Recent Strategies to Combat Biofilms Using Antimicrobial Agents and Therapeutic Approaches
Abstract
1. Biofilms and Chronic Infections
2. Biofilm Antibiotic Tolerance
3. Basic Strategies to Treat Biofilms
4. Antimicrobial Agents
4.1. Surface Attachment Inhibitors
4.2. Compound Inducing Cell Lysis
4.3. Antiquorum Sensing Molecules
4.4. Synthetic Small Organic Molecules
| Small Organic Molecules | Biological Role | Effective Against | Type of Compound | Reference | |
|---|---|---|---|---|---|
| 1 | 5-phenyl-2-aminoimidazole | Reduction in transription of CsgD, csgB and adrA | S. typhimurium | Imidazole derivative | [79] |
| 2 | ABC-1 | Reduction in SpA and PIA production and decrease eDNA release | S. aureus, Gram-positive and Gram-negative pathogens | Imidazole derivative | [1,80] |
| 3 | 5,6-dimethoxy-2-aminobenzimidazole | Reduction in QS receptors (LasR and RhlR) | P. aeruginosa | Imidazole derivative | [81] |
| 4 | Pyrazolo-pyrimido [4,5-d] pyrimidines | ROS accumulation, loss of membrane integrity | M. luteus, S. aureus, B. subtilis, E. coli, K. planticola | pyrazole compound | [82,83,84] |
| 5 | Indole-3-carboxaldehyde and 3-indolylacetonitrile | Reduction of curli production | E. coli, P. aeruginosa | indole and carbazole derivative | [85,86] |
| 6 | Phenylhydrazine analogues | SrtA inhibition | S. aureus | 2-Phenylhydrazineylidene derivatives | [87] |
| 7 | Diethyl 1-(2-chlorophenyl)-4-((3-chlorophenyl)amino)-5-oxo-2,5-dihydr-1H-pyrrole-2,3-dicarboxylate | MDH and eDNA inhibition | P. aeruginosa | Pyrrole derivatives | [90] |
| 8 | (Z)-5-bromomethylene-2(5H)-furanone | AI-2-mediated QS inhibition | S. anginosus, S.intermedius and S. mutans | Furanone and oxazolidinone derivatives | [91] |
| 9 | Bicyclic brominated furanones | AI-2-mediated QS inhibition | F. nucleatum, P. gingivalis and T. forsythia | Furanone and oxazolidinone derivatives | [91] |
| 10 | Halogenated phenazine | Bind with copper (II ) and iron (II) | MRSA, MRSE, and VRE | Phenazine and quinolone derivative | [92] |
| 11 | Quinolone compound Ia | PqsR inhibition | P. aeruginosa | Quinolone derivative | [93] |
| 12 | 3,4-dimethoxycinnamide derivative | LecB inhibition | P. aeruginosa | Cinnamide derivative of d-mannose | [94] |
4.5. Secondary Metabolites
4.6. Antibiofilm Peptides
| Biofilms | AMP | Amino Acid Sequence | MW (g/moL) | No. of Residues | Mode of Action | References |
|---|---|---|---|---|---|---|
| P. aeruginosa | LL-37 | [LL-37, 37 aa] | 4493.33 | 37 | Reduces swimming and swarming motilities, promotes twitching motility, downregulates the genes required for biofilm formation and influences QS system | [105,106] |
| 1037 | KRFRIRVRV | 1229.54 | 9 | [106] | ||
| 1018 | VRLIVAVRIWRR | 1536.93 | 12 | binds and degrades (p)ppGpp | [102] | |
| Esculentin-1a (1–21) | GIFSKLAGKKIKNLLISGLKG | 2185.73 | 21 | Disrupts cell membrane | [113] | |
| RN3(5-17P22-36) | RPFTRAQWFAIQHISPRTIAMRAINNYRWR | 3758.38 | 30 | Depolarizes and permeabilize cell membrane | [114] | |
| S4 (1–16) | ALWKTLLKKVLKAAAK | 1782.29 | 16 | disintegrates and release membrane lipids | [115] | |
| DJK-5 | VQWRAIRVRVIR | 1551.91 | 12 | degrade (p)ppGpp | [107] | |
| S. aureus | Nisin A | MSTKDFNLDLVSVSKKDSGASPR | 3354.1 | 23 | Depolarizes cell membrane | [116] |
| lacticin Q | MAGFLKVVQLLAKYGSKAVQMAWANKGKILDWLNAGQAIDKVVSKIKQILGIK | 5785.05 | 53 | |||
| Nukacin ISK-1 | KK-KSGVIPTVSHGCHMNSFQFVFTCC | 2886.44 | 26 | |||
| HC5 | VGXRYASXPGXSWKYVXF | 1616.84 | 14 | alter surface hydrophobicity | [104] | |
| S. epidermidis | Hepcidin 20 | ICIFCCGCCHRSHCGMCCKT | 2208.8 | 20 | Acts on Polysaccharide Intercellular Adhesin | [117] |
| Human β defensin 3 (HBD-3) | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK | 5161.24 | 45 | targets icaA, icaD, and icaR genes | [118] | |
| S. mutans | P1 | PARKARAATAATAATAATAATAAT | 2158 | 24 | interferes and degrades EPS | [119] |
| E. coli | Pyrrhocoricin | VDKGSYLPRPTPPRPIYNRN | 2340.67 | 20 | bind with DNaK | [108,109,110] |
| Apdidaecin | GNNRPVYIPQPRPPHPRI | 2108.44 | 18 | |||
| Drosocin | GKPRPYSPRPTSHPRPIRV | 2198.56 | 19 | |||
| Microcin B17 | VGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI | 3255.35 | 43 | Inhibition of DNA replication by inhibiting type II DNA topoisomerase | [111] | |
| PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | 4720.7 | 39 | stop the synthesis of DNA and protein | [112] |
4.7. Compounds Targeting Metabolism
4.8. EPS Degrading Enzymes for Biofilm Dispersal
5. Other Therapeutic Approaches
5.1. Phage Therapy and CRISPR-Cas 9
| Type of Therapy | Target | Biofilm | Type of Assay | References |
|---|---|---|---|---|
