Acad. Sci. USA 2013, 110, 7778–7783. [Google Scholar] [CrossRef] [Green Version]
- Mori, K.; Weng, S.M.; Arzberger, T.; May, S.; Rentzsch, K.; Kremmer, E.; Schmid, B.; Kretzschmar, H.A.; Cruts, M.; Van Broeckhoven, C.; et al. The C9orf72 GGGGCC repeat is translated into aggregating dipeptide-repeat proteins in FTLD/ALS. Science 2013, 339, 1335–1338. [Google Scholar] [CrossRef]
- Kwon, I.; Xiang, S.; Kato, M.; Wu, L.; Theodoropoulos, P.; Wang, T.; Kim, J.; Yun, J.; Xie, Y.; McKnight, S.L. Poly-dipeptides encoded by the C9orf72 repeats bind nucleoli, impede RNA biogenesis, and kill cells. Science 2014, 345, 1139–1145. [Google Scholar] [CrossRef] [Green Version]
- Mizielinska, S.; Gronke, S.; Niccoli, T.; Ridler, C.E.; Clayton, E.L.; Devoy, A.; Moens, T.; Norona, F.E.; Woollacott, I.O.C.; Pietrzyk, J.; et al. C9orf72 repeat expansions cause neurodegeneration in Drosophila through arginine-rich proteins. Science 2014, 345, 1192–1194. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhang, K.; Donnelly, C.J.; Haeusler, A.R.; Grima, J.C.; Machamer, J.B.; Steinwald, P.; Daley, E.L.; Miller, S.J.; Cunningham, K.M.; Vidensky, S.; et al. The C9orf72 repeat expansion disrupts nucleocytoplasmic transport. Nature 2015, 525, 56–61. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Coyne, A.N.; Zaepfel, B.L.; Hayes, L.; Fitchman, B.; Salzberg, Y.; Luo, E.C.; Bowen, K.; Trost, H.; Aigner, S.; Rigo, F.; et al. G4C2 Repeat RNA Initiates a POM121-Mediated Reduction in Specific Nucleoporins in C9orf72 ALS/FTD. Neuron 2020, 107, 1124–1140.e1111. [Google Scholar] [CrossRef]
- Jovicic, A.; Mertens, J.; Boeynaems, S.; Bogaert, E.; Chai, N.; Yamada, S.B.; Paul, J.W., 3rd; Sun, S.; Herdy, J.R.; Bieri, G.; et al. Modifiers of C9orf72 dipeptide repeat toxicity connect nucleocytoplasmic transport defects to FTD/ALS. Nat. Neurosci. 2015, 18, 1226–1229. [Google Scholar] [CrossRef] [Green Version]
- Freibaum, B.D.; Taylor, J.P. The Role of Dipeptide Repeats in C9ORF72-Related ALS-FTD. Front. Mol. Neurosci. 2017, 10, 35. [Google Scholar] [CrossRef] [Green Version]
- Mori, K.; Arzberger, T.; Grasser, F.A.; Gijselinck, I.; May, S.; Rentzsch, K.; Weng, S.M.; Schludi, M.H.; van der Zee, J.; Cruts, M.; et al. Bidirectional transcripts of the expanded C9orf72 hexanucleotide repeat are translated into aggregating dipeptide repeat proteins. Acta Neuropathol. 2013, 126, 881–893. [Google Scholar] [CrossRef]
- Zu, T.; Liu, Y.; Banez-Coronel, M.; Reid, T.; Pletnikova, O.; Lewis, J.; Miller, T.M.; Harms, M.B.; Falchook, A.E.; Subramony, S.H.; et al. RAN proteins and RNA foci from antisense transcripts in C9ORF72 ALS and frontotemporal dementia. Proc. Natl. Acad. Sci. USA 2013, 110, E4968–E4977. [Google Scholar] [CrossRef] [Green Version]
- Shi, K.Y.; Mori, E.; Nizami, Z.F.; Lin, Y.; Kato, M.; Xiang, S.; Wu, L.C.; Ding, M.; Yu, Y.; Gall, J.G.; et al. Toxic PRn poly-dipeptides encoded by the C9orf72 repeat expansion block nuclear import and export. Proc. Natl. Acad. Sci. USA 2017, 114, E1111–E1117. [Google Scholar] [CrossRef] [Green Version]
