Pre-Clinical Evaluation of the Nanoliposomal antiPCSK9 Vaccine in Healthy Non-Human Primates
Abstract
1. Introduction
2. Methods
2.1. The L-IFPTA Vaccine Formulation
2.2. Macaques Monkey Vaccination
2.3. Characterization of Antibody Responses
2.4. Evaluating the Effect of Induced antiPCSK9 Antibodies on PCSK9/LDLR Interaction In Vitro
2.5. The Plasma Lipid Assay
2.6. The Inflammatory Biomarker Assay
2.7. The Assessment of Organ Injury Biomarkers
2.8. Statistical Analysis
3. Results
3.1. Characterization and Stability of L-IFPT Nanoparticles
3.2. The L-IFPTA Vaccine Is Immunogenic in the Rhesus Macaque
3.3. Vaccine-Induced antiPCSK9 Antibodies Interfered with PCSK9 Function
3.4. The L-IFPTA Vaccine Did Not Cause Organ Injury in the Rhesus Macaque
3.5. The L-IFPTA Vaccine Did Not Change Levels of Plasma Lipids in the Rhesus Macaque
3.6. The L-IFPTA Vaccine Did Not Induce Systemic Inflammation in the Rhesus Macaque
4. Discussion
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Sabatine, M.S.; Giugliano, R.; Wiviott, S.D.; Raal, F.J.; Blom, D.J.; Robinson, J.; Ballantyne, C.M.; Somaratne, R.; Legg, J.; Wasserman, S.M.; et al. Efficacy and Safety of Evolocumab in Reducing Lipids and Cardiovascular Events. N. Engl. J. Med. 2015, 372, 1500–1509. [Google Scholar] [CrossRef] [Scilit]
- Robinson, J.G.; Farnier, M.; Krempf, M.; Bergeron, J.; Luc, G.; Averna, M.; Stroes, E.S.; Langslet, G.; Raal, F.J.; El Shahawy, M.; et al. Efficacy and Safety of Alirocumab in Reducing Lipids and Cardiovascular Events. N. Engl. J. Med. 2015, 372, 1489–1499. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sabatine, M.S.; Giugliano, R.P.; Keech, A.C.; Honarpour, N.; Wiviott, S.D.; Murphy, S.A.; Kuder, J.F.; Wang, H.; Liu, T.; Wasserman, S.M.; et al. FOURIER Steering Committee and Investigators. Evolocumab and clinical outcomes in patients with cardiovascular disease. N. Engl. J. Med. 2017, 376, 1713–1722. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Nicholls, S.J.; Puri, R.; Anderson, T.; Ballantyne, C.M.; Cho, L.; Kastelein, J.J.; Koenig, W.; Somaratne, R.; Kassahun, H.; Yang, J.; et al. Effect of evolocumab on progression of coronary disease in statin-treated patients: The glagov randomized clinical trial. JAMA 2016, 316, 2373–2384. [Google Scholar] [CrossRef] [Scilit]
- Momtazi-Borojeni, A.A.; Sabouri-Rad, S.; Gotto, A.M., Jr.; Pirro, M.; Banach, M.; Awan, Z.; Barreto, G.E.; Sahebkar, A. PCSK9 and inflammation: A review of experimental and clinical evidence. Eur. Heart J. Cardiovasc. Pharmacother. 2019, 5, 237–245. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Catapano, A.; Papadopoulos, N. The safety of therapeutic monoclonal antibodies: Implications for cardiovascular disease and targeting the PCSK9 pathway. Atherosclerosis 2013, 228, 18–28. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Do, R.Q.; Vogel, R.A.; Schwartz, G.G. PCSK9 Inhibitors: Potential in Cardiovascular Therapeutics. Curr. Cardiol. Rep. 2013, 15, 1–12. [Google Scholar] [CrossRef] [Scilit]
- Hall, S.S. A gene of rare effect. Nature 2013, 496, 152–155. [Google Scholar] [CrossRef] [Scilit]
- Sahebkar, A.; Watts, G.F. New Therapies Targeting apoB Metabolism for High-Risk Patients with Inherited Dyslipidaemias: What Can the Clinician Expect? Cardiovasc. Drugs Ther. 2013, 27, 559–567. [Google Scholar] [CrossRef] [Scilit]