| Bacteriophage therapy | EPS polysaccharide | S. aureus | in vitro | [128] |
| Vaccine (Staphvax) | capsular polysaccharide serotypes (CP5 and CP5) | S. aureus | phase III clinical trials | [135] |
| CRISPR/Cas | luxS and fimH genes | E. coli | in vitro | [132,133] |
| CRISPR/Cas | ompA | C. neteri | in vivo | [134] |
| Photodynamic therapy | EPS | S. aureus | in vitro | [12] |
| Virus like particles | agr QS system | S. aureus | in vivo | [135,136] |
| Vaccine | pili-S and integration host factor (IHF) | H. influenzae | in vivo | [137] |
| Catalytic antimicrobial robots | kill cells and detach biofilms | S. mutans | in vitro | [138] |
| Nitric oxide-releasing nanoparticles | N/A | S. aureus | in vivo | [139] |
| Arikayce™ | inhibition of protein synthesis | M. avium | phase III clinical trials | [140] |
| Fluidsomes™ | inhibition of protein synthesis | P. aeruginosa | Phase II clinical trials | [140] |
| Calcium fluoride nanoparticles | various cellular processes | S. mutans | in vitro and in vivo | [141] |
5.2. Vaccines
5.3. Biomaterials and Nanoparticles
5.4. Photodynamic Therapy
6. Future Directions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Shrestha, L.; Kayama, S.; Sasaki, M.; Kato, F.; Hisatsune, J.; Tsuruda, K.; Koizumi, K.; Tatsukawa, N.; Yu, L.; Takeda, K.; et al. Inhibitory effects of antibiofilm compound 1 against Staphylococcus aureus biofilms. Microbiol. Immunol. 2016, 60, 148–159. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Watters, C.; Fleming, D.; Bishop, D.; Rumbaugh, K. Chapter seven-host responses to biofilm. Prog. Mol. Biol. Transl. Sci. 2016, 142, 193–239. [Google Scholar]
- López, D.; Vlamakis, H.; Kolter, R. Biofilms. Cold Spring Harb. Perspect. Biol. 2010, 2, a000398. [Google Scholar]
- Koo, H.; Allan, R.N.; Howlin, R.P.; Stoodley, P.; Hall-Stoodley, L. Targeting microbial biofilms: Current and prospective therapeutic strategies. Nat. Rev. Microbiol. 2017, 15, 740–755. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bjarnsholt, T. The role of bacterial biofilms in chronic infections. APMIS Suppl. 2013, 136, 1–51. [Google Scholar] [CrossRef] [Scilit]
- Hall-Stoodley, L.; Costerton, J.W.; Stoodley, P. Bacterial biofilms: From the natural environment to infectious diseases. Nat. Rev. Microbiol. 2004, 2, 95–108. [Google Scholar] [CrossRef] [Scilit]
- Flemming, H.C.; Wingender, J.; Szewzyk, U.; Steinberg, P.; Rice, S.A.; Kjelleberg, S. Biofilms: An emergent form of bacterial life. Nat. Rev. Microbiol. 2016, 14, 563–575. [Google Scholar] [CrossRef] [Scilit]
- Jamal, M.; Ahmad, W.; Andleeb, S.; Jalil, F.; Imran, M.; Nawaz, M.A.; Hussain, T.; Ali, M.; Rafiq, M.; Kamil, M.A. Bacterial biofilm and associated infections. J. Chin. Med. Assoc. 2018, 81, 7–11. [Google Scholar] [CrossRef] [Scilit]
- Soo, V.; Kwan, B.; Quezada, H.; Castillo-Juárez, I.; Pérez-Eretza, B.; García-Contreras, S.J.; Martínez-Vázquez, M.; Wood, T.K.; García-Contreras, R. Repurposing of anticancer drugs for the treatment of bacterial infections. Curr. Top. Med. Chem. 2016, 17, 1157–1176. [Google Scholar] [CrossRef] [Scilit]
- Dincer, S.; Masume Uslu, F.; Delik, A. Antibiotic resistance in biofilm. In Bacterial Biofilms; IntechOpen: London, UK, 2020. [Google Scholar] [CrossRef] [Scilit]
- Stewart, P.S. Antimicrobial tolerance in bio films. Microbiol. Spectr. 2015, 3, 1–13. [Google Scholar] [CrossRef] [Scilit]
- Sharma, D.; Misba, L.; Khan, A.U. Antibiotics versus biofilm: An emerging battleground in microbial communities. Antimicrob. Resist. Infect. Control 2019, 8, 76. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Omar, A.; Wright, J.B.; Schultz, G.; Burrell, R.; Nadworny, P. Microbial biofilms and chronic wounds. Microorganisms 2017, 5, 9. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Davies, D. Understanding biofilm resistance to antibacterial agents. Nat. Rev. Drug Discov. 2003, 2, 114–122. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pogodin, S.; Hasan, J.; Baulin, V.A.; Webb, H.K.; Truong, V.K.; Phong Nguyen, T.H.; Boshkovikj, V.; Fluke, C.J.; Watson, G.S.; Watson, J.A.; et al. Biophysical model of bacterial cell interactions with nanopatterned cicada wing surfaces. Biophys. J. 2013, 104, 835–840. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Tang, P.; Zhang, W.; Wang, Y.; Zhang, B.; Wang, H.; Lin, C.; Zhang, L. Effect of superhydrophobic surface of titanium on Staphylococcus aureus adhesion. J. Nanomater. 2011, 2011, 178921. [Google Scholar] [CrossRef] [Scilit]
- Kim, S.; Jung, U.T.; Kim, S.K.; Lee, J.H.; Choi, H.S.; Kim, C.S.; Jeong, M.Y. Nanostructured multifunctional surface with antireflective and antimicrobial characteristics. ACS Appl. Mater. Interfaces 2015, 7, 326–331. [Google Scholar] [CrossRef] [Scilit]
