Next Article in Journal
Structure-Dependent Innate Immune Compatibility of Sup35 G7-Derived Self-Assembling Peptide Nanomaterials in an Immune-Compatibility Assessment
Previous Article in Journal
Hepatitis B Immunization Among Healthcare Students: A Narrative Review of Occupational Risk, Seroprotection, and Immunization Management
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Allele-Skewed HLA-DR Immunopeptidomes of Bordetella pertussis

by
Hooman Yari
1,
Saghar Kaabinejadian
1,
Ricardo da Silva Antunes
2,
Sandra K. Armstrong
3,
Timothy J. Brickman
3,
Alessandro Sette
2,4 and
William H. Hildebrand
1,*
1
Department of Microbiology and Immunology, College of Medicine, The University of Oklahoma Health Campus, Oklahoma City, OK 73104, USA
2
Center for Vaccine Innovation, La Jolla Institute for Immunology, La Jolla, CA 92037, USA
3
Department of Microbiology and Immunology, University of Minnesota Medical School, Minneapolis, MN 55455, USA
4
Department of Medicine, Division of Infectious Diseases and Global Public Health, University of California San Diego, La Jolla, CA 92093, USA
*
Author to whom correspondence should be addressed.
Vaccines 2026, 14(9), 733; https://doi.org/10.3390/vaccines14090733
Submission received: 21 July 2026 / Revised: 18 August 2026 / Accepted: 19 August 2026 / Published: 25 August 2026
(This article belongs to the Section Pathogens-Host Immune Boundaries)

Abstract

Background/Objectives: Infection with Bordetella pertussis causes whooping cough. CD4+ T cell responses depend on bacterial peptides displayed by HLA class II, yet allele- and strain-resolved maps of naturally processed B. pertussis HLA-DR ligands remain limited. We sought to define which antigens yield HLA-DR ligands in a human macrophage model and whether presentation is skewed by HLA-DR molecule and bacterial strain. Methods: THP-1–derived macrophages were pulsed with whole-cell lysates of B. pertussis vaccine/reference strain Tohama I or clinical isolate D420. HLA-DR was immunoaffinity purified; eluted peptides were identified by LC-MS/MS and assigned to HLA-DR molecules encoded by HLA-DRB1*01:01, HLA-DRB1*15:01, and HLA-DRB5*01:01. Results: We identified 63 B. pertussis peptide ligands from 29 source proteins. Presentation was skewed by HLA-DR molecule: DRB1*01:01 accounted for 37 ligands from 21 antigens, DRB1*15:01 for 22 from 7, and DRB5*01:01 for 4 from 4. Most source proteins contributed ligands primarily to one HLA-DR molecule, so an antigen that supplies peptides to one DR product need not supply peptides to another. Strain further partitioned the ligandome: 32 ligands unique to Tohama I, 12 to D420, and only 19 from 8 proteins with both lysates. Only three antigens contributed ligands to both DRB1*01:01 and DRB1*15:01; two of these, pertactin and filamentous hemagglutinin, are components of current acellular pertussis vaccines. Conclusions: B. pertussis HLA-DR ligandomes are jointly shaped by bacterial strain and HLA-DR molecule. Antigens can interact selectively with individual HLA-DR products, and peptides from a given antigen may be recovered after pulse with one strain but not another. These findings support HLA-DR and strain-aware interpretation of class II presentation and nominate BrkA autotransporter (Bordetella resistance to killing A), outer membrane protein A (OmpA), tracheal colonization factor (TcfA), and a divalent metal transporter (DMT) family transporter for follow-up.

1. Introduction

Whooping cough is a highly contagious, potentially life-threatening respiratory illness, especially in infants, caused by the Gram-negative bacterium Bordetella pertussis. Vaccination has markedly reduced disease burden, and both innate and adaptive immunity contribute after natural infection or immunization [1]. CD4+ T cells—particularly those with T helper 1 (Th1)– and T helper 17 (Th17)–associated programs—are thought to support durable, cell-mediated help and to orchestrate effector responses that control bacterial infection; vaccines or infection histories that elicit robust CD4+ immunity are therefore of central interest for long-term protection against B. pertussis.
Introduction of inactivated whole-cell pertussis (wP) vaccines in the 1940s dramatically reduced incidence—for example, from approximately 157 cases per million to <1 per million in the United States at peak control [2]. Because reactogenicity and manufacturing considerations favored more defined products, many countries replaced wP with acellular pertussis (aP) vaccines in the 1990s [3,4,5]. Unlike wP, which exposes the immune system to a broad mixture of bacterial material, licensed aP formulations are subunit vaccines built from a small set of purified or genetically or chemically detoxified antigens—classically pertussis toxin (PT), filamentous hemagglutinin (FHA), pertactin (PRN), and fimbrial types FIM2 and/or FIM3 (FIM), depending on the product [4,6]. The transition to acellular vaccines therefore required selecting antigens that are immunogenic and can be presented broadly across human class II HLA molecules.
Despite high pediatric coverage with aP in many industrialized countries, B. pertussis continues to circulate globally, with periodic increases in reported cases; infants remain at highest risk for severe outcomes [4,7,8,9,10]. Contributing factors remain debated and are likely multifactorial, including evolutionary change in circulating strains—for example, antigenic drift among surface proteins, variation or loss of vaccine-included antigens such as PRN, and divergence in toxin or adhesin sequences [11,12,13,14]—together with waning vaccine-elicited immunity that permits ongoing transmission [3,5,15]. These patterns underscore a tension between immunity focused on a narrow antigen set and a pathogen capable of antigenic change, motivating strategies to broaden or refocus the B. pertussis antigen repertoire addressed by vaccination.
Broadening the immune response by expanding the antigen content of acellular vaccines is a promising direction for improving efficacy [16]. Because the limited number of purified antigens in licensed aP products may be suboptimal for long-lasting protection against a continuously evolving bacterium, next-generation pertussis vaccines will likely require expanded or revised antigen sets. Candidate targets have been proposed through complementary approaches, including genome-wide or proteome-informed identification of CD4+ T cellreactive regions in human donors [15,17,18], B. pertussis proteomics [19,20,21], and serological profiling after infection or vaccination [19,22,23]. Such work generates valuable hypotheses about immunogenic proteins and candidate peptide–HLA pairs. However, for class II-restricted CD4+ responses, a fundamental question remains only partially addressed: which B. pertussis proteins give rise to peptides that are actually loaded onto specific HLA-DR molecules on human antigen-presenting cells (APCs) under defined antigen-processing conditions? Direct answers require experimental access to naturally processed HLA-DR–associated peptides—information that cannot be reliably inferred from binding predictions or from T cell assays performed in unrelated HLA haplotypes.
CD4+ T cell recognition of protein antigens is HLA class II–restricted: APCs degrade internalized proteins into peptides that load onto HLA-DR, -DQ, and/or -DP heterodimers for display to T cell receptors. Among these loci, HLA-DR is often the dominant restriction element for CD4+ responses in human populations, and allelic polymorphism at HLA-DRB1 (and linked DRB genes) changes which peptide sequences can be productively bound and presented. The HLA-DR–associated peptide repertoire on APCs is therefore a proximate determinant of which CD4+ specificities can be engaged during B. pertussis vaccination or infection. Direct identification of eluted HLA-DR ligands provides a complementary, HLA-centric foundation for interpreting CD4+ immunity—especially when analyzed allele by allele.
Here, we used immunopeptidomics to characterize HLA-DR–associated B. pertussis peptide ligands eluted from HLA-DR immunoprecipitated from THP-1–derived macrophages pulsed with whole bacterial lysate, allowing the class II APC pathway to encounter a complex, physiologically plausible mixture of bacterial proteins. We focused on three HLA-DR allotypes—HLA-DRB1*01:01, HLA-DRB1*15:01, and HLA-DRB5*01:01—and identified eluted ligands by liquid chromatography–tandem mass spectrometry. To probe robustness across genetic backgrounds relevant to epidemiology and vaccine production, we compared lysates from the laboratory/vaccine strain Tohama I [6,24,25] and the clinically relevant isolate D420 [26,27]. Our aims were (i) to define which B. pertussis source proteins contribute ligands to each HLA-DR molecule in this model, (ii) to determine the extent of overlap versus allele-private presentation among the three HLA-DR allotypes, and (iii) to evaluate whether presentation patterns are conserved between strains for proteins detected in both lysates—information that situates contemporary vaccine antigens within a broader, allele-aware map of macrophage class II ligandomes for B. pertussis.