- Khosravi, B.; Hartmann, H.; May, S.; Mohl, C.; Ederle, H.; Michaelsen, M.; Schludi, M.H.; Dormann, D.; Edbauer, D. Cytoplasmic poly-GA aggregates impair nuclear import of TDP-43 in C9orf72 ALS/FTLD. Hum. Mol. Genet. 2017, 26, 790–800. [Google Scholar] [CrossRef] [Green Version]
- Hutten, S.; Usluer, S.; Bourgeois, B.; Simonetti, F.; Odeh, H.M.; Fare, C.M.; Czuppa, M.; Hruska-Plochan, M.; Hofweber, M.; Polymenidou, M.; et al. Nuclear Import Receptors Directly Bind to Arginine-Rich Dipeptide Repeat Proteins and Suppress Their Pathological Interactions. Cell Rep. 2020, 33, 108538. [Google Scholar] [CrossRef]
- Nousiainen, H.O.; Kestila, M.; Pakkasjarvi, N.; Honkala, H.; Kuure, S.; Tallila, J.; Vuopala, K.; Ignatius, J.; Herva, R.; Peltonen, L. Mutations in mRNA export mediator GLE1 result in a fetal motoneuron disease. Nat. Genet. 2008, 40, 155–157. [Google Scholar] [CrossRef]
- Kaneb, H.M.; Folkmann, A.W.; Belzil, V.V.; Jao, L.E.; Leblond, C.S.; Girard, S.L.; Daoud, H.; Noreau, A.; Rochefort, D.; Hince, P.; et al. Deleterious mutations in the essential mRNA metabolism factor, hGle1, in amyotrophic lateral sclerosis. Hum. Mol. Genet. 2015, 24, 1363–1373. [Google Scholar] [CrossRef] [Green Version]
- Paonessa, F.; Evans, L.D.; Solanki, R.; Larrieu, D.; Wray, S.; Hardy, J.; Jackson, S.P.; Livesey, F.J. Microtubules Deform the Nuclear Membrane and Disrupt Nucleocytoplasmic Transport in Tau-Mediated Frontotemporal Dementia. Cell Rep. 2019, 26, 582–593.e585. [Google Scholar] [CrossRef] [Green Version]
- Alzheimer’s Association. 2021 Alzheimer’s disease facts and figures. Alzheimers Dement. 2021, 17, 327–406. [Google Scholar] [CrossRef] [PubMed]
- O’Brien, R.J.; Wong, P.C. Amyloid precursor protein processing and Alzheimer’s disease. Annu. Rev. Neurosci. 2011, 34, 185–204. [Google Scholar] [CrossRef] [Green Version]
- Rajmohan, R.; Reddy, P.H. Amyloid-Beta and Phosphorylated Tau Accumulations Cause Abnormalities at Synapses of Alzheimer’s disease Neurons. J. Alzheimers Dis. 2017, 57, 975–999. [Google Scholar] [CrossRef] [Green Version]
- Zhang, H.; Wei, W.; Zhao, M.; Ma, L.; Jiang, X.; Pei, H.; Cao, Y.; Li, H. Interaction between Abeta and Tau in the Pathogenesis of Alzheimer’s Disease. Int. J. Biol. Sci. 2021, 17, 2181–2192. [Google Scholar] [CrossRef]
- Patel, V.P.; Chu, C.T. Nuclear transport, oxidative stress, and neurodegeneration. Int. J. Clin. Exp. Pathol. 2011, 4, 215–229. [Google Scholar]
- Lee, H.G.; Ueda, M.; Miyamoto, Y.; Yoneda, Y.; Perry, G.; Smith, M.A.; Zhu, X. Aberrant localization of importin alpha1 in hippocampal neurons in Alzheimer disease. Brain Res. 2006, 1124, 1–4. [Google Scholar] [CrossRef]
- Mastroeni, D.; Chouliaras, L.; Grover, A.; Liang, W.S.; Hauns, K.; Rogers, J.; Coleman, P.D. Reduced RAN expression and disrupted transport between cytoplasm and nucleus; a key event in Alzheimer’s disease pathophysiology. PLoS ONE 2013, 8, e53349. [Google Scholar] [CrossRef]