- Pereira, M.O.; Machado, I.; Simoes, M.; Viera, M.J. Preventing biofilm formation using surfactants. Biofilm Club 2007, 167–174. [Google Scholar]
- Brackman, G.; Coenye, T. Quorum sensing inhibitors as anti-biofilm agents. Curr. Pharm. Des. 2014, 21, 5–11. [Google Scholar] [CrossRef] [Scilit]
- Lijuan, C.; Xing, Y.; Minxi, W.; Wenkai, L.; Le, D. Development of an aptamer-ampicillin conjugate for treating biofilms. Biochem. Biophys. Res. Commun. 2017, 483, 847–854. [Google Scholar] [CrossRef] [Scilit]
- Yasuda, H.; Ajiki, Y.; Koga, T.; Kawada, H.; Yokota, T. Interaction between biofilms formed by Pseudomonas aeruginosa and clarithromycin. Antimicrob. Agents Chemother. 1993, 37, 1749–1755. [Google Scholar] [CrossRef] [Scilit]
- Kim, C.; Kim, J.; Park, H.Y.; Lee, J.H.; Park, H.J.; Kim, C.K.; Yoon, J. Structural understanding of quorum-sensing inhibitors by molecular modeling study in Pseudomonas aeruginosa. Appl. Microbiol. Biotechnol. 2009, 83, 1095–1103. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kim, C.; Kim, J.; Park, H.Y.; Park, H.J.; Kim, C.K.; Yoon, J.; Lee, J.H. Development of inhibitors against TraR quorum-sensing system in Agrobacterium tumefaciens by molecular modeling of the ligand-receptor interaction. Mol. Cells 2009, 28, 447–453. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ren, D.; Sims, J.J.; Wood, T.K. Inhibition of biofilm formation and swarming of Escherichia coli by (5Z)-4-bromo-5-(bromomethylene)-3- butyl-2(5H)-furanone. Environ. Microbiol. 2001, 3, 731–736. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kim, C.; Kim, J.; Park, H.Y.; Park, H.J.; Lee, J.H.; Kim, C.K.; Yoon, J. Furanone derivatives as quorum-sensing antagonists of Pseudomonas aeruginosa. Appl. Microbiol. Biotechnol. 2008, 80, 37–47. [Google Scholar] [CrossRef] [Scilit]
- Kim, J.; Pitts, B.; Stewart, P.S.; Camper, A.; Yoon, J. Comparison of the antimicrobial effects of chlorine, silver ion, and tobramycin on biofilm. Antimicrob. Agents Chemother. 2008, 52, 1446–1453. [Google Scholar] [CrossRef] [Scilit]
- Li, X.H.; Lee, J.H. Antibiofilm agents: A new perspective for antimicrobial strategy. J. Microbiol. 2017, 55, 753–766. [Google Scholar] [CrossRef] [Scilit]
- Plakunov, V.K.; Zhurina, M.V.; Gannesen, A.V.; Mart’yanov, S.V.; Nikolaev, Y.A. Antibiofilm agents: Therminological ambiguity and strategy for search. Microbiology 2019, 88, 747–750. [Google Scholar] [CrossRef] [Scilit]
- Khalid, S.; Gao, A.; Wang, G.; Chu, P.K.; Wang, H. Tuning surface topographies on biomaterials to control bacterial infection. Biomater. Sci. 2020, 8, 6840–6857. [Google Scholar] [CrossRef] [Scilit]
- Allegrone, G.; Ceresa, C.; Rinaldi, M.; Fracchia, L. Diverse effects of natural and synthetic surfactants on the inhibition of staphylococcus aureus biofilm. Pharmaceutics 2021, 13, 1172. [Google Scholar] [CrossRef] [Scilit]
- Ohta, K.; Komatsuzawa, H.; Sugai, M.; Suginaka, H. Triton X-100-induced lipoteichoic acid release is correlated with the methicillin resistance in Staphylococcus aureus. FEMS Microbiol. Lett. 2000, 182, 77–79. [Google Scholar] [CrossRef]
- Komatsuzawa, H.; Suzuki, J.; Sugai, M.; Miyake, Y.; Suginaka, H. The effect of triton X-100 on the in-vitro susceptibility of methicillin-resistant Staphylococcus aureus to oxacillin. J. Antimicrob. Chemother. 1994, 34, 3537–3545. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Nitschke, M.; Costa, S.G.V.A.O. Biosurfactants in food industry. Trends Food Sci. Technol. 2007, 18, 252–259. [Google Scholar] [CrossRef] [Scilit]
- Percival, S.L.; Mayer, D.; Kirsner, R.S.; Schultz, G.; Weir, D.; Roy, S.; Alavi, A.; Romanelli, M. Surfactants: Role in biofilm management and cellular behaviour. Int. Wound J. 2019, 16, 753–760. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Abdel-Mawgoud, A.M.; Lépine, F.; Déziel, E. Rhamnolipids: Diversity of structures, microbial origins and roles. Appl. Microbiol. Biotechnol. 2010, 86, 1323–1336. [Google Scholar] [CrossRef] [Scilit]
- ESilva, S.S.; Carvalho, J.W.P.; Aires, C.P.; Nitschke, M. Disruption of Staphylococcus aureus biofilms using rhamnolipid biosurfactants. J. Dairy Sci. 2017, 100, 7864–7873. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chebbi, A.; Elshikh, M.; Haque, F.; Ahmed, S.; Dobbin, S.; Marchant, R.; Sayadi, S.; Chamkha, M.; Banat, I.M. Rhamnolipids from Pseudomonas aeruginosa strain W10; as antibiofilm/antibiofouling products for metal protection. J. Basic Microbiol. 2017, 57, 364–375. [Google Scholar] [CrossRef] [Scilit]