2. Materials and Methods

2.1. Mammalian Cell Culture

THP-1 monocytes (ATCC TIB-202) were obtained from American Type Culture Collection (Manassas, VA, USA) and were grown and maintained in Roswell Park Memorial Institute (RPMI) 1640 medium (Gibco, Thermo Fisher Scientific, Waltham, MA, USA), supplemented with 10% FBS (Gibco, Thermo Fisher Scientific, Waltham, MA, USA) at 37 °C in 5% CO2 atmosphere. The HLA genotype of the cells was determined prior to their use in experiments to ensure authentication.

2.2. Bacterial Cell Culture and Preparation of B. Pertussis Lysates

The Tohama I and D420 strains of B. pertussis were grown in 1 L of iron-free Stainer-Scholte (SS) medium at 37 °C and cells were harvested at their late exponential growth phase by centrifugation at 8000× g for 10 min. The cell pellets were washed with cold PBS, weighed, and resuspended in 20 mL of cold sterile PBS. After a freeze–thaw cycle in a dry ice–ethanol bath, the bacterial cell suspensions were lysed by two sequential passages through a surface-sterilized French pressure cell at 4 °C under 20,000 psi pressure. The bacterial cell homogenates were centrifuged at 3000 × g for 10 min to remove any unbroken cells, and the supernatant fluids were transferred into fresh sterile containers. The lysates were streaked onto Bordet–Gengou (BG) agar plates to assess levels of viable bacteria remaining and other potential microbial contamination. The B. pertussis lysates were flash-frozen in a dry ice–ethanol bath and stored at −80 °C until use.
Before pulsing the cells, the lysates were heat-inactivated at 56 °C for 45 min and subsequently homogenized by sonication using a Qsonica Q125 sonicator equipped with a GL-10 probe (Qsonica, Newtown, CT, USA). Sonication was performed at 50% amplitude for 20 s, followed by a 20 s rest period on ice, for a total of six sonication–rest cycles.

2.3. Differentiation and Pulsing of THP-1

For each experiment, 4 × 108 THP-1 monocytes were stimulated with phorbol 12-myristate acetate (PMA; EMD Millipore, Burlington, MA, USA) at 10 nM for 72 h to induce differentiation into phagocytic macrophage-like cells. After 48 h rest in fresh complete medium, they were stimulated with recombinant human interferon gamma (IFN-γ; Peprotech, Rocky Hill, NJ, USA) at 200 U/mL for another 48 h to induce expression of HLA-DR on the surface. For pulsing with the bacterial lysate, cells were incubated with the bacterial lysate at 1 mg/mL, while the concentration of IFN-γ was maintained at 200 U/mL. After a 24 h incubation period, cells were trypsinized, collected and washed thoroughly with phosphatebuffered saline (PBS) in three cycles of resuspensioncentrifugation. Cell pellets were stored at −80 °C before further processing.

2.4. Flow Cytometry

Undifferentiated THP-1 cells or differentiated THP-1 cells after trypsinization were blocked in a 5% solution of normal goat serum (Abcam, Waltham, MA, USA) in the cell staining buffer (Biolegend, San Diego, CA, USA). After removing the blocking agent, they were resuspended at 1 × 106 cells in 100 µL of cold cell staining buffer and incubated with FITC- or PE-conjugated anti-HLA-DR clone L243 antibody (Biolegend, San Diego, CA, USA) and anti-CD14 antibody (Biolegend, San Diego, CA, USA) or corresponding conjugated isotypes (Biolegend, San Diego, CA, USA) for 30 min. Stained cells were analyzed for immunofluorescence using a Stratedigm S1200Ex (Stratedigm, San Jose, CA, USA). Cell debris and aggregates were excluded from the analysis by appropriate gating. Results were analyzed using the FlowJo version 10.10.0 software (Becton, Dickinson, Ashland, OR, USA).

2.5. Extraction of HLA-Bound Peptides

HLA-bound peptides were extracted from the cell pellets based on the previously published method with some modification [28]. Cell pellets were resuspended in a lysis buffer consisting of 50 mM Tris (pH 8.0), 150 mM NaCl, and 0.5% Igepal (octylphenoxy poly(ethyleneoxy)ethanol), supplemented with the cOmplete protease inhibitor cocktail (Roche, Mannheim, Germany). The resulting material underwent high-speed centrifugation at 200,000× g for a period of 90 min using a Beckman Coulter Optima ultracentrifuge (Beckman Coulter, Indianapolis, IN, USA). Following filtration, the clarified supernatants were applied to in-made immunoaffinity columns conjugated with L243 monoclonal antibodies to selectively isolate HLA-DRcomplexes. Columns were washed sequentially with a series of wash buffers as previously described [28] and were eluted with 0.2 N acetic acid after the last wash. The entire extraction process was performed at 4 °C. For denaturation of HLApeptide complexes and release of the bound peptides, glacial acetic acid was added to the eluate to a final concentration of 10% (v/v), followed by incubation at 76 °C for 10 min. Before fractionation of the extracted peptide mixtures by phase high-performance liquid chromatography (RP-HPLC), eluates were dried under vacuum using a CentriVap concentrator (Labconco, Kansas City, MO, USA) and solid residues were dissolved in water containing acetic acid (10% v/v).

2.6. Fractionation of HLA Peptides by RP-HPLC

To reduce the complexity of the peptide pool obtained from the affinity purification process, the samples underwent fractionation via reverse-phase high-performance liquid chromatography (RP-HPLC). Initially, a CentriVap vacuum concentrator (Labconco, Kansas City, MO, USA) was utilized to dehydrate the eluate. The remaining solid material was then reconstituted in a 10% aqueous acetic acid solution and processed using either a Shimadzu Nexera (Shimadzu Scientific Instruments, Pittsburgh, PA, USA) or a Paradigm MG4 system (Michrom BioResources, Auburn, CA, USA). The separation was performed on a Gemini C18 column (150 mm length, 5 μm particles, 110 Å pores; Phenomenex, Torrance, CA, USA). The mobile phase system, maintained at pH 2, consisted of two components: Solvent A comprised of 98% water and 2% acetonitrile (ACN), and Solvent B (95% ACN, 5% water), with both containing 0.1% trifluoroacetic acid (TFA). After the column was equilibrated to 2% Solvent B, the peptides were introduced over a 19 min loading phase at a flow rate of 160 µL/min, which was maintained throughout the entire gradient. Following sample loading, the gradient was programmed as follows: a linear increase from 4% to 40% Solvent B over 40 min, followed by a second linear increase to 80% Solvent B over 8 min, a 4 min hold at 80% Solvent B, and a return to 2% Solvent B over 3 min. Effluent monitoring was conducted by measuring ultraviolet (UV) absorbance at 215 nm, and a Gilson FC 203B collector (Gilson, Middleton, WI, USA) was used to collect discrete fractions at 2 min intervals.

2.7. Liquid Chromatography–Tandem Mass Spectrometry

Following the first chromatography, 19 peptide-containing fractions were evaporated to dryness and then reconstituted in an aqueous solution containing 10% acetic acid, 2% ACN, and iRT peptides (Biognosys, Schlieren, Switzerland) as internal standards. These fractions were individually injected into an Eksigent nanoLC 415 system utilizing a 0.5 mm trap column (350 µm ID) packed with 3 µm ChromXP C18 particles (120 Å pore size), followed by a 15 cm analytical column (75 µm ID) featuring the same stationary phase (AB Sciex, Framingham, MA, USA). The chromatographic separation was performed at pH 2.5 using a two-mobile-phase system: Solvent A (0.1% formic acid in water) and Solvent B (0.1% formic acid in 95% ACN). After a 2% Solvent B pre-equilibration step, peptides were loaded onto the trap at 5 µL/min and subsequently eluted through the analytical column at a flow rate of 300 nL/min. Elution was achieved via a dual linear gradient: increasing from 10% to 40% B over 70 min, followed by a ramp to 80% B over 7 min.
Peptides were introduced into an AB Sciex TripleTOF 5600 time-of-flight mass spectrometer using either a Nanospray III (AB Sciex, Framingham, MA, USA) or Digital PicoView (New Objective, Littleton, MA, USA) ion source at a potential of 2400 V. Acquisition followed a data-dependent acquisition (DDA) strategy, starting with a 0.25 s TOF-MS survey scan across the m/z 300–1250 range. For each cycle, up to 22 precursor ions—characterized by intensities exceeding 200 cps and charge states from +2 to +4—were targeted for collision-induced dissociation (CID). These MS/MS events occurred over a maximum of 3.3 s, with specific m/z values excluded for 30 s after three initial observations. Fragmentation was optimized using dynamic collision energy based on the mass and charge of the ions, and data were visualized using PeakView Software version 1.2.0.3 (AB Sciex, Framingham, MA, USA).