- Hua, Q.; He, R.Q. Tau could protect DNA double helix structure. Biochim Biophys Acta 2003, 1645, 205–211. [Google Scholar] [CrossRef]
- Padmaraju, V.; Indi, S.S.; Rao, K.S. New evidences on Tau-DNA interactions and relevance to neurodegeneration. Neurochem. Int. 2010, 57, 51–57. [Google Scholar] [CrossRef] [PubMed]
- Sultan, A.; Nesslany, F.; Violet, M.; Begard, S.; Loyens, A.; Talahari, S.; Mansuroglu, Z.; Marzin, D.; Sergeant, N.; Humez, S.; et al. Nuclear tau, a key player in neuronal DNA protection. J. Biol. Chem. 2011, 286, 4566–4575. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Violet, M.; Delattre, L.; Tardivel, M.; Sultan, A.; Chauderlier, A.; Caillierez, R.; Talahari, S.; Nesslany, F.; Lefebvre, B.; Bonnefoy, E.; et al. A major role for Tau in neuronal DNA and RNA protection in vivo under physiological and hyperthermic conditions. Front. Cell Neurosci. 2014, 8, 84. [Google Scholar] [CrossRef] [Green Version]
- Guo, T.; Noble, W.; Hanger, D.P. Roles of tau protein in health and disease. Acta Neuropathol. 2017, 133, 665–704. [Google Scholar] [CrossRef] [Green Version]
- Evans, H.T.; Taylor, D.; Kneynsberg, A.; Bodea, L.G.; Gotz, J. Altered ribosomal function and protein synthesis caused by tau. Acta Neuropathol. Commun. 2021, 9, 110. [Google Scholar] [CrossRef]
- Schmidt, H.B.; Gorlich, D. Nup98 FG domains from diverse species spontaneously phase-separate into particles with nuclear pore-like permselectivity. Elife 2015, 4, e04251. [Google Scholar] [CrossRef]
- Bates, G.P.; Dorsey, R.; Gusella, J.F.; Hayden, M.R.; Kay, C.; Leavitt, B.R.; Nance, M.; Ross, C.A.; Scahill, R.I.; Wetzel, R.; et al. Huntington disease. Nat. Rev. Dis. Primers 2015, 1, 15005. [Google Scholar] [CrossRef]
- Saudou, F.; Humbert, S. The Biology of Huntingtin. Neuron 2016, 89, 910–926. [Google Scholar] [CrossRef] [Green Version]
- Bessert, D.A.; Gutridge, K.L.; Dunbar, J.C.; Carlock, L.R. The identification of a functional nuclear localization signal in the Huntington disease protein. Brain Res. Mol. Brain Res. 1995, 33, 165–173. [Google Scholar] [CrossRef]
- Desmond, C.R.; Atwal, R.S.; Xia, J.; Truant, R. Identification of a karyopherin beta1/beta2 proline-tyrosine nuclear localization signal in huntingtin protein. J. Biol. Chem. 2012, 287, 39626–39633. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xia, J.; Lee, D.H.; Taylor, J.; Vandelft, M.; Truant, R. Huntingtin contains a highly conserved nuclear export signal. Hum. Mol. Genet. 2003, 12, 1393–1403. [Google Scholar] [CrossRef] [PubMed]
- Graveland, G.A.; Williams, R.S.; DiFiglia, M. Evidence for degenerative and regenerative changes in neostriatal spiny neurons in Huntington’s disease. Science 1985, 227, 770–773. [Google Scholar] [CrossRef] [PubMed]
- Reiner, A.; Dragatsis, I.; Dietrich, P. Genetics and neuropathology of Huntington’s disease. Int. Rev. NeuroBiol. 2011, 98, 325–372. [Google Scholar] [CrossRef] [Green Version]