- Banat, I.M.; de Rienzo, M.A.D.; Quinn, G.A. Microbial biofilms: Biosurfactants as antibiofilm agents. Appl. Microbiol. Biotechnol. 2014, 98, 9915–9929. [Google Scholar] [CrossRef] [Scilit]
- D’Auria, L.; Deleu, M.; Dufour, S.; Mingeot-Leclercq, M.P.; Tyteca, D. Surfactins modulate the lateral organization of fluorescent membrane polar lipids: A new tool to study drug: Membrane interaction and assessment of the role of cholesterol and drug acyl chain length. Biochim. Biophys. Acta-Biomembr. 2013, 1828, 2064–2073. [Google Scholar] [CrossRef] [Scilit]
- Finnegan, S.; Percival, S.L. EDTA: An antimicrobial and antibiofilm agent for use in wound care. Adv. Wound Care 2015, 4, 415–421. [Google Scholar] [CrossRef] [Scilit]
- Zhang, A.; Mu, H.; Zhang, W.; Cui, G.; Zhu, J.; Duan, J. Chitosan coupling makes microbial biofilms susceptible to antibiotics. Sci. Rep. 2013, 3, 3364. [Google Scholar] [CrossRef] [Scilit]
- Vikram, A.; Jesudhasan, P.R.; Jayaprakasha, G.K.; Pillai, S.D.; Patil, B.S. Citrus limonoids interfere with Vibrio harveyi cell–cell signalling and biofilm formation by modulating the response regulator luxO. Microbiology 2011, 157, 99–110. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Scopel, M.; Abraham, W.R.; Henriques, A.T.; MacEdo, A.J. Dipeptide cis-cyclo(Leucyl-Tyrosyl) produced by sponge associated Penicillium sp. F37 inhibits biofilm formation of the pathogenic Staphylococcus epidermidis. Bioorganic Med. Chem. Lett. 2013, 23, 624–626. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Park, S.R.; Tripathi, A.; Wu, J.; Schultz, P.J.; Yim, I.; McQuade, T.J.; Yu, F.; Arevang, C.J.; Mensah, A.Y.; Castillo, G.T.; et al. Discovery of cahuitamycins as biofilm inhibitors derived from a convergent biosynthetic pathway. Nat. Commun. 2016, 7, 10710. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Eom, S.H.; Lee, D.S.; Jung, Y.J.; Park, J.H.; Choi, J.I.; Yim, M.J.; Jeon, J.M.; Kim, H.W.; Son, K.T.; Je, J.Y.; et al. The mechanism of antibacterial activity of phlorofucofuroeckol-A against methicillin-resistant Staphylococcus aureus. Appl. Microbiol. Biotechnol. 2014, 98, 504–518. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kalpana, B.J.; Aarthy, S.; Pandian, S.K. Antibiofilm activity of α-amylase from Bacillus subtilis S8-18 against biofilm forming human bacterial pathogens. Appl. Biochem. Biotechnol. 2012, 167, 1778–1794. [Google Scholar] [CrossRef] [Scilit]
- Kolodkin-Gal, I.; Cao, S.; Chai, L.; Böttcher, T.; Kolter, R.; Clardy, J.; Losick, R. A self-produced trigger for biofilm disassembly that targets exopolysaccharide. Cell 2012, 149, 684–692. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kolodkin-Gal, I.; Romero, D.; Cao, S.; Clardy, J.; Kolter, R.; Losick, R. D-Amino acids trigger biofilm disassembly. Science 2010, 328, 627–629. [Google Scholar] [CrossRef] [Scilit]
- Muñoz-Egea, M.C.; García-Pedrazuela, M.; Mahillo-Fernandez, I.; Esteban, J. Effect of antibiotics and antibiofilm agents in the ultrastructure and development of biofilms developed by nonpigmented rapidly growing mycobacteria. Microb. Drug Resist. 2016, 22, 1–6. [Google Scholar] [CrossRef] [Scilit]
- Iwase, T.; Uehara, Y.; Shinji, H.; Tajima, A.; Seo, H.; Takada, K.; Agata, T.; Mizunoe, Y. Staphylococcus epidermidis Esp inhibits Staphylococcus aureus biofilm formation and nasal colonization. Nature 2010, 465, 346–349. [Google Scholar] [CrossRef] [Scilit]
- Tetz, G.V.; Artemenko, N.K.; Tetz, V.V. Effect of DNase and antibiotics on biofilm characteristics. Antimicrobial Agents Chemother. 2009, 53, 1204–1209. [Google Scholar] [CrossRef] [Scilit]
- Zhao, X.; Liu, Z.Z.; Liu, Z.Z.; Meng, R.; Shi, C.; Chen, X.; Bu, X.; Guo, N. Phenotype and RNA-seq-based transcriptome profiling of Staphylococcus aureus biofilms in response to tea tree oil. Microb. Pathog. 2018, 123, 304–313. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wu, H.; Moser, C.; Wang, H.Z.; Høiby, N.; Song, Z.J. Strategies for combating bacterial biofilm infections. Int. J. Oral Sci. 2015, 7, 1–7. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Roy, R.; Tiwari, M.; Donelli, G.; Tiwari, V. Strategies for combating bacterial biofilms: A focus on anti-biofilm agents and their mechanisms of action. Virulence 2018, 9, 522–554. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hoeltje, J.v.; Mirelman, D.; Sharon, N.; Schwarz, U. Novel type of murein transglycosylase in Escherichia coli. J. Bacteriol. 1975, 124, 1067–1076. [Google Scholar] [CrossRef] [Scilit]
- Shen, Y.; Köller, T.; Kreikemeyer, B.; Nelson, D.C. Rapid degradation of Streptococcus pyogenes biofilms by PlyC, a bacteriophage-encoded endolysin. J. Antimicrob. Chemother. 2013, 8, 1818–1824. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Worthington, R.J.; Richards, J.J.; Melander, C. Small molecule control of bacterial biofilms. Org. Biomol. Chem. 2012, 10, 7457–7474. [Google Scholar] [CrossRef] [Scilit]