2.8. Data Analysis

To assign sequences to the resulting spectra, the PEAKS Studio 11.5 software (Bioinformatics Solutions, Waterloo, ON, Canada) was utilized. The identification process was executed with a precursor mass deviation limit of 30 ppm and a product ion mass error tolerance of 0.02 Da. A database comprised of SwissProt Homo sapiens (taxon identifier 9606, accessed on 1 May 2026) and UniProt B. pertussis strain Tohama I (taxon identifier 257313, accessed on 1 May 2026) or the strain D420 RefSeq protein data (RefSeq GCF_001013565.1, accessed on 1 May 2026) [27] and iRT peptide sequences was used as the reference protein database. Variable post-translational modifications including acetylation, deamidation, pyroglutamate formation, methionine oxidation, cysteinylation, and citrullination were analyzed in database search using the immunopeptidome workflow. The assigned peptide sequences were subjected to a 1% false discovery rate (FDR) threshold using the PEAKS decoy-fusion procedure, and after removing PTMs from peptide sequences, they were assigned to HLA-DR alleles by submitting to MHCMotifDecon-1.2 available via https://services.healthtech.dtu.dk/services/MHCMotifDecon-1.2 (accessed on 6 May 2026, Technical University of Denmark, Lyngby, Denmark) [29]. GraphPad Prism software version 9.0.2 (GraphPad Software, San Diego, CA, USA) was used to fit size-distribution data the lognormal distribution model to calculate peptide length geometric means. An unpaired t-test with HolmSidak correction for multiple comparisons (α = 0.05) was used to assess the differences in contribution of different DR alleles to total peptides and B. pertussis peptides. The peptide sequences were aligned human proteome using IEDB PepMatch tool [30].

3. Results

3.1. Establishment of a THP-1–Derived Macrophage Model

THP-1 differentiation into macrophage-like cells was evaluated by flow cytometry for CD14 and HLA-DR. CD14 expression increased after differentiation of monocytic cells into their macrophage-like state (Figure 1a,b). Monocytic THP-1 cells expressed a low level of HLA-DR on the surface (Figure 1c). To augment HLA-DR expression, PMA-differentiated cells were treated with IFN-γ; the macrophage-like cells shown in Figure 1b,d are this PMA plus IFN-γ condition, which markedly increased HLA-DR relative to monocytic cells (Figure 1c vs. Figure 1d). B. pertussis lysate-pulsing experiments were performed using cells differentiated with PMA at 10 nM concentration for 72 h duration and IFN-γ at 200 U/mL for 48 h.

3.2. HLA-DR-Bound Peptide Repertoire of Differentiated THP-1 Cells After B. pertussis Lysate Pulse

After pulse with bacterial lysates prepared from Tohama I and D420, peptides were eluted from immunopurified cell-surface HLA-DR and analyzed by LC-MS/MS using the immunopeptidomics workflow described in Methods. Across both strain conditions, assignments mapped to the three HLA-DR molecules expressed by THP-1 (HLA-DRB1*01:01, HLA-DRB1*15:01, and HLA-DRB5*01:01) totaled 1587 unique sequences at a 1% false discovery rate (FDR). The length distribution peaked at 14–16 residues (Figure 2a), consistent with prior reports for HLA-DR ligands (~15 aa). Eluted peptide binding motifs (Figure 2b) matched established binding motifs for these alleles [31,32]. The B. pertussis assignments exhibited a minimum of three amino acid mismatches from the closest match in the human reference proteome.

3.3. Bordetella Pertussis–Derived HLA-DR Ligands

Using DDA and 1% FDR at the peptide level, the Tohama I strain yielded 51 B. pertussis peptide sequences derived from 22 B. pertussis proteins. Similarly, THP-1 pulsed with lysate from strain D420 provided 31 bacterial peptides derived from 17 B. pertussis proteins. These peptides and their corresponding source proteins are listed in Table 1.
The HLA-DRB1*01:01 presented seven GroEL-derived peptides, six peptides from the DNA-binding protein, and four peptides derived from alcaligin biosynthesis protein C (AlcC). The bacterial antigen that was most frequently sampled for presentation by class II HLA was OmpA with DRB1*15:01 presenting 16 different OmpA peptides.
A total of 32 unique peptides were obtained from Tohama I lysates and 12 unique peptides were found using D420 lysates. These data suggest that differentiated THP-1 cells present a greater number of peptides from Tohama I than from strain D420 (Figure 3a).
To eliminate the biases due to the length variants of a single binding core, we compared the binding core of the peptides presented from the Tohama I and D420 strains and confirmed that a greater number of peptides were presented by differentiated THP-1 cells when they were pulsed with the Tohama I compared to D420 (Figure 3b). Peptides originating from OmpA were presented by DRB1*15:01 with either Tohama I or D420, whereas DRB1*01:01 presented AlcC-derived peptides. The DNA-binding protein was presented only with Tohama I lysates, and more peptide ligands from chaperonin GroEL were presented by DRB1*01:01 after pulsing with Tohama I lysate compared to D420 lysate (7 vs. 3 bacterial peptides). These data illustrate strain-to-strain variability for HLA-DR presentation of some bacterial proteins, while the OmpA-derived peptides were HLA-DR presented in a strain-independent manner. Table 2 summarizes the source antigens from B. pertussis that we found presented by HLA-DR using a DDA method.
When data from the Tohama I and D420 strains are combined, 29 source proteins in total were sampled by HLA-DR for peptides with 12 bacterial source proteins unique to Tohama I and 7 bacterial source proteins unique to the D420 strain (Figure 4).

3.4. Strain Comparison-Tohama I vs. D420

Unique B. pertussis peptide sequences were more numerous for Tohama I than D420 (Figure 3a). Collapsing length variants to shared binding cores preserved this pattern (Figure 3b). The OmpA-derived DRB1*15:01 ligands were detected with either lysate, consistent with strain-independent presentation of this source protein under our assay. By contrast, AlcC- and DNA-binding protein-derived DRB1*01:01 ligands were detected only with Tohama I, and GroEL-derived DRB1*01:01 ligands were more numerous with Tohama I (7 sequences) than D420 (3 sequences), illustrating allele- and strain-dependent differences in the recovered ligand set. Combining both strains, HLA-DR sampled ligands from 29 B. pertussis source proteins, including 12 proteins only in Tohama I, 7 only in D420, and 10 detected with both strains (Table 2; Figure 4). The DMT family receptor protein, a peptide source protein unique to strain D420, lacks a homologous coding sequence in the Tohama I genome.

3.5. Contribution of Individual HLA-DR Allotypes

HLA-DRB1*01:01 contributed 37 bacterial peptide assignments in THP-1 (28 peptides from Tohama I; 18 peptides from D420), as shown in Figure 5.
At the source-protein level, DRB1*01:01 sampled 14 Tohama I proteins and the same number of D420 proteins, with 7 proteins shared between the two strains (Figure 6).
The DRB1*15:01 allele presented 22 bacterial peptides from 7 Tohama I source proteins, but 11 peptides exclusively from OmpA protein with D420, demonstrating sharp strain-dependent restriction of the recovered ligand repertoire for this allele. HLA-DRB5*01:01 contributed few bacterial ligands overall with no overlap between the two strains (Figure 5 and Figure 6).