- Maningat, P.; Gordon, B.R.; Breslow, J.L. How Do We Improve Patient Compliance and Adherence to Long-Term Statin Therapy? Curr. Atheroscler. Rep. 2013, 15, 291. [Google Scholar] [CrossRef] [Scilit]
- Kazi, D.S.; Moran, A.E.; Coxson, P.G.; Penko, J.; Ollendorf, D.A.; Pearson, S.D.; Tice, J.; Guzman, D.; Bibbins-Domingo, K. Cost-effectiveness of PCSK9 Inhibitor Therapy in Patients with Heterozygous Familial Hypercholesterolemia or Atherosclerotic Cardiovascular Disease. JAMA 2016, 316, 743–753. [Google Scholar] [CrossRef] [Scilit]
- Marquina, C.; Zomer, E.; Vargas-Torres, S.; Zoungas, S.; Ofori-Asenso, R.; Liew, D.; Ademi, Z. Novel Treatment Strategies for Secondary Prevention of Cardiovascular Disease: A Systematic Review of Cost-Effectiveness. Pharmacoeconomics 2020, 38, 1095–1113. [Google Scholar] [CrossRef] [Scilit]
- Bartelds, G.M.; Krieckaert, C.L.M.; Nurmohamed, M.T.; van Schouwenburg, P.; Lems, W.F.; Twisk, J.W.R.; Dijkmans, B.A.C.; Aarden, L.; Wolbink, G.J. Development of Antidrug Antibodies Against Adalimumab and Association with Disease Activity and Treatment Failure During Long-term Follow-up. JAMA 2011, 305, 1460–1468. [Google Scholar] [CrossRef] [Scilit]
- Fattori, E.; Cappelletti, M.; Surdo, P.L.; Calzetta, A.; Bendtsen, C.; Ni, Y.G.; Pandit, S.; Sitlani, A.; Mesiti, G.; Carfí, A.; et al. Immunization against Proprotein Convertase Subtilisin-like/Kexin type 9 (PCSK9) lowers plasma LDL-cholesterol levels in mice. J. Lipid Res. 2012, 53, 1654–1661. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pan, Y.; Zhou, Y.; Wu, H.; Chen, X.; Zihua, Z.; Zhang, H.; Zhou, Z.; Qiu, Z.; Liao, Y. A Therapeutic Peptide Vaccine Against PCSK9. Sci. Rep. 2017, 7, 12534. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Crossey, E.; Amar, M.J.; Sampson, M.; Peabody, J.; Schiller, J.T.; Chackerian, B.; Remaley, A.T. A cholesterol-lowering VLP vaccine that targets PCSK9. Vaccine 2015, 33, 5747–5755. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wu, D.; Zhou, Y.; Pan, Y.; Li, C.; Wang, Y.; Chen, F.; Chen, X.; Yang, S.; Zhou, Z.; Liao, Y.; et al. Vaccine Against PCSK9 Improved Renal Fibrosis by Regulating Fatty Acid β-Oxidation. J. Am. Heart Assoc. 2020, 9, e014358. [Google Scholar] [CrossRef] [Scilit]
- You, S.; Guo, X.; Xue, X.; Li, Y.; Dong, H.; Ji, H.; Hong, T.; Wei, Y.; Shi, X.; He, B. PCSK9 Hapten Multicopy Displayed onto Carrier Protein Nanoparticle: An Antiatherosclerosis Vaccine. ACS Biomater. Sci. Eng. 2019, 5, 4263–4271. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Galabova, G.; Brunner, S.; Winsauer, G.; Juno, C.; Wanko, B.; Mairhofer, A.; Lührs, P.; Schneeberger, A.; Von Bonin, A.; Mattner, F.; et al. Peptide-Based Anti-PCSK9 Vaccines—An Approach for Long-Term LDLc Management. PLoS ONE 2014, 9, e114469. [Google Scholar] [CrossRef] [Scilit]