- Miller, M.B.; Bassler, B.L. Quorum sensing in bacteria. Annu. Rev. Microbiol. 2001, 55, 165–199. [Google Scholar] [CrossRef] [Scilit]
- Romling, U.; Galperin, M.Y.; Gomelsky, M. Cyclic di-GMP: The first 25 years of a universal bacterial second messenger. Microbiol. Mol. Biol. Rev. 2013, 77, 1–52. [Google Scholar] [CrossRef] [Scilit]
- Valentini, M.; Filloux, A. Biofilms and cyclic di-GMP (c-di-GMP) signaling: Lessons from Pseudomonas aeruginosa and other bacteria. J. Biol. Chem. 2016, 291, 12547–12555. [Google Scholar] [CrossRef] [Scilit]
- Ryan, R.P.; Fouhy, Y.; Lucey, J.F.; Dow, J.M. Cyclic di-GMP signaling in bacteria: Recent advances and new puzzles. J. Bacteriol. 2006, 188, 8327–8334. [Google Scholar] [CrossRef] [Scilit]
- Harjai, K.; Kumar, R.; Singh, S. Garlic blocks quorum sensing and attenuates the virulence of Pseudomonas aeruginosa. FEMS Immunol. Med. Microbiol. 2010, 58, 161–168. [Google Scholar] [CrossRef] [Scilit]
- Persson, T.; Hansen, T.H.; Rasmussen, T.B.; Skindersø, M.E.; Givskov, M.; Nielsen, J. Rational design and synthesis of new quorum-sensing inhibitors derived from acylated homoserine lactones and natural products from garlic. Org. Biomol. Chem. 2005, 3, 253–262. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vikram, A.; Jesudhasan, P.R.; Pillai, S.D.; Patil, B.S. Isolimonic acid interferes with Escherichia coli O157, H7 biofilm and TTSS in QseBC and QseA dependent fashion. BMC Microbiol. 2012, 12, 261. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Brackman, G.; Defoirdt, T.; Miyamoto, C.; Bossier, P.; Calenbergh, S.; van Nelis, H.; Coenye, T. Cinnamaldehyde and cinnamaldehyde derivatives reduce virulence in Vibrio spp. by decreasing the DNA-binding activity of the quorum sensing response regulator LuxR. BMC Microbiol. 2008, 8, 149. [Google Scholar] [CrossRef] [Scilit]
- Niu, C.; Gilbert, E.S. Colorimetric method for identifying plant essential oil components that affect biofilm formation and structure. Appl. Environ. Microbiol. 2004, 70, 9651–9656. [Google Scholar] [CrossRef] [Scilit]
- Zhou, J.W.; Luo, H.Z.; Jiang, H.; Jian, T.K.; Chen, Z.Q.; Jia, A.Q. Hordenine: A novel quorum sensing inhibitor and antibiofilm agent against Pseudomonas aeruginosa. J. Agric. Food Chem. 2018, 66, 1620–1628. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhou, J.W.; Hou, B.; Liu, G.Y.; Jiang, H.; Sun, B.; Wang, Z.N.; Shi, R.F.; Xu, Y.; Wang, R.; Jia, A.Q. Attenuation of Pseudomonas aeruginosa biofilm by hordenine: A combinatorial study with aminoglycoside antibiotics. Appl. Microbiol. Biotechnol. 2018, 102, 9745–9758. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Krishnan, T.; Yin, W.F.; Chan, K.G. Inhibition of quorum sensing-controlled virulence factor production in Pseudomonas aeruginosa PAO1 by ayurveda spice clove (syzygium aromaticum) bud extract. Sensors 2012, 12, 4016–4030. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Tan, S.Y.Y.; Chua, S.L.; Chen, Y.; Rice, S.A.; Kjelleberg, S.; Nielsen, T.E.; Yang, L.; Givskov, M. Identification of five structurally unrelated quorum-sensing inhibitors of Pseudomonas aeruginosa from a natural-derivative database. Antimicrob. Agents Chemother. 2013, 57, 5629–5641. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chu, W.; Zhou, S.; Jiang, Y.; Zhu, W.; Zhuang, X.; Fu, J. Effect of traditional Chinese herbal medicine with antiquorum sensing activity on Pseudomonas aeruginosa. Evid.-Based Complementary Altern. Med. 2013, 2013, 648257. [Google Scholar] [CrossRef] [Scilit]
- Vasavi, H.S.; Arun, A.B.; Rekha, P.D. Anti-quorum sensing activity of flavonoid-rich fraction from Centella asiatica L. against Pseudomonas aeruginosa PAO1. J. Microbiol. Immunol. Infect. 2016, 49, 8–15. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ouyang, J.; Sun, F.; Feng, W.; Sun, Y.; Qiu, X.; Xiong, L.; Liu, Y.; Chen, Y. Quercetin is an effective inhibitor of quorum sensing, biofilm formation and virulence factors in Pseudomonas aeruginosa. J. Appl. Microbiol. 2016, 120, 966–974. [Google Scholar] [CrossRef] [Scilit]
- Lauderdale, K.J.; Malone, C.L.; Boles, B.R.; Morcuende, J.; Horswill, A.R. Biofilm dispersal of community-associated methicillin-resistant Staphylococcus aureus on orthopedic implant material. J. Orthop. Res. 2010, 28, 55–61. [Google Scholar] [CrossRef] [Scilit]