3.6. Allele Contribution to Bacterial vs. Total DR Immunopeptidome

Overall, in our experiments with B. pertussis strain Tohama I lysates, we found that the contribution of HLA-DRB1*15:01 to the B. pertussis peptide set was significantly greater than its contribution to the total DR immunopeptidome (Figure 7a). The same trend was also observed in our experiments with the strain D420 lysates (Figure 7b).
HLA-DRB1*01:01 accounted for the largest share of the total DR immunopeptidome after either lysate pulse (Figure 7). Its contribution to B. pertussis ligands was also substantial, consistent with this molecule sampling a broader set of bacterial source proteins rather than a single dominant antigen (Figure 5 and Figure 6). HLA-DRB5*01:01 remained a minor contributor to both the total and bacterial peptide sets. Thus, the allele that dominates the self-ligandome is not necessarily the allele that dominates pathogen-ligand recovery.

4. Discussion

We used HLA-DR immunopeptidomics in IFN-γ–treated, PMA-differentiated THP-1 macrophages [33,34,35,36] pulsed with whole Bordetella pertussis lysate to define which bacterial proteins yield naturally processed peptide ligands on three HLA-DR allotypes expressed by this line—HLA-DRB1*01:01, HLA-DRB1*15:01, and HLA-DRB5*01:01. Across lysates from the reference strain Tohama I and the clinical isolate D420, we identified 63 HLA-DR–associated bacterial peptide ligands mapping to 29 source proteins. Only 19 ligands from 8 source proteins were detected from both bacterial lysates in this system. Presentation was allele-skewed rather than a single shared inventory: DRB1*01:01 accounted for 37 bacterial ligands from 21 source proteins, DRB1*15:01 for 22 ligands from 7 proteins, and DRB5*01:01 for 4 ligands from 4 proteins. Thirty-two bacterial peptide ligands were uniquely recovered from Tohama I and 12 uniquely from D420.
Together, these results show that B. pertussis HLA-DR ligandomes are jointly shaped by bacterial strain and HLA-DR molecule: an antigen that yields peptide ligands for one HLA-DR product often does not for another, and peptides from a given antigen may be recovered after pulse with one strain but not the other. We did not assess T cell recognition; eluted ligands report what reached stable HLA-DR–peptide complexes under the conditions tested, not immunogenicity or protection. A presented peptide may still fail to elicit a CD4+ response if the corresponding TCR specificity is missing or deleted (a hole in the repertoire), if precursor frequency is very low, or if regulatory mechanisms dominate. Conversely, CD4 epitopes can exist below the detection limit of data-dependent immunopeptidomics.
A central finding is that DRB1*01:01 and DRB1*15:01 both presented B. pertussis ligands, but from different source-protein portfolios. DRB1*01:01 drew ligands from a wide set of bacterial proteins—including GroEL, DNA-binding protein, and AlcC—whereas DRB1*15:01 was dominated by OmpA, particularly when cells were pulsed with D420 lysate, for which all DRB1*15:01assigned bacterial sequences mapped to OmpA. DRB5*01:01 contributed a small, distinct set (four ligands from four proteins, with no bacterial overlap between strains in this allele’s assignments). Most source proteins primarily fed ligands to one of the three HLA-DR molecules assayed, so the alleles did not simply resample the same immunopeptidome at different depths; they recovered ligands from largely non-overlapping antigen sets.
This skew has practical implications for interpreting class II–restricted immunity. HLA-DRB1 expression has been associated with variation in vaccine-elicited antibody responses in population studies [37], and our data add a ligand-level perspective: the DRB1 allele that dominates total DR presentation is not necessarily the allele that dominates presentation of a given pathogen’s ligands. With Tohama I lysate, DRB1*15:01 accounted for a greater fraction of B. pertussis–derived DR ligands than of the overall DR immunopeptidome (Figure 7a), and a similar trend was seen with D420 (Figure 7b) but did not reach statistical significance, likely reflecting lower bacterial spectral depth and run-to-run variation for that strain. Together, these patterns support an HLA-DR allele-aware analysis of B. pertussis class II presentation rather than collapsing a study across all DR molecules or haplotypes.
Stenger et al. eluted HLA-DR ligands from human monocyte-derived dendritic cells after uptake of B. pertussis biomass and linked selected ligands to CD4+ T cell responses, reporting a comparatively small set of bacterial sequences [38]. Our workflow differs in APC type (THP-1–derived macrophages), activation (IFN-γ), antigen format (defined lysate pulse), strains (Tohama I and D420), mass spectrometry platform, search and deconvolution pipeline, and the explicit comparison of three DR allotypes in one genotype. Our findings agree qualitatively with prior work that only a subset of bacterial proteins contribute detectable class II ligands in a given model, and that the eluted pool is not dominated exclusively by canonical aP components under the conditions tested.
Separately, genome-wide and donor-based CD4+ T cell screens document broad recognition of the B. pertussis proteome, including many proteins beyond aP antigens [15,19,39,40]. Those approaches and immunopeptidomics are complementary: recall and screening assays report what memory T cells can recognize across diverse HLA backgrounds, whereas elution reports what is loaded onto defined HLA-DR allotypes in a chosen APC context. In our catalog, the intersection of source proteins with ligand assignments to both DRB1*01:01 and DRB1*15:01 is small—three proteins in total—and includes established aP components pertactin (PRN) and filamentous hemagglutinin (FHA). GroEL-derived ligands were recovered primarily with DRB1*01:01, illustrating that proteins highlighted as immunogenic in population-level T cell studies are not guaranteed to supply ligands on every DR allotype without allele-resolved measurement. None of the eluted sequences in our dataset are currently recorded in the Immune Epitope Database (IEDB); overlap with highly T cell-reactive regions reported for FHA and GroEL in donor cohorts [39] is therefore hypothesis-generating for follow-up tetramer or activation assays in matched HLA types.
Because the bacterial culture, THP-1 differentiation and pulsing, HLA-DR isolation, and mass spectrometry were held constant, comparison of Tohama I and D420 lysates tests how strain choice alters the eluted ligand inventory in a fixed host genotype. Unique bacterial ligand counts were higher for Tohama I than D420 whether analyzed at the level of peptide sequences or collapsed binding cores (Figure 3). OmpA-derived DRB1*15:01 ligands were detected with either lysate, consistent with robust presentation of this source protein in this model. By contrast, AlcC– and DNA-binding protein-derived DRB1*01:01 ligands were seen only with Tohama I, and GroEL-derived DRB1*01:01 ligands were more numerous with Tohama I than D420. Combining both strains, HLA-DR sampled ligands from 29 source proteins: 12 Tohama I–only, 7 D420-only, and 10 detected with both strains (Table 2; Figure 4). That overlap defines a strain-transcendent core while preserving strain-private ligand sets.
An instructive case is PRN. With Tohama I, we detected two distinct PRN-derived ligands—AAGVAAMQGAVVHLQR (presented by DRB1*01:01) and DGWFLEPQAELAVFRAGGGAY (presented by DRB1*15:01)—whereas with D420 lysate neither DRB1 allele yielded a PRN assignment in our experiments, despite D420 encoding a full-length PRN and identical aminoacid sequence at the mapped binding cores relative to Tohama I. PRN-deficient circulating isolates have been reported in aP-using settings [12,41], but that genetic context does not explain the Tohama I–positive, D420-negative pattern here. We favor explanations involving PRN abundance in lysate, competition with the self-ligandome, routing or processing differences, or DDA undersampling—without implying that D420 cannot yield these ligands under other conditions. More generally, absence from an eluate list is not proof of non-presentation; positive calls in one strain/allele combination are nevertheless informative for catalog building. The DMT family transporter, detected only with D420, lacks a homologous coding sequence in the Tohama I reference genome and illustrates how reliance on a historical vaccine strain alone could miss ligand sources relevant to contemporary isolates.
The introduction framed a tension between narrow aP antigen content and an evolving pathogen; the ligand data sharpen that discussion in HLA-specific terms. If most B. pertussis source proteins in lysate-pulsed macrophages feed ligands primarily to a single DRB1 allele (with DRB5 contributing only a minor pathogen set), subunit vaccines built from proteins that are poorly represented across common HLA-DR allotypes may have inherently uneven population coverage for CD4+ priming, even when those proteins are immunogenic by other readouts. Reformulating aP content remains constrained by manufacturing, safety, and regulatory precedent; our results suggest that the prioritization of bacterial proteins should include allele-resolved antigen presentation data, not binding prediction or T cell screens alone.
Against that background, a carefully circumscribed but notable observation is that PRN and FHA—both established aP components—were among the very few source proteins supplying ligand assignments to both DRB1*01:01 and DRB1*15:01. Ligand elution is not a readout of protective CD4+ help, yet under these conditions two priority vaccine antigens also rank among the more cross–DRB1-accessible B. pertussis proteins in the eluted ligand data. A parsimonious interpretation is that current aP formulations include representatives of a scarce class of antigens compatible with at least this pair of common DRB1 alleles in macrophages; identifying additional proteins with similar multi-allelic presentation may be non-trivial and may require broader experimental systems than the present study.
Beyond PRN and FHA, our inventory nominates BrkA, OmpA, tracheal colonization factor (TcfA), and the DMT family transporter—together with numerous additional source proteins in Table 1 and Table 2—for follow-up immunopeptidomics across a wider panel of HLA-DR, -DP, and -DQ molecules (L243 captures DR only). Proteomics and immunoproteomics studies have independently highlighted several of these protein classes as immunologically relevant [19,21,27]; the present data add direct evidence of natural HLA-DR ligand formation for selected sequences in a macrophage lysate-pulse model. Whether these ligands support productive CD4+ responses in human donors remains to be tested by HLA-matched functional assays.
Several limitations bound interpretation. First, THP-1 macrophages are a tractable human model but represent a single HLA genotype and one differentiation state; dendritic cells, primary macrophages, and other phagocytes may differ in routing and ligand hierarchy. Second, lysate pulse is not infection; it standardizes antigen encounter, but bypasses live bacterial gene expression, adhesin-mediated uptake, and intracellular niches. Third, HLA-DR assignment relied on MHCMotifDecon deconvolution in a heterozygous line; closely related sequences and co-immunoprecipitated DR molecules introduce assignment uncertainty, and HLA-DP and HLA-DQ ligands were not captured. Fourth, DDA with complex lysates favors detection of abundant ligands; strain and allele differences in recovery should be distinguished from differences in presentation capacity where possible (e.g., targeted MS, normalized input, additional replicates). Priority next steps include extending the allele panel and APC types, comparing infection-based antigen delivery with lysate pulse, adding clinical isolates beyond D420, and linking eluted ligands to CD4+ recognition in HLA-typed cohorts. Systematic expansion along those axes will clarify which bacterial proteins reliably supply ligands on multiple class II molecules—and whether such patterns correlate with durable helper responses relevant to next-generation pertussis vaccines.