- Grima, J.C.; Daigle, J.G.; Arbez, N.; Cunningham, K.C.; Zhang, K.; Ochaba, J.; Geater, C.; Morozko, E.; Stocksdale, J.; Glatzer, J.C.; et al. Mutant Huntingtin Disrupts the Nuclear Pore Complex. Neuron 2017, 94, 93–107.e106. [Google Scholar] [CrossRef] [Green Version]
- Freibaum, B.D.; Lu, Y.; Lopez-Gonzalez, R.; Kim, N.C.; Almeida, S.; Lee, K.H.; Badders, N.; Valentine, M.; Miller, B.L.; Wong, P.C.; et al. GGGGCC repeat expansion in C9orf72 compromises nucleocytoplasmic transport. Nature 2015, 525, 129–133. [Google Scholar] [CrossRef]
- Chapple, J.P.; Bros-Facer, V.; Butler, R.; Gallo, J.M. Focal distortion of the nuclear envelope by huntingtin aggregates revealed by lamin immunostaining. Neurosci. Lett. 2008, 447, 172–174. [Google Scholar] [CrossRef] [Green Version]
- Mapelli, L.; Canale, C.; Pesci, D.; Averaimo, S.; Guizzardi, F.; Fortunati, V.; Falasca, L.; Piacentini, M.; Gliozzi, A.; Relini, A.; et al. Toxic effects of expanded ataxin-1 involve mechanical instability of the nuclear membrane. Biochim Biophys Acta 2012, 1822, 906–917. [Google Scholar] [CrossRef] [Green Version]
- Rodriguez, R.; Hernandez-Hernandez, O.; Magana, J.J.; Gonzalez-Ramirez, R.; Garcia-Lopez, E.S.; Cisneros, B. Altered nuclear structure in myotonic dystrophy type 1-derived fibroblasts. Mol. Biol. Rep. 2015, 42, 479–488. [Google Scholar] [CrossRef]
- Da Cruz, S.; Cleveland, D.W. CELL BIOLOGY. Disrupted nuclear import-export in neurodegeneration. Science 2016, 351, 125–126. [Google Scholar] [CrossRef] [Green Version]
- Lee, K.H.; Zhang, P.; Kim, H.J.; Mitrea, D.M.; Sarkar, M.; Freibaum, B.D.; Cika, J.; Coughlin, M.; Messing, J.; Molliex, A.; et al. C9orf72 Dipeptide Repeats Impair the Assembly, Dynamics, and Function of Membrane-Less Organelles. Cell 2016, 167, 774–788.e717. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Woerner, A.C.; Frottin, F.; Hornburg, D.; Feng, L.R.; Meissner, F.; Patra, M.; Tatzelt, J.; Mann, M.; Winklhofer, K.F.; Hartl, F.U.; et al. Cytoplasmic protein aggregates interfere with nucleocytoplasmic transport of protein and RNA. Science 2016, 351, 173–176. [Google Scholar] [CrossRef]
- Zhang, Y.J.; Gendron, T.F.; Grima, J.C.; Sasaguri, H.; Jansen-West, K.; Xu, Y.F.; Katzman, R.B.; Gass, J.; Murray, M.E.; Shinohara, M.; et al. C9ORF72 poly(GA) aggregates sequester and impair HR23 and nucleocytoplasmic transport proteins. Nat. Neurosci. 2016, 19, 668–677. [Google Scholar] [CrossRef] [PubMed]
- Suhr, S.T.; Senut, M.C.; Whitelegge, J.P.; Faull, K.F.; Cuizon, D.B.; Gage, F.H. Identities of sequestered proteins in aggregates from cells with induced polyglutamine expression. J. Cell Biol. 2001, 153, 283–294. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gasset-Rosa, F.; Chillon-Marinas, C.; Goginashvili, A.; Atwal, R.S.; Artates, J.W.; Tabet, R.; Wheeler, V.C.; Bang, A.G.; Cleveland, D.W.; Lagier-Tourenne, C. Polyglutamine-Expanded Huntingtin Exacerbates Age-Related Disruption of Nuclear Integrity and Nucleocytoplasmic Transport. Neuron 2017, 94, 48–57.e44. [Google Scholar] [CrossRef] [Green Version]