- Simonetti, O.; Cirioni, O.; Ghiselli, R.; Goteri, G.; Scalise, A.; Orlando, F.; Silvestri, C.; Riva, A.; Saba, V.; Madanahally, K.D.; et al. RNAIII-inhibiting peptide enhances healing of wounds infected with methicillin-resistant Staphylococcus aureus. Antimicrob. Agents Chemother. 2008, 52, 2205–2211. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Barraud, N.; Schleheck, D.; Klebensberger, J.; Webb, J.S.; Hassett, D.J.; Rice, S.A.; Kjelleberg, S. Nitric oxide signaling in Pseudomonas aeruginosa biofilms mediates phosphodiesterase activity, decreased cyclic di-GMP levels, and enhanced dispersal. J. Bacteriol. 2009, 191, 7333–7342. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Schreiber, F.; Beutler, M.; Enning, D.; Lamprecht-Grandio, M.; Zafra, O.; González-Pastor, J.; de Beer, D. The role of nitric-oxide-synthase-derived nitric oxide in multicellular traits of Bacillus subtilis 3610, Biofilm formation, swarming, and dispersal. BMC Microbiol. 2011, 11, 111. [Google Scholar] [CrossRef] [Scilit]
- Parrino, B.; Schillaci, D.; Carnevale, I.; Giovannetti, E.; Diana, P.; Cirrincione, G.; Cascioferro, S. Synthetic small molecules as anti-biofilm agents in the struggle against antibiotic resistance. Eur. J. Med. Chem. 2019, 161, 154–178. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Robijns, S.C.A.; Roberfroid, S.; van Puyvelde, S.; de Pauw, B.; Uceda Santamaría, E.; de Weerdt, A.; De Coster, D.; Hermans, K.; De Keersmaecker, S.C.; Vanderleyden, J.; et al. A GFP promoter fusion library for the study of Salmonella biofilm formation and the mode of action of biofilm inhibitors. Biofouling 2014, 30, 605–625. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sambanthamoorthy, K.; Gokhale, A.A.; Lao, W.; Parashar, V.; Neiditch, M.B.; Semmelhack, M.F.; Lee, I.; Waters, C.M. Identification of a novel benzimidazole that inhibits bacterial biofilm formation in a broad-spectrum manner. Antimicrob. Agents Chemother. 2011, 55, 4369–4378. [Google Scholar] [CrossRef] [Scilit]
- Coldham, N.G.; Webber, M.; Woodward, M.J.; Piddock, L.J.V. A 96-well plate fluorescence assay for assessment of cellular permeability and active efflux in Salmonella enterica serovar Typhimurium and Escherichia coli. J. Antimicrob. Chemother. 2010, 65, 1655–1663. [Google Scholar] [CrossRef] [Scilit]
- Suresh, L.; Sagar Vijay Kumar, P.; Poornachandra, Y.; Ganesh Kumar, C.; Chandramouli, G.V.P. Design, synthesis and evaluation of novel pyrazolo-pyrimido [4,5-d] pyrimidine derivatives as potent antibacterial and biofilm inhibitors. Bioorganic Med. Chem. Lett. 2017, 27, 1451–1457. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jitender Dev, G.; Poornachandra, Y.; Ratnakar Reddy, K.; Naresh Kumar, R.; Ravikumar, N.; Krishna Swaroop, D.; Ranjithreddy, P.; Shravan Kumar, G.; Nanubolu, J.B.; Ganesh Kumar, C.; et al. Synthesis of novel pyrazolo [3,4-b] quinolinyl acetamide analogs, their evaluation for antimicrobial and anticancer activities, validation by molecular modeling and CoMFA analysis. Eur. J. Med. Chem. 2017, 130, 223–239. [Google Scholar] [CrossRef] [Scilit]
- Dixon, S.J.; Stockwell, B.R. The role of iron and reactive oxygen species in cell death. Nat. Chem. Biol. 2014, 10, 9–17. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ryu, J.H.; Beuchat, L.R. Biofilm formation by Escherichia coli O157, H7 on stainless steel: Effect of exopolysaccharide and curli production on its resistance to chlorine. Appl. Environ. Microbiol. 2005, 71, 247–254. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Uhlich, G.A.; Cooke, P.H.; Solomon, E.B. Analyses of the red-dry-rough phenotype of an Escherichia coli O157, H7 strain and its role in biofilm formation and resistance to antibacterial agents. Appl. Environ. Microbiol. 2006, 72, 2564–2572. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Maggio, B.; Raffa, D.; Raimondi, M.V.; Cascioferro, S.; Plescia, F.; Schillaci, D.; Cusimano, M.G.; Leonchiks, A.; Zhulenkovs, D.; Basile, L.; et al. Discovery of a new class of sortase a transpeptidase inhibitors to tackle gram-positive pathogens: 2-(2-phenylhydrazinylidene)alkanoic acids and related derivatives. Molecules 2016, 21, 241. [Google Scholar] [CrossRef] [Scilit]
- Mazmanian, S.K.; Liu, G.; Jensen, E.R.; Lenoy, E.; Schneewind, O. Staphylococcus aureus sortase mutants defective in the display of surface proteins and in the pathogenesis of animal infections. Proc. Natl. Acad. Sci. USA 2000, 97, 5510–5515. [Google Scholar] [CrossRef] [Scilit]
- Oh, K.B.; Oh, M.N.; Kim, J.G.; Shin, D.S.; Shin, J. Inhibition of sortase-mediated Staphylococcus aureus adhesion to fibronectin via fibronectin-binding protein by sortase inhibitors. Appl. Microbiol. Biotechnol. 2006, 70, 102–106. [Google Scholar] [CrossRef] [Scilit]