5. Conclusions

In this study we completed HLA-DR immunopeptidomics using IFN-γ-stimulated, PMA-differentiated THP-1 macrophages pulsed with whole-cell lysates of Bordetella pertussis to define which bacterial proteins yield naturally processed peptide ligands on three HLA-DR allotypes expressed by this line—HLA-DRB1*01:01, HLA-DRB1*15:01, and HLA-DRB5*01:01—and how that inventory differs between the vaccine/reference strain Tohama I and the clinical isolate D420. We recovered 63 bacterial HLA-DR ligands from 29 source proteins. Presentation was allele-skewed: most source proteins contributed ligands primarily to one of the three HLA-DR molecules, so an antigen that supplies peptides to one DR product need not supply peptides to another. Strain further partitioned the ligandome, with only a minority of ligands recovered after pulse with both Tohama I and D420.
Two established acellular pertussis (aP) vaccine antigens, pertactin and filamentous hemagglutinin, were among the few proteins that contributed ligands to both DRB1*01:01 and DRB1*15:01 under these conditions, while other bacterial proteins not in current aP vaccines—including BrkA, OmpA, tracheal colonization factor, and a DMT family transporter—yielded HLA-DR ligands of interest. Eluted ligands report stable cell surface HLA-DR–peptide complexes in this macrophage lysate-pulse model; a priori, they do not establish CD4+ immunogenicity or protection. Within that scope, the data support HLA-DR- and strain-aware interpretation of B. pertussis class II presentation and argue that prioritization of antigens for next-generation pertussis vaccines should incorporate allele-resolved ligand discovery alongside conventional immunogenicity screens.

Author Contributions

Conceptualization, W.H.H., A.S. and R.d.S.A.; methodology, H.Y., S.K., S.K.A., T.J.B. and W.H.H.; formal analysis, H.Y.; resources, A.S. and W.H.H.; writing—original draft preparation, H.Y.; writing—review and editing, W.H.H.; supervision, W.H.H.; funding acquisition, A.S. and W.H.H. All authors have read and agreed to the published version of the manuscript.

Funding

This research was supported by a subaward agreement with La Jolla Institute for Immunology under National Institutes of Health (NIH), National Institute of Allergy and Infectious Diseases (NIAID), prime award number 75N93019C00066.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The raw mass spectrometry data acquired in this study and result files are openly available in the Center for Computational Mass Spectrometry (MassIVE, https://massive.ucsd.edu, accessed on 27 July 2026) under MSV000102625 accession number.

Conflicts of Interest

The authors declare no conflicts of interest.

Abbreviations

The following abbreviations are used in this manuscript:
ACNAcetonitrile
AlcCAlcaligin biosynthesis protein
aPAcellular pertussis vaccine
APCAntigen-presenting cell
BGBordet–Gengou medium
B. pertussisBordetella pertussis
BrkABordetella resistance to killing A
CDCluster of differentiation
CIDCollision-induced dissociation
DMTDivalent metal transporter
FBSFetal bovine serum
DDAData-dependent acquisition
FDRFalse discovery rate
FHAFilamentous hemagglutinin
FIMFimbrial antigen
FITCFluorescein isothiocyanate
HLAHuman leukocyte antigen
IDAInformation-dependent analysis
IEDBImmune epitope database
IFN-γInterferon gamma
iRTIndexed retention time
MSMass spectrometry
OmpAOuter membrane protein A
PBSPhosphate-buffered saline
PEPhycoerythrin
PMAPhorbol 12-Myristate Acetate
PRNPertactin
PTPertussis toxin
PTMPost-translational modification
RP-HPLCReverse-phase high-performance liquid chromatography
RPMIRoswell Park Memorial Institute
SSStainer-Scholte medium
TcfATracheal colonization factor
TFATrifluoroacetic acid
ThT helper
TOFTime of flight
UVUltraviolet
wPWhole-cell pertussis vaccine