- Landlinger, C.; Pouwer, M.G.; Juno, C.; Van Der Hoorn, J.W.; Pieterman, E.J.; Jukema, J.W.; Staffler, G.; Princen, H.; Galabova, G. The AT04A vaccine against proprotein convertase subtilisin/kexin type 9 reduces total cholesterol, vascular inflammation, and atherosclerosis in APOE*3Leiden.CETP mice. Eur. Heart J. 2017, 38, 2499–2507. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Momtazi-Borojeni, A.A.; Jaafari, M.R.; Badiee, A.; Sahebkar, A. Long-term generation of antiPCSK9 antibody using a nanoliposome-based vaccine delivery system. Atherosclerosis 2019, 283, 69–78. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Momtazi, A.A.; Jaafari, M.R.; Badiee, A.; Banach, M.; Sahebkar, A. Therapeutic effect of nanoliposomal PCSK9 vaccine in a mouse model of atherosclerosis. BMC Med. 2019, 17, 223. [Google Scholar] [CrossRef] [Scilit]
- Momtazi, A.A.; Nik, M.E.; Jaafari, M.R.; Banach, M.; Sahebkar, A. Effects of immunization against PCSK9 in an experimental model of breast cancer. Arch. Med. Sci. 2019, 15, 570–579. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Momtazi-Borojeni, A.; Jaafari, M.R.; Abdollahi, E.; Banach, M.; Sahebkar, A. P704Nanoliposomal anti-PCSK9 vaccine ameliorates glucose intolerance and insulin resistance in diabetic rats. Eur. Heart J. 2019, 40. [Google Scholar] [CrossRef] [Scilit]
- Momtazi-Borojeni, A.A.; Jaafari, M.R.; Afshar, M.; Banach, M.; Sahebkar, A. PCSK9 immunization using nanoliposomes: Preventive efficacy against hypercholesterolemia and atherosclerosis. Arch. Med. Sci. 2021, 17. [Google Scholar] [CrossRef] [Scilit]
- Momtazi-Borojeni, A.; Jaafari, M.R.; Banach, M.; Sahebkar, A. P6194Therapeutic effect of nanoliposomal anti-PCSK9 vaccine on hypercholesterolemia and atherosclerosis in C57BL/6 mice. Eur. Heart J. 2019, 40. [Google Scholar] [CrossRef] [Scilit]
- Momtazi-Borojeni, A.; Jaafari, M.R.; Badiee, A.A.; Banach, M.; Sahebkar, A.A. P6195Nanoliposomal anti-PCSK9 vaccine induces long-term and safe protection against atherosclerosis in C57BL/6 mouse. Eur. Heart J. 2019, 40. [Google Scholar] [CrossRef] [Scilit]
- Schneeberger, A.; Mandler, M.; Otava, O.; Zauner, W.; Mattner, F.; Schmidt, W. Development of AFFITOPE vaccines for Alzheimer’s disease (AD)—from concept to clinical testing. JNHA 2009, 13, 264–267. [Google Scholar] [CrossRef] [Scilit]
- Banach, M.; Penson, P. What have we learned about lipids and cardiovascular risk from PCSK9 inhibitor outcome trials: ODYSSEY and FOURIER? Cardiovasc. Res. 2019, 115, e26–e31. [Google Scholar] [CrossRef] [Scilit]
- Lakoski, S.G.; Lagace, T.A.; Cohen, J.C.; Horton, J.D.; Hobbs, H.H. Genetic and Metabolic Determinants of Plasma PCSK9 Levels. J. Clin. Endocrinol. Metab. 2009, 94, 2537–2543. [Google Scholar] [CrossRef] [Scilit]
- Di Pasquale, A.; Preiss, S.; Silva, F.M.D.O.E.; Garçon, N. Vaccine Adjuvants: From 1920 to 2015 and Beyond. Vaccines 2015, 3, 320–343. [Google Scholar] [CrossRef] [Scilit]
- Hervé, C.; Laupèze, B.; Del Giudice, G.; Didierlaurent, A.M.; Da Silva, F.T. The how’s and what’s of vaccine reactogenicity. NPJ Vaccines 2019, 4, 39. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lim, P.W.; Garssen, J.; Sandalova, E. Potential Use of Salivary Markers for Longitudinal Monitoring of Inflammatory Immune Responses to Vaccination. Mediat. Inflamm. 2016, 2016, 1–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Institute of Medicine (US); Committee to Review Adverse Effects of Vaccines; Stratton, K.R.; Clayton, E.W. Adverse Effects of Vaccines: Evidence and Causality; National Academies Press: Washington, DC, USA, 2012.