- Donlan, R.M.; Costerton, J.W. Biofilms: Survival mechanisms of clinically relevant microorganisms. Clin. Microbiol. Rev. 2002, 15, 167–193. [Google Scholar] [CrossRef] [Scilit]
- Lönn-Stensrud, J.; Petersen, F.C.; Benneche, T.; Scheie, A.A. Synthetic bromated furanone inhibits autoinducer-2-mediated communication and biofilm formation in oral streptococci. Oral Microbiol. Immunol. 2007, 22, 340–346. [Google Scholar] [CrossRef] [Scilit]
- Garrison, A.T.; Abouelhassan, Y.; Norwood, V.M.; Kallifidas, D.; Bai, F.; Nguyen, M.T.; Rolfe, M.; Burch, G.M.; Jin, S.; Luesch, H.; et al. Structure-activity relationships of a diverse class of halogenated phenazines that targets persistent, antibiotic-tolerant bacterial biofilms and Mycobacterium tuberculosis. J. Med. Chem. 2016, 59, 3808–3825. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Soukarieh, F.; Oton, E.V.; Dubern, J.F.; Gomes, J.; Halliday, N.; De Pilar Crespo, M.; Prada, J.R.; Insuasty, B.; Abonia, R.; Quiroga, J.; et al. In silico and in vitro-guided identification of inhibitors of alkylquinolone-dependent quorum sensing in Pseudomonas aeruginosa. Molecules 2018, 23, 257. [Google Scholar] [CrossRef] [Scilit]
- Sommer, R.; Hauck, D.; Varrot, A.; Wagner, S.; Audfray, A.; Prestel, A.; Moller, H.M.; Imberty, A.; Titz, A. Cinnamide Derivatives of d-mannose as inhibitors of the bacterial virulence factor lecb from Pseudomonas aeruginosa. ChemistryOpen 2015, 4, 756–767. [Google Scholar] [CrossRef] [Scilit]
- Petersen, L.-E.; Kellermann, M.Y.; Schupp, P.J. Secondary metabolites of marine microbes: From natural products chemistry to chemical ecology. YOUMARES 2020, 9, 159–180. [Google Scholar] [CrossRef] [Scilit]
- Adnan, M.; Alshammari, E.; Patel, M.; Ashraf, S.A.; Khan, S.; Hadi, S. Significance and potential of marine microbial natural bioactive compounds against biofilms/biofouling: Necessity for green chemistry. PeerJ 2018, 2018, e5049. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rosa, G.P.; Tavares, W.R.; Sousa, P.M.C.; Pagès, A.K.; Seca, A.M.L.; Pinto, D.C.G.A. Seaweed secondary metabolites with beneficial health effects: An overview of successes in in vivo studies and clinical trials. Mar. Drugs 2020, 18, 8. [Google Scholar] [CrossRef] [Scilit]
- Wang, Z.; Shen, Y.; Haapasalo, M. Antibiofilm peptides against oral biofilms. J. Oral Microbiol. 2017, 9, 1327308. [Google Scholar] [CrossRef] [Scilit]
- Gaspar, D.; Veiga, A.S.; Castanho, M.A.R.B. From antimicrobial to anticancer peptides. A review. Front. Microbiol. 2013, 4, 294. [Google Scholar] [CrossRef] [Scilit]
- Giuliani, A.; Pirri, G.; Nicoletto, S.F. Antimicrobial peptides: An overview of a promising class of therapeutics. Cent. Eur. J. Biol. 2007, 2, 1–33. [Google Scholar] [CrossRef] [Scilit]
- Mohamed, M.F.; Abdelkhalek, A.; Seleem, M.N. Evaluation of short synthetic antimicrobial peptides for treatment of drug-resistant and intracellular Staphylococcus aureus. Sci. Rep. 2016, 6, 29707. [Google Scholar] [CrossRef] [Scilit]
- De La Fuente-Núñez, C.; Reffuveille, F.; Haney, E.F.; Straus, S.K.; Hancock, R.E.W. Broad-spectrum anti-biofilm peptide that targets a cellular stress response. PLoS Pathog. 2014, 10, e1004152. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Andrea, A.; Molchanova, N.; Jenssen, H. Antibiofilm peptides and peptidomimetics with focus on surface immobilization. Biomolecules 2018, 8, 27. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pimentel-Filho, N.d.J.; Martins, M.C.d.F.; Nogueira, G.B.; Mantovani, H.C.; Vanetti, M.C.D. Bovicin HC5 and nisin reduce Staphylococcus aureus adhesion to polystyrene and change the hydrophobicity profile and Gibbs free energy of adhesion. Int. J. Food Microbiol. 2014, 190, 1–8. [Google Scholar] [CrossRef] [Scilit]
- Overhage, J.; Campisano, A.; Bains, M.; Torfs, E.C.W.; Rehm, B.H.A.; Hancock, R.E.W. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect. Immun. 2008, 76, 4176–4182. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- De La Fuente-Núñez, C.; Korolik, V.; Bains, M.; Nguyen, U.; Breidenstein, E.B.; Horsman, S.; Lewenza, S.; Burrows, L.; Hancock, R.E. Inhibition of bacterial biofilm formation and swarming motility by a small synthetic cationic peptide. Antimicrob. Agents Chemother. 2012, 56, 2696–2704. [Google Scholar] [CrossRef] [Scilit]
- De La Fuente-Núñez, C.; Reffuveille, F.; Mansour, S.C.; Reckseidler-Zenteno, S.L.; Hernández, D.; Brackman, G.; Coenye, T.; Hancock, E.W. D-enantiomeric peptides that eradicate wild-type and multidrug-resistant biofilms and protect against lethal Pseudomonas aeruginosa infections. Chem. Biol. 2015, 22, 196–205. [Google Scholar] [CrossRef] [Scilit]