References

  1. Gillard, J.; Suffiotti, M.; Brazda, P.; Venkatasubramanian, P.B.; Versteegen, P.; de Jonge, M.I.; Kelly, D.; Bibi, S.; Pinto, M.V.; Simonetti, E.; et al. Antiviral responses induced by Tdap-IPV vaccination are associated with persistent humoral immunity to Bordetella pertussis. Nat. Commun. 2024, 15, 2133. [Google Scholar] [CrossRef] [Scilit]
  2. Cherry, J.D. The epidemiology of pertussis and pertussis immunization in the United Kingdom and the United State: A Comparative study. Curr. Probl. Pediatr. 1984, 14, 7–77. [Google Scholar] [CrossRef] [Scilit]
  3. Ausiello, C.M.; Cassone, A. Acellular Pertussis Vaccines and Pertussis Resurgence: Revise or Replace? mBio 2014, 5, e01339-14. [Google Scholar] [CrossRef] [Scilit]
  4. World Health Organization. The Immunological Basis for Immunization Series: Module 4: Pertussis; Immunological Basis for Immunization Series; World Health Organization: Geneva, Switzerland, 2017; Volume 4. [Google Scholar]
  5. Cherry, J.D. The 112-Year Odyssey of Pertussis and Pertussis Vaccines—Mistakes Made and Implications for the Future. J. Pediatr. Infect. Dis. Soc. 2019, 8, 334–341. [Google Scholar] [CrossRef] [Scilit]
  6. Sato, Y.; Sato, H. Development of Acellular Pertussis Vaccines. Biologicals 1999, 27, 61–69. [Google Scholar] [CrossRef] [Scilit]
  7. Cherry, J.D. Epidemic Pertussis in 2012—The Resurgence of a Vaccine-Preventable Disease. N. Engl. J. Med. 2012, 367, 785–787. [Google Scholar] [CrossRef] [Scilit]
  8. Centers for Disease Control and Prevention. Pertussis Surveillance and Trends. Available online: https://www.cdc.gov/pertussis/php/surveillance/index.html (accessed on 24 June 2026).
  9. European Centre for Disease Prevention and Control. Increase of Pertussis Cases in the EU/EEA; ECDC: Stockholm, Sweden, 2024. [Google Scholar] [CrossRef]
  10. Pan American Health Organization; World Health Organization. Epidemiological Alert: Increase in Pertussis (Whooping Cough) in the Americas Region; PAHO: Washington, DC, USA, 2025. [Google Scholar]
  11. Linz, B.; Ivanov, Y.V.; Preston, A.; Brinkac, L.; Parkhill, J.; Kim, M.; Harris, S.R.; Goodfield, L.L.; Fry, N.K.; Gorringe, A.R.; et al. Acquisition and loss of virulence-associated factors during genome evolution and speciation in three clades of Bordetella species. BMC Genom. 2016, 17, 767. [Google Scholar] [CrossRef] [Scilit]
  12. Martin, S.W.; Pawloski, L.; Williams, M.; Weening, K.; DeBolt, C.; Qin, X.; Reynolds, L.; Kenyon, C.; Giambrone, G.; Kudish, K.; et al. Pertactin-Negative Bordetella pertussis Strains: Evidence for a Possible Selective Advantage. Clin. Infect. Dis. 2014, 60, 223–227. [Google Scholar] [CrossRef] [Scilit]
  13. Weigand, M.R.; Williams, M.M.; Peng, Y.; Kania, D.; Pawloski, L.C.; Tondella, M.L.; CDC Pertussis Working Group. Genomic survey of Bordetella pertussis diversity, United States, 2000–2013. Emerg. Infect. Dis. 2018, 25, 780–783. [Google Scholar] [CrossRef] [Scilit]
  14. Zomer, A.; Otsuka, N.; Hiramatsu, Y.; Kamachi, K.; Nishimura, N.; Ozaki, T.; Poolman, J.; Geurtsen, J. Bordetella pertussis population dynamics and phylogeny in Japan after adoption of acellular pertussis vaccines. Microb. Genom. 2018, 4, e000180. [Google Scholar] [CrossRef] [Scilit]
  15. Antunes, R.d.S.; Soldevila, F.; Pomaznoy, M.; Babor, M.; Bennett, J.; Tian, Y.; Khalil, N.; Qian, Y.; Mandava, A.; Scheuermann, R.H.; et al. A system-view of Bordetella pertussis booster vaccine responses in adults primed with whole-cell versus acellular vaccine in infancy. J. Clin. Investig. 2021, 6, e141023. [Google Scholar] [CrossRef] [Scilit]
  16. Dewan, K.K.; Linz, B.; DeRocco, S.E.; Harvill, E.T. Acellular Pertussis Vaccine Components: Today and Tomorrow. Vaccines 2020, 8, 217. [Google Scholar] [CrossRef] [Scilit]
  17. Antunes, R.D.S.; Quiambao, L.G.; Sutherland, A.; Soldevila, F.; Dhanda, S.K.; Armstrong, S.K.; Brickman, T.J.; Merkel, T.; Peters, B.; Sette, A. Development and Validation of a Bordetella pertussis Whole-Genome Screening Strategy. J. Immunol. Res. 2020, 2020, 8202067. [Google Scholar] [CrossRef] [Scilit]
  18. Basmenj, E.R.; Izadkhah, H.; Hosseinpour, M.; Saburi, E.; Ezabadi, M.A.; Alipourfard, I. A novel approach to design a multiepitope peptide as a vaccine candidate for Bordetella pertussis. J. Biomol. Struct. Dyn. 2023, 42, 13738–13750. [Google Scholar] [CrossRef] [Scilit]
  19. Gregg, A.K.; Wang, Y.; Warfel, J.; Schoenfeld, E.; Jankowska, E.; Cipollo, J.F.; Mayho, M.; Boinett, C.; Prasad, D.; Brickman, T.J.; et al. Antigen Discovery for Next-Generation Pertussis Vaccines Using Immunoproteomics and Transposon-Directed Insertion Sequencing. J. Infect. Dis. 2022, 227, 583–591. [Google Scholar] [CrossRef] [Scilit]
  20. Luu, L.D.W.; Octavia, S.; Aitken, C.; Zhong, L.; Raftery, M.J.; Sintchenko, V.; Lan, R. Surfaceome analysis of Australian epidemic Bordetella pertussis reveals potential vaccine antigens. Vaccine 2020, 38, 539–548. [Google Scholar] [CrossRef] [Scilit]
  21. Möller, J.; Kraner, M.E.; Burkovski, A. Proteomics of Bordetella pertussis whole-cell and acellular vaccines. BMC Res. Notes 2019, 12, 329. [Google Scholar] [CrossRef] [Scilit]
  22. Petersen, J.W.; Holm, A.; Ibsen, P.H.; Hasløv, K.; Capiau, C.; Heron, I. Identification of human T-cell epitopes on the S4 subunit of pertussis toxin. Infect. Immun. 1992, 60, 3962–3970. [Google Scholar] [CrossRef] [Scilit]
  23. Piatti, G. Identification of immunodominant epitopes in the filamentous hemagglutinin of Bordetella pertussis. FEMS Immunol. Med. Microbiol. 1999, 23, 235–241. [Google Scholar] [CrossRef] [Scilit]
  24. Sato, Y.; Kimura, M.; Fukumi, H. Development of a Pertussis Component Vaccine in Japan. Lancet 1984, 323, 122–126. [Google Scholar] [CrossRef] [Scilit]
  25. Sato, Y.; Sato, H. Further characterization of Japanese acellular pertussis vaccine prepared in 1988 by 6 Japanese manufacturers. Tokai J. Exp. Clin. Med. 1988, 13, 79–88. [Google Scholar]
  26. Parkhill, J.; Sebaihia, M.; Preston, A.; Murphy, L.D.; Thomson, N.; Harris, E.D.; Holden, M.T.G.; Churcher, C.M.; Bentley, S.D.; Mungall, K.L.; et al. Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat. Genet. 2003, 35, 32–40. [Google Scholar] [CrossRef] [Scilit]
  27. Boinett, C.J.; Harris, S.R.; Langridge, G.C.; Trainor, E.A.; Merkel, T.J.; Parkhill, J. Complete Genome Sequence of Bordetella pertussis D420. Genome Announc. 2015, 3, e00657-15, Erratum in Genome Announc. 2015, 3, e00842-15. https://doi.org/10.1128/genomea.00842-15. [Google Scholar] [CrossRef] [Scilit]
  28. Purcell, A.W. Isolation and characterization of naturally processed MHC-bound peptides from the surface of antigen-presenting cells. Methods Mol. Biol. 2004, 251, 291–306. [Google Scholar] [CrossRef] [Scilit]