- Hung, C.W.; Chen, Y.C.; Hsieh, W.L.; Chiou, S.H.; Kao, C.L. Ageing and neurodegenerative diseases. Ageing Res. Rev. 2010, 9 (Suppl. 1), S36–S46. [Google Scholar] [CrossRef]
- Kim, H.J.; Taylor, J.P. Lost in Transportation: Nucleocytoplasmic Transport Defects in ALS and Other Neurodegenerative Diseases. Neuron 2017, 96, 285–297. [Google Scholar] [CrossRef]
- Hutten, S.; Dormann, D. Nucleocytoplasmic transport defects in neurodegeneration—Cause or consequence? Semin. Cell Dev. Biol. 2020, 99, 151–162. [Google Scholar] [CrossRef]
- Rabut, G.; Doye, V.; Ellenberg, J. Mapping the dynamic organization of the nuclear pore complex inside single living cells. Nat. Cell Biol. 2004, 6, 1114–1121. [Google Scholar] [CrossRef]
- D’Angelo, M.A.; Raices, M.; Panowski, S.H.; Hetzer, M.W. Age-dependent deterioration of nuclear pore complexes causes a loss of nuclear integrity in postmitotic cells. Cell 2009, 136, 284–295. [Google Scholar] [CrossRef] [Green Version]
- Cho, K.I.; Yoon, D.; Yu, M.; Peachey, N.S.; Ferreira, P.A. Microglial activation in an amyotrophic lateral sclerosis-like model caused by Ranbp2 loss and nucleocytoplasmic transport impairment in retinal ganglion neurons. Cell Mol. Life Sci. 2019, 76, 3407–3432. [Google Scholar] [CrossRef] [PubMed]
- Raices, M.; D’Angelo, M.A. Nuclear pore complex composition: A new regulator of tissue-specific and developmental functions. Nat. Rev. Mol. Cell Biol. 2012, 13, 687–699. [Google Scholar] [CrossRef] [PubMed]
- Lange, J.; Wood-Kaczmar, A.; Ali, A.; Farag, S.; Ghosh, R.; Parker, J.; Casey, C.; Uno, Y.; Kunugi, A.; Ferretti, P.; et al. Mislocalization of Nucleocytoplasmic Transport Proteins in Human Huntington’s Disease PSC-Derived Striatal Neurons. Front. Cell Neurosci. 2021, 15, 742763. [Google Scholar] [CrossRef]
- Hedlund, E.; Karlsson, M.; Osborn, T.; Ludwig, W.; Isacson, O. Global gene expression profiling of somatic motor neuron populations with different vulnerability identify molecules and pathways of degeneration and protection. Brain 2010, 133, 2313–2330. [Google Scholar] [CrossRef] [Green Version]
- Fallini, C.; Khalil, B.; Smith, C.L.; Rossoll, W. Traffic jam at the nuclear pore: All roads lead to nucleocytoplasmic transport defects in ALS/FTD. NeuroBiol. Dis. 2020, 140, 104835. [Google Scholar] [CrossRef] [PubMed]
- Bitetto, G.; Di Fonzo, A. Nucleo-cytoplasmic transport defects and protein aggregates in neurodegeneration. Transl. Neurodegener. 2020, 9, 25. [Google Scholar] [CrossRef]
- Kosyna, F.K.; Depping, R. Controlling the Gatekeeper: Therapeutic Targeting of Nuclear Transport. Cells 2018, 7, 221. [Google Scholar] [CrossRef] [Green Version]
- Haines, J.D.; Herbin, O.; de la Hera, B.; Vidaurre, O.G.; Moy, G.A.; Sun, Q.; Fung, H.Y.; Albrecht, S.; Alexandropoulos, K.; McCauley, D.; et al. Nuclear export inhibitors avert progression in preclinical models of inflammatory demyelination. Nat. Neurosci. 2015, 18, 511–520. [Google Scholar] [CrossRef]
- Gittings, L.M.; Sattler, R. Recent advances in understanding amyotrophic lateral sclerosis and emerging therapies. Fac. Rev. 2020, 9, 12. [Google Scholar] [CrossRef]