- Otvos, L.; Insug, O.; Rogers, M.E.; Consolvo, P.J.; Condie, B.A.; Lovas, S.; Bulet, P.; Blaszczyk-Thurin, M. Interaction between heat shock proteins and antimicrobial peptides. Biochemistry 2000, 39, 14150–14159. [Google Scholar] [CrossRef] [Scilit]
- Kragol, G.; Lovas, S.; Varadi, G.; Condie, B.A.; Hoffmann, R.; Otvos, L. The antibacterial peptide pyrrhocoricin inhibits the ATPase actions of DnaK and prevents chaperone-assisted protein folding. Biochemistry 2001, 40, 3016–3026. [Google Scholar] [CrossRef] [Scilit]
- Kragol, G.; Hoffmann, R.; Chattergoon, M.A.; Lovas, S.; Cudic, M.; Bulet, P.; Condie, B.A.; Rosengren, K.J.; Montaner, L.J.; Otvos, L., Jr. Identification of crucial residues for the antibacterial activity of the proline-rich peptide, pyrrhocoricin. Eur. J. Biochem. 2002, 269, 4226–4237. [Google Scholar] [CrossRef] [Scilit]
- Vizan, J.L.; Hernandez-Chico, C.; Del Castillo, I.; Moreno, F. The peptide antibiotic microcin B17 induces double-strand cleavage of DNA mediated by E. coli DNA gyrase. EMBO J. 1991, 10, 467–476. [Google Scholar] [CrossRef] [Scilit]
- Boman, H.G.; Agerberth, B.; Boman, A. Mechanisms of action on Escherichia coli of cecropin P1 and PR-39, two antibacterial peptides from pig intestine. Infect. Immun. 1993, 61, 2978–2984. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Luca, V.; Stringaro, A.; Colone, M.; Pini, A.; Mangoni, M.L. Esculentin(1–21), an amphibian skin membrane-active peptide with potent activity on both planktonic and biofilm cells of the bacterial pathogen Pseudomonas aeruginosa. Cell. Mol. Life Sci. 2013, 70, 2773–2786. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pulido, D.; Prats-Ejarque, G.; Villalba, C.; Albacar, M.; González-López, J.J.; Torrent, M.; Moussaoui, M.; Boix, E. A novel RNase 3/ECP peptide for Pseudomonas aeruginosa biofilm eradication that combines antimicrobial, lipopolysaccharide binding, and cell-agglutinating activities. Antimicrob. Agents Chemother. 2016, 60, 6313–6325. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Quilès, F.; Saadi, S.; Francius, G.; Bacharouche, J.; Humbert, F. In situ and real time investigation of the evolution of a Pseudomonas fluorescens nascent biofilm in the presence of an antimicrobial peptide. Biochim. Biophys. Acta-Biomembr. 2016, 1858, 75–84. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Okuda, K.I.; Zendo, T.; Sugimoto, S.; Iwase, T.; Tajima, A.; Yamada, S.; Sonomoto, K.; Mizunoe, Y. Effects of bacteriocins on methicillin-resistant Staphylococcus aureus biofilm. Antimicrob. Agents Chemother. 2013, 57, 5572–5579. [Google Scholar] [CrossRef] [Scilit]
- Brancatisano, F.L.; Maisetta, G.; di Luca, M.; Esin, S.; Bottai, D.; Bizzarri, R.; Campa, M.; Batoni, G. Inhibitory effect of the human liver-derived antimicrobial peptide hepcidin 20 on biofilms of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains of Staphylococcus epidermidis. Biofouling 2014, 30, 435–446. [Google Scholar] [CrossRef] [Scilit]
- Zhu, C.; Tan, H.; Cheng, T.; Shen, H.; Shao, J.; Guo, Y.; Shi, S.; Zhang, X. Human β-defensin 3 inhibits antibiotic-resistant Staphylococcus biofilm formation. J. Surg. Res. 2013, 183, 204–213. [Google Scholar] [CrossRef] [Scilit]
- Ansari, J.M.; Abraham, N.M.; Massaro, J.; Murphy, K.; Smith-Carpenter, J.; Fikrig, E. Anti-biofilm activity of a self-aggregating peptide against Streptococcus mutans. Front. Microbiol. 2017, 8, 488. [Google Scholar] [CrossRef] [Scilit]
- Hancock, R.E.W.; Alford, M.A.; Haney, E.F. Antibiofilm activity of host defence peptides: Complexity provides opportunities. Nat. Rev. Microbiol. 2021, 19, 786–797. [Google Scholar] [CrossRef] [Scilit]
- Allison, K.R.; Brynildsen, M.P.; Collins, J.J. Metabolite-enabled eradication of bacterial persisters by aminoglycosides. Nature 2011, 473, 216–220. [Google Scholar] [CrossRef] [Scilit]
- Pisithkul, T.; Schroeder, J.W.; Trujillo, E.A.; Yeesin, P.; Stevenson, D.M.; Chaiamarit, T.; Coon, J.J.; Wang, J.D.; Amador-Noguez, D. Metabolic remodeling during biofilm development of bacillus subtilis. MBio 2019, 10, e00623-19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lu, H.; Que, Y.; Wu, X.; Guan, T.; Guo, H. Metabolomics deciphered metabolic reprogramming required for biofilm formation. Sci. Rep. 2019, 9, 13160. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- He, J.; Hwang, G.; Liu, Y.; Gao, L.; Kilpatrick-Liverman, L.T.; Santarpi, P.; Zhou, X.; Koo, H. L-arginine modifies the exopolysaccharide matrix and thwarts Streptococcus mutans outgrowth within mixed-species oral biofilms. J. Bacteriol. 2016, 198, 2651–2661. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sun