  29. Kaabinejadian, S.; Barra, C.; Alvarez, B.; Yari, H.; Hildebrand, W.H.; Nielsen, M. Accurate MHC Motif Deconvolution of Immunopeptidomics Data Reveals a Significant Contribution of DRB3, 4 and 5 to the Total DR Immunopeptidome. Front. Immunol. 2022, 13, 835454. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Marrama, D.; Chronister, W.D.; Westernberg, L.; Vita, R.; Koşaloğlu-Yalçın, Z.; Sette, A.; Nielsen, M.; Greenbaum, J.A.; Peters, B. PEPMatch: A tool to identify short peptide sequence matches in large sets of proteins. BMC Bioinform. 2023, 24, 485. [Google Scholar] [CrossRef] [Scilit]
  31. Reynisson, B.; Barra, C.; Kaabinejadian, S.; Hildebrand, W.H.; Peters, B.; Nielsen, M. Improved Prediction of MHC II Antigen Presentation through Integration and Motif Deconvolution of Mass Spectrometry MHC Eluted Ligand Data. J. Proteome Res. 2020, 19, 2304–2315. [Google Scholar] [CrossRef] [Scilit]
  32. Nilsson, J.B.; Kaabinejadian, S.; Yari, H.; Kester, M.G.D.; van Balen, P.; Hildebrand, W.H.; Nielsen, M. Accurate prediction of HLA class II antigen presentation across all loci using tailored data acquisition and refined machine learning. Sci. Adv. 2023, 9, eadj6367. [Google Scholar] [CrossRef] [Scilit]
  33. Auwerx, J. The human leukemia cell line, THP-1: A multifacetted model for the study of monocyte-macrophage differentiation. Cell. Mol. Life Sci. 1991, 47, 22–31. [Google Scholar] [CrossRef] [Scilit]
  34. Jakubzick, C.V.; Randolph, G.J.; Henson, P.M. Monocyte differentiation and antigen-presenting functions. Nat. Rev. Immunol. 2017, 17, 349–362. [Google Scholar] [CrossRef] [Scilit]
  35. Chanput, W.; Mes, J.J.; Wichers, H.J. THP-1 cell line: An in vitro cell model for immune modulation approach. Int. Immunopharmacol. 2014, 23, 37–45. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Tsuchiya, S.; Yamabe, M.; Yamaguchi, Y.; Kobayashi, Y.; Konno, T.; Tada, K. Establishment and characterization of a human acute monocytic leukemia cell line (THP-1). Int. J. Cancer 1980, 26, 171–176. [Google Scholar] [CrossRef] [Scilit]
  37. Mentzer, A.J.; Dilthey, A.T.; Pollard, M.; Gurdasani, D.; Karakoc, E.; Carstensen, T.; Muhwezi, A.; Cutland, C.; Diarra, A.; Antunes, R.d.S.; et al. High-resolution African HLA resource uncovers HLA-DRB1 expression effects underlying vaccine response. Nat. Med. 2024, 30, 1384–1394. [Google Scholar] [CrossRef] [Scilit]
  38. Stenger, R.M.; Meiring, H.D.; Kuipers, B.; Poelen, M.; Brink, J.A.M.v.G.-V.D.; Boog, C.J.P.; de Jong, A.P.J.M.; van Els, C.A.C.M. Bordetella pertussis Proteins Dominating the Major Histocompatibility Complex Class II-Presented Epitope Repertoire in Human Monocyte-Derived Dendritic Cells. Clin. Vaccine Immunol. 2014, 21, 641–650. [Google Scholar] [CrossRef] [Scilit]
  39. Antunes, R.d.S.; Garrigan, E.; Quiambao, L.G.; Dhanda, S.K.; Marrama, D.; Westernberg, L.; Wang, E.; Abawi, A.; Sutherland, A.; Armstrong, S.K.; et al. T cell reactivity to Bordetella pertussis is highly diverse regardless of childhood vaccination. Cell Host Microbe 2023, 31, 1404–1416.e4. [Google Scholar] [CrossRef] [Scilit]
  40. Natrajan, M.S.; Hall, J.M.; Weigand, M.R.; Peng, Y.; Williams, M.M.; Momin, M.; Damron, F.H.; Dubey, P.; Tondella, M.L.; Pawloski, L.C. Genome-based prediction of cross-protective, HLA-DR-presented epitopes as putative vaccine antigens for multiple Bordetella species. Microbiol. Spectr. 2024, 12, e0352723. [Google Scholar] [CrossRef] [Scilit]
  41. Ma, L.; Caulfield, A.; Dewan, K.K.; Harvill, E.T. Pertactin-Deficient Bordetella pertussis, Vaccine-Driven Evolution, and Reemergence of Pertussis. Emerg. Infect. Dis. 2021, 27, 1561–1566. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Surface expression of CD14 and HLA-DR in naïve monocytic THP-1 cells and on THP-1-derived macrophage-like cells after PMA plus IFN-γ. Overlays include the corresponding isotype-control antibody. (a) CD14 on monocytic cells; (b) CD14 on macrophage-like cells; (c) HLA-DR on monocytic cells; (d) HLA-DR on macrophage-like cells.
Figure 1. Surface expression of CD14 and HLA-DR in naïve monocytic THP-1 cells and on THP-1-derived macrophage-like cells after PMA plus IFN-γ. Overlays include the corresponding isotype-control antibody. (a) CD14 on monocytic cells; (b) CD14 on macrophage-like cells; (c) HLA-DR on monocytic cells; (d) HLA-DR on macrophage-like cells.
Vaccines 14 00733 g001
Figure 2. Global HLA-DR ligand characteristics after B. pertussis lysate pulse. (a) Length distribution of HLA-DR-bound peptides isolated from differentiated THP-1 cells and (b) binding motifs of peptides assigned to each HLA-DR molecule expressed by THP-1 cells.
Figure 2. Global HLA-DR ligand characteristics after B. pertussis lysate pulse. (a) Length distribution of HLA-DR-bound peptides isolated from differentiated THP-1 cells and (b) binding motifs of peptides assigned to each HLA-DR molecule expressed by THP-1 cells.
Vaccines 14 00733 g002
Figure 3. Overlap of B. pertussis HLA-DR-bound peptide sequences presented by differentiated THP-1 cells pulsed with Tohama I or D420 lysates. (a) Overlap of unique full-length bacterial peptide sequences recovered from each strain pulse. Nested length variants that share a registry are counted as separate sequences. (b) Overlap after collapsing nested length variants to a single 9-mer binding core per nested set, so each core is counted once.
Figure 3. Overlap of B. pertussis HLA-DR-bound peptide sequences presented by differentiated THP-1 cells pulsed with Tohama I or D420 lysates. (a) Overlap of unique full-length bacterial peptide sequences recovered from each strain pulse. Nested length variants that share a registry are counted as separate sequences. (b) Overlap after collapsing nested length variants to a single 9-mer binding core per nested set, so each core is counted once.
Vaccines 14 00733 g003
Figure 4. Overlap of B. pertussis source proteins that contributed ≥1 HLA-DR ligand after Tohama I versus D420 lysate pulsing of differentiated THP-1 cells.
Figure 4. Overlap of B. pertussis source proteins that contributed ≥1 HLA-DR ligand after Tohama I versus D420 lysate pulsing of differentiated THP-1 cells.
Vaccines 14 00733 g004
Figure 5. Number of B. pertussis peptide ligands assigned to each THP-1 HLA-DR molecule after Tohama I or D420 pulsing.
Figure 5. Number of B. pertussis peptide ligands assigned to each THP-1 HLA-DR molecule after Tohama I or D420 pulsing.
Vaccines 14 00733 g005
Figure 6. Number of B. pertussis source proteins contributing ligands to each THP-1 HLA-DR molecule after Tohama I or D420 lysate pulsing.