- Lien, M.Y.; Chang, A.C.; Tsai, H.C.; Tsai, M.H.; Hua, C.H.; Cheng, S.P.; Wang, S.W.; Tang, C.H. Monocyte chemoattractant protein 1 promotes VEGF-A expression in OSCC by activating ILK and MEK1/2 signaling and downregulating miR-29c. Front. Oncol. 2020, 10, 2536. [Google Scholar] [CrossRef] [Scilit]
- Mitchell, L.A.; Henderson, A.J.; Dow, S.W. Suppression of Vaccine Immunity by Inflammatory Monocytes. J. Immunol. 2012, 189, 5612–5621. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sahebkar, A.; Momtazi-Borojeni, A.A.; Banach, M. PCSK9 vaccine: So near, yet so far! Eur. Heart J. 2021. [Google Scholar] [CrossRef] [Scilit]





| Peptide Name | Sequence | Immunogenicity |
|---|---|---|
| PCSK9 | S-I-P-W-N-L-E-R-I-T-P-V-R | B cell epitope |
| Tetanus | A-Q-Y-I-K-A-N-S-K-F-I-G-I-T-E-L | T cell epitope |
| IFPT | * CGGGSIPWNLERITPVRKKAQYIKANSKFIGITEL |
| Formulation | Z-Average (nm) [Mean ± SD, n = 3] | Zeta Potential (mV) [Mean ± SD, n = 3] | PDI * [Mean ± SD, n = 3] |
|---|---|---|---|
| The free-nanoliposome | 134 ± 5 | −41 ± 2 | 0.01 ± 0.001 |
| The IFPT linked-nanoliposome | 159 ± 8 | −28 ± 3 | 0.02 ± 0.008 |
| Time-Point | Creatinine (mg/dL, Mean ± SD) | Urea (mg/dL, Mean ± SD) | Uric Acid (mg/dL, Mean ± SD) | Bilirubin (mg/dL, Mean ± SD) | ALP (mg/dL, Mean ± SD) | AST (mg/dL, Mean ± SD) | ALT (mg/dL, Mean ± SD) | TSH (mg/dL, Mean ± SD) |
|---|---|---|---|---|---|---|---|---|
| Pre-immunization | 1.2 ± 0.2 | 30.8 ± 7 | ND | ND | 2311 ± 1121 | 32 ± 13 | 2.8 ± 1.5 | 0.9 ± 0.2 |
| Post-immunization | 1.1 ± 0.1 | 48 ± 14 | ND | ND | 1876 ± 1125 | 25 ± 14 | 2.4 ± 1.1 | 1 ± 0.3 |
| Mean difference | NSD | NSD | - | - | NSD | NSD | NSD | NSD |
| Time-Point | IL1α | IL1β | IL2 | IL4 | IL6 | IL8 | IL10 | IFNγ | TNF | EGF | VEGF | MCP-1 | CRP |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Pre-vaccination (pg/mL, mean ± SD) | ND | ND | ND | ND | 1 ± 1.3 | 6.6 ± 8 | 3.6 ± 7 | ND | ND | 2.6 ± 6 | ND | 171 ± 31 | 2.2 ± 1.5 |
| Post-vaccination (pg/mL, mean ± SD) | ND | ND | ND | ND | ND | 25 ± 7 | ND | ND | ND | 62 ± 37 | ND | 156 ± 76 | 2 ± 0.7 |
| Mean difference | - | - | - | - | NSD | NSD | NSD | - | - | NSD | - | NSD | NSD |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Momtazi-Borojeni, A.A.; Jaafari, M.R.; Banach, M.; Gorabi, A.M.; Sahraei, H.; Sahebkar, A. Pre-Clinical Evaluation of the Nanoliposomal antiPCSK9 Vaccine in Healthy Non-Human Primates. Vaccines 2021, 9, 749. https://doi.org/10.3390/vaccines9070749
Momtazi-Borojeni AA, Jaafari MR, Banach M, Gorabi AM, Sahraei H, Sahebkar A. Pre-Clinical Evaluation of the Nanoliposomal antiPCSK9 Vaccine in Healthy Non-Human Primates. Vaccines. 2021; 9(7):749. https://doi.org/10.3390/vaccines9070749
Chicago/Turabian StyleMomtazi-Borojeni, Amir Abbas, Mahmoud R. Jaafari, Maciej Banach, Armita Mahdavi Gorabi, Hedayat Sahraei, and Amirhossein Sahebkar. 2021. "Pre-Clinical Evaluation of the Nanoliposomal antiPCSK9 Vaccine in Healthy Non-Human Primates" Vaccines 9, no. 7: 749. https://doi.org/10.3390/vaccines9070749
APA StyleMomtazi-Borojeni, A. A., Jaafari, M. R., Banach, M., Gorabi, A. M., Sahraei, H., & Sahebkar, A. (2021). Pre-Clinical Evaluation of the Nanoliposomal antiPCSK9 Vaccine in Healthy Non-Human Primates. Vaccines, 9(7), 749. https://doi.org/10.3390/vaccines9070749