- Ramic, M.; Andrade, N.S.; Rybin, M.J.; Esanov, R.; Wahlestedt, C.; Benatar, M.; Zeier, Z. Epigenetic Small Molecules Rescue Nucleocytoplasmic Transport and DNA Damage Phenotypes in C9ORF72 ALS/FTD. Brain Sci. 2021, 11, 1543. [Google Scholar] [CrossRef]
- Waibel, S.; Neumann, M.; Rabe, M.; Meyer, T.; Ludolph, A.C. Novel missense and truncating mutations in FUS/TLS in familial ALS. Neurology 2010, 75, 815–817. [Google Scholar] [CrossRef]
- Eura, N.; Sugie, K.; Suzuki, N.; Kiriyama, T.; Izumi, T.; Shimakura, N.; Kato, M.; Aoki, M. A juvenile sporadic amyotrophic lateral sclerosis case with P525L mutation in the FUS gene: A rare co-occurrence of autism spectrum disorder and tremor. J. Neurol. Sci. 2019, 398, 67–68. [Google Scholar] [CrossRef] [PubMed]
- Dormann, D.; Rodde, R.; Edbauer, D.; Bentmann, E.; Fischer, I.; Hruscha, A.; Than, M.E.; Mackenzie, I.R.; Capell, A.; Schmid, B.; et al. ALS-associated fused in sarcoma (FUS) mutations disrupt Transportin-mediated nuclear import. EMBO J. 2010, 29, 2841–2857. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gonzalez, A.; Mannen, T.; Cagatay, T.; Fujiwara, A.; Matsumura, H.; Niesman, A.B.; Brautigam, C.A.; Chook, Y.M.; Yoshizawa, T. Mechanism of karyopherin-beta2 binding and nuclear import of ALS variants FUS(P525L) and FUS(R495X). Sci. Rep. 2021, 11, 3754. [Google Scholar] [CrossRef] [PubMed]
- Dormann, D.; Madl, T.; Valori, C.F.; Bentmann, E.; Tahirovic, S.; Abou-Ajram, C.; Kremmer, E.; Ansorge, O.; Mackenzie, I.R.; Neumann, M.; et al. Arginine methylation next to the PY-NLS modulates Transportin binding and nuclear import of FUS. EMBO J. 2012, 31, 4258–4275. [Google Scholar] [CrossRef] [Green Version]
- Suarez-Calvet, M.; Neumann, M.; Arzberger, T.; Abou-Ajram, C.; Funk, E.; Hartmann, H.; Edbauer, D.; Kremmer, E.; Gobl, C.; Resch, M.; et al. Monomethylated and unmethylated FUS exhibit increased binding to Transportin and distinguish FTLD-FUS from ALS-FUS. Acta Neuropathol. 2016, 131, 587–604. [Google Scholar] [CrossRef]
- Baade, I.; Hutten, S.; Sternburg, E.L.; Porschke, M.; Hofweber, M.; Dormann, D.; Kehlenbach, R.H. The RNA-binding protein FUS is chaperoned and imported into the nucleus by a network of import receptors. J. Biol. Chem. 2021, 296, 100659. [Google Scholar] [CrossRef]
- Hayes, L.R.; Duan, L.; Bowen, K.; Kalab, P.; Rothstein, J.D. C9orf72 arginine-rich dipeptide repeat proteins disrupt karyopherin-mediated nuclear import. Elife 2020, 9, e51685. [Google Scholar] [CrossRef]
- Boeynaems, S.; Bogaert, E.; Michiels, E.; Gijselinck, I.; Sieben, A.; Jovicic, A.; De Baets, G.; Scheveneels, W.; Steyaert, J.; Cuijt, I.; et al. Drosophila screen connects nuclear transport genes to DPR pathology in c9ALS/FTD. Sci. Rep. 2016, 6, 20877. [Google Scholar] [CrossRef]
- McEachin, Z.T.; Gendron, T.F.; Raj, N.; Garcia-Murias, M.; Banerjee, A.; Purcell, R.H.; Ward, P.J.; Todd, T.W.; Merritt-Garza, M.E.; Jansen-West, K.; et al. Chimeric Peptide Species Contribute to Divergent Dipeptide Repeat Pathology in c9ALS/FTD and SCA36. Neuron 2020, 107, 292–305.e296. [Google Scholar] [CrossRef]
- Nishimura, A.L.; Zupunski, V.; Troakes, C.; Kathe, C.; Fratta, P.; Howell, M.; Gallo, J.M.; Hortobagyi, T.; Shaw, C.E.; Rogelj, B. Nuclear import impairment causes cytoplasmic trans-activation response DNA-binding protein accumulation and is associated with frontotemporal lobar degeneration. Brain 2010, 133, 1763–1771. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Park, J.H.; Chung, C.G.; Park, S.S.; Lee, D.; Kim, K.M.; Jeong, Y.; Kim, E.S.; Cho, J.H.; Jeon, Y.M.; Shen, C.J.; et al. Cytosolic calcium regulates cytoplasmic accumulation of TDP-43 through Calpain-A and Importin alpha3. Elife 2020, 9, e60132. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Z.C.; Chook, Y.M. Structural and energetic basis of ALS-causing mutations in the atypical proline-tyrosine nuclear localization signal of the Fused in Sarcoma protein (FUS). Proc. Natl. Acad. Sci. USA 2012, 109, 12017–12021. [Google Scholar] [CrossRef] [Green Version]
- Jackrel, M.E.; DeSantis, M.E.; Martinez, B.A.; Castellano, L.M.; Stewart, R.M.; Caldwell, K.A.; Caldwell, G.A.; Shorter, J. Potentiated Hsp104 variants antagonize diverse proteotoxic misfolding events. Cell 2014, 156, 170–182. [Google Scholar] [CrossRef] [Green Version]
- Jackrel, M.E.; Shorter, J. Potentiated Hsp104 variants suppress toxicity of diverse neurodegenerative disease-linked proteins. Dis. Model. Mech. 2014, 7, 1175–1184. [Google Scholar] [CrossRef] [Green Version]
- March, Z.M.; Sweeney, K.; Kim, H.; Yan, X.; Castellano, L.M.; Jackrel, M.E.; Lin, J.; Chuang, E.; Gomes, E.; Willicott, C.W.; et al. Therapeutic genetic variation revealed in diverse Hsp104 homologs. Elife 2020, 9, e57457. [Google Scholar] [CrossRef]
- Jackrel, M.E.; Tariq, A.; Yee, K.; Weitzman, R.; Shorter, J. Isolating potentiated Hsp104 variants using yeast proteinopathy models. J. Vis. Exp. 2014, e52089. [Google Scholar] [CrossRef] [PubMed]
- Shorter, J. Engineering therapeutic protein disaggregases. Mol. Biol. Cell 2016, 27, 1556–1560. [Google Scholar] [CrossRef] [Green Version]
- Jackrel, M.E.; Shorter, J. Engineering enhanced protein disaggregases for neurodegenerative disease. Prion 2015, 9, 90–109. [Google Scholar] [CrossRef] [Green Version]
Category | Type | Protein | NLS Amino Acid Sequence | Importins | Reference |
---|---|---|---|---|---|
Classical nuclear localization signal (cNLS) | MP NLS | VACM-1/CUL5 | PKLKRQ | Importin α/β1 | [52] |
CXCR4 | RPRK | [53] | |||
VP1 | RRARRPRG | [54] | |||
c-myc | PAAKRVKLD/RQRRNELKRSF | [55] | |||
Polyoma large T-Ag | VSRKRPRP | [56,57] | |||
Hepatitis D virus antigen | EGAPPAKRAR | [58,59] | |||
NF-κB p50 | QRKRQK | Importin α3 & Importin α4 | [60,61,62] | ||
NF-κB p65 | EEKRKR | [62,63] | |||
SV40 T antigen | PKKKRKV | Importin α | [64,65] | ||
murine p53 | PPQPKKKPLDGE | [66,67] | |||
BP NLS | Nucleoplasmin | KRPAATKKAGOAKKKK | Importin α/β1 | [64] | |
ING4 | KGKKGRTQKEKKAARARSKGKN | [68] | |||
IER5 | RKRCAAGVGGGPAGCPAPGSTPLKKPRR | [69] | |||
ERK5 | RKPVTAQERQREREEKRRRRQERAKEREKRRQERER | Importin 7 | [70,71] | ||
53BP1 | GKRKLITSEEERSPAKRGRKS | Importin α | [72] | ||
Rat glucocorticoid receptor | YRKCLQAGMNLEARKTKKKIKGIQQATA | Importin 7 & Importin α/β1 | [73,74] | ||
RCC1 | MSPKRIAKRRSPPADAIPKSKKVKVSHR | Importin α3 | [75] | ||
Non-classical nuclear localization signals (ncNLS) | PY-NLS | Hrp1 | RSGGNHRRNGRGGRGGYNRRNNGYHPY | Imp β2 | [76] |
UL79 | TLLLRETMNNLGVSDHAVLSRKTPQPY | [51] | |||
FUS | FGPGKMDSRGEHRQDRRERPY | [77,78] | |||
hnRNPA1 | NNOSSNFGPMKGGNFGGRSSGPYG | [77,78] | |||
hnRNPA2 | NQQPSNYGPMKSGNFGGSRNMGGPYG | [77] | |||
TAF15 | GYGGKMGGRNDYRNDQRNRPY | [77] | |||
EWS | GGPGKMDKGEHRQERRDRPY | [77] | |||
Other ncNLS | Pho4 | SANKVTKNKSNSSPYLNKRKGKPGPDS | Impβ family member Pse1/Kap121 | [79] | |
rpL23a | VHSHKKKKIPTSPTFTTPKTLTLRRQPKYPRKSAPRRNKLDHY | Impβ, transportin, RanBP5 and RanBP7 | [80] | ||
PTHrP | GKKKKGKPGKRREQRKKKRRT | Imp β1 | [81] | ||
Other types of nuclear localization signals | Putative NLS | PABPN1 | None | [47] | |
Spatial epitope NLS | STAT1 | None | |||
Cryptic NLS | FGF2 | None | |||
Multiple NLS | MSX1 | RKHKTNRKPR NRRAKAKR | [82] | ||
NLS-RARα | RNKKKK RKVIK | Importin α1/β1 | [83] |
Class | Sequence Pattern |
---|---|
1a | ΦXXXΦXXΦXΦ |
1b | ΦXXΦXXΦXΦ |
1c | ΦXXXΦXXXΦXΦ |
1d | ΦXXΦXXXΦXΦ |
2 | ΦXΦXXΦXΦ |
3 | ΦXXΦXXXΦXXΦ |
1a-R | ΦXΦXXΦXXXΦ |
1b-R | ΦXΦXXΦXXΦ |
1c-R | ΦXΦXXXΦXXXΦ |
1d-R | ΦXΦXXXΦXXΦ |
Exportin | Type of NES | Protein | NES Sequence | Reference |
---|---|---|---|---|
CRM1/Xpo1 | Leucine-rich | CPEB4 | RTFDMHSLESSLIDI | [98] |
hRio2 | RSFEMTEFNQALEEI | |||
Yap1p | SDIDVDGLCSELMAKAK | |||
Stat3 | RGLSIEQLTTLAEKLL | |||
TIS11 | MDLSAIYESLMSMSH | |||
rZap | SVDVTQKFKYLGTHDR | |||
Menin1 | DSLELLQLQQKLLWLLY | |||
Pap1 | ESFDIDDLCSKLKNKAK | |||
DOK7 | ETLQLEKRLSLLSHA | |||
hnRNPA1 | NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY | [100] | ||
RanBP1 | DHAEKVAEKLEALSV | [101] | ||
Exportin2/CAS/Xpo2 | - | Imp-α | Conformational or entire Impα | [102] |
Exportin-4/Xpo4 | - | eIF-5A and other proteins | - | [103,104] |
Exportin-5/Xpo5/RanBP21 | - | RNA and proteins | Conformational or entire pre-miRNA | [104] |
Exportin-6/Xpo6/RanBP20 | - | Nuclear export of actin and profilin-actin complexes | - | [104,105] |
Exportin-7/Xpo7/RanBP16 | - | Proteins | - | [104] |
Exportin-t/Xpot | - | tRNAs | Conformational or entire tRNAs | [102] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Girdhar, A.; Guo, L. Regulating Phase Transition in Neurodegenerative Diseases by Nuclear Import Receptors. Biology 2022, 11, 1009. https://doi.org/10.3390/biology11071009
Girdhar A, Guo L. Regulating Phase Transition in Neurodegenerative Diseases by Nuclear Import Receptors. Biology. 2022; 11(7):1009. https://doi.org/10.3390/biology11071009
Chicago/Turabian StyleGirdhar, Amandeep, and Lin Guo. 2022. "Regulating Phase Transition in Neurodegenerative Diseases by Nuclear Import Receptors" Biology 11, no. 7: 1009. https://doi.org/10.3390/biology11071009