Figure 6. Number of B. pertussis source proteins contributing ligands to each THP-1 HLA-DR molecule after Tohama I or D420 lysate pulsing.
Vaccines 14 00733 g006
Figure 7. Relative contribution of each THP-1 HLA-DR molecule to (i) the total HLA-DR immunopeptidome and (ii) the B. pertussis–derived ligand subset after pulsing with (a) Tohama I or (b) D420 lysate. Error bars represent the standard deviation (SD) of each group. *: statistically significant (p < 0.05), ns: not significant.
Figure 7. Relative contribution of each THP-1 HLA-DR molecule to (i) the total HLA-DR immunopeptidome and (ii) the B. pertussis–derived ligand subset after pulsing with (a) Tohama I or (b) D420 lysate. Error bars represent the standard deviation (SD) of each group. *: statistically significant (p < 0.05), ns: not significant.
Vaccines 14 00733 g007
Table 1. Peptide sequences and the corresponding source proteins from B. pertussis presented by HLA-DR of differentiated THP-1 cells.
Table 1. Peptide sequences and the corresponding source proteins from B. pertussis presented by HLA-DR of differentiated THP-1 cells.
SequenceStrain *Binding CoreHLAAccessionSource Protein
KGELQPIASNKTREGT & DLQPIASNKTDRB1*15:01Q7VZG6Outer membrane protein A
GKGELQPIASNKTREGT & D
GKGELQPIASNKTRED
KGELQPIASNKTREGRT & D
EGKGELQPIASNKTREGT & D
KGELQPIASNKTRET & D
GKGELQPIASNKTREGRT & D
EGKGELQPIASNKTRET & D
EGKGELQPIASNKTREGRT & D
KGELQPIASNKTREGRAT
GKGELQPIASNKTRT
KGELQPIASNKTRT
TEGKGELQPIASNKTREGRT
EGKGELQPIASNKTREGRAT & D
EGKGELQPIASNKTRT & D
IYTEGKGELQPIASNKTREGRT
LKDKFENIGAQLVKDTFENIGAQLVDRB1*01:01P48210Chaperonin GroEL
KDKFENIGAQLVKDVAT & D
LKDKFENIGAQLVKDVAT & D
LKDKFENIGAQLVKT
DKFENIGAQLVKT
LEDIAILTGGTVIST & DIAILTGGTVDRB1*01:01
DIAILTGGTVIST
APRWLAAEEAAGAKRDTLAAEEAAGADRB1*01:01Q79GJ5DNA-binding protein (Histone)
APRWLAAEEAAGAKRT
APRWLAAEEAAGAKRDST
GKAPRWLAAEEAAGAKRDT
GKAPRWLAAEEAAGAKRT
GKAPRWLAAEEAAGAKRDST
DYHGYAPEAATPVRTYAPEAATPVDRB1*01:01Q7VW17Alcaligin biosynthesis protein C
YHGYAPEAATPVRT
EDYHGYAPEAATPVRT
AEDYHGYAPEAATPVRT
AGHDIHIINSAKLENTGTIHIINSAKLDRB1*15:01P12255Filamentous hemagglutinin
IDSMTALGAIGVQAGDMTALGAIGVDRB1*01:01
AAGVAAMQGAVVHLQRTVAAMQGAVVDRB1*01:01P14283Pertactin autotransporter
DGWFLEPQAELAVFRAGGGAYTLAVFRAGGGDRB1*15:01
IPVAVALESGALARGDIT & DVALESGALADRB1*01:01Q45340BrkA autotransporter
IPVAVALESGALARGD
IDALTVVQGNAARLSDLTVVQGNAADRB1*01:01Q7VZS2Rhodanese domain-containing protein
QLVQQTDYYAPVRTLVQQTDYYADRB1*15:01
ISRIALETGIPVANGT & DIALETGIPVDRB1*01:01Q7VTN46,7-dimethyl-8-ribityllumazine synthase
AISRIALETGIPVANGDIALETGIPVDRB1*01:01
ADLVYVAQTGVVGAPQDYVAQTGVVGDRB1*01:01P65622Membrane protein insertase YidC
VGKFDLLSGRAIWKDFDLLSGRAIDRB1*01:01Q7VWL3Outer membrane protein assembly factor BamB
DATAYAIEGGKLVVTDYAIEGGKLVDRB1*01:01Q7VT71Malate synthase G
KPGIAYSILGPVAAANDYSILGPVAADRB1*01:01Q7VX91Aspartokinase
NPNPEILPEAAHAVRTILPEAAHAVDRB1*01:01Q7VZ68NADP-dependent malic enzyme
TPSDQYQFISGTIVRT & DYQFISGTIVDRB1*01:01Q7VTP4Phosphopantetheine adenylyltransferase
EPQPEIVPAAPEPVTPPT & DIVPAAPEPVDRB1*01:01Q7VYR6SMC-Scp complex subunit ScpB
DGGQVKIIENAEGARTTVKIIENAEGDRB1*15:01Q7VVY2Chaperone protein DnaK
IPAFSVDEAVAAAEKT & DFSVDEAVAADRB1*01:01Q7VVU5Succinate-CoA ligase [ADP-forming] subunit beta
LPPELAALLAASVEHT & DLAALLAASVDRB1*01:01Q7VUY8Integral membrane protein
ASSGLYIAWRATSRRDYIAWRATSRDRB5*01:01WP_080265467.1DMT family transporter
AAPPLAHAAAAPVATLAHAAAAPVDRB1*01:01Q7VS71Two-component response regulator
IAGDLCIYTNQNHVIETLCIYTNQNHDRB1*15:01Q7VUK0ATP-dependent protease subunit HslV
QRLLELRARLRRPVTLLELRARLRDRB5*01:01Q7VU64Anthranilate synthase component 1
EALNKSQLIAYLVENTGVEAKTLIAYLVENTDRB1*15:01Q7VWY4DNA-binding protein Bph2
APLAALAALWLADLAALAALWLDRB1*01:01Q7VWT5Membrane protein
VYLEPGEAAITNTATTLEPGEAAITDRB1*01:01Q7VZY7Carboxynorspermidine/carboxyspermidine decarboxylase
AGAPAAGVPAAPAPKPAPKPTGVPAAPAPKDRB5*01:01Q7W0D8Exported protein
IATLPGIGRSTAAAIATIGRSTAAAIDRB1*01:01Q7VST7Adenine DNA glycosylase
LTPVAGGVWGRAFGRRQDVDDWGRAFGRRQDRB5*01:01Q79GX8Tracheal colonization factor
* T: Tohama I, D: D420.
Table 2. Source protein of B. pertussis-derived ligands presented by HLA-DR of differentiated THP-1 cells.
Table 2. Source protein of B. pertussis-derived ligands presented by HLA-DR of differentiated THP-1 cells.
AccessionProtein NameNumber of PeptidesStrain *
Q7VZG6Outer membrane protein A16T & D
P48210Chaperonin GroEL7T & D
Q79GJ5DNA-binding protein (Histone)6T
Q7VW17Alcaligin biosynthesis protein C4T
P12255Filamentous hemagglutinin 2T & D
P14283Pertactin autotransporter 2T
Q45340BrkA autotransporter2T & D
Q7VZS2Rhodanese domain-containing protein2T & D
Q7VTN46,7-dimethyl-8-ribityllumazine synthase2T & D
P65622Membrane protein insertase YidC1D
Q7VWL3Outer membrane protein assembly factor BamB1D
Q7VT71Malate synthase G1D
Q7VX91Aspartokinase1D
Q7VZ68NADP-dependent malic enzyme1T
Q7VTP4Phosphopantetheine adenylyltransferase1T & D
Q7VYR6SMC-Scp complex subunit ScpB1T & D
Q7VVY2Chaperone protein DnaK1T
Q7VVU5Succinate-CoA ligase1T & D
Q7VUY8Integral membrane protein1T & D
WP_080265467.1DMT family transporter1D
Q7VS71Two-component response regulator1T
Q7VUK0ATP-dependent protease subunit HslV1T
Q7VU64Anthranilate synthase component 11T
Q7VWY4DNA-binding protein Bph21T
Q7VWT5Membrane protein1D
Q7VZY7Carboxynorspermidine/carboxyspermidine decarboxylase1T
Q7W0D8Exported protein1T
Q7VST7Adenine DNA glycosylase1T
Q79GX8Tracheal colonization factor1D
* T: Tohama I, D: D420, Included in acellular pertussis vaccines.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Yari, H.; Kaabinejadian, S.; da Silva Antunes, R.; Armstrong, S.K.; Brickman, T.J.; Sette, A.; Hildebrand, W.H. Allele-Skewed HLA-DR Immunopeptidomes of Bordetella pertussis. Vaccines 2026, 14, 733. https://doi.org/10.3390/vaccines14090733

AMA Style

Yari H, Kaabinejadian S, da Silva Antunes R, Armstrong SK, Brickman TJ, Sette A, Hildebrand WH. Allele-Skewed HLA-DR Immunopeptidomes of Bordetella pertussis. Vaccines. 2026; 14(9):733. https://doi.org/10.3390/vaccines14090733

Chicago/Turabian Style

Yari, Hooman, Saghar Kaabinejadian, Ricardo da Silva Antunes, Sandra K. Armstrong, Timothy J. Brickman, Alessandro Sette, and William H. Hildebrand. 2026. "Allele-Skewed HLA-DR Immunopeptidomes of Bordetella pertussis" Vaccines 14, no. 9: 733. https://doi.org/10.3390/vaccines14090733

APA Style

Yari, H., Kaabinejadian, S., da Silva Antunes, R., Armstrong, S. K., Brickman, T. J., Sette, A., & Hildebrand, W. H. (2026). Allele-Skewed HLA-DR Immunopeptidomes of Bordetella pertussis. Vaccines, 14(9), 733. https://doi.org/10.3390/vaccines14090733

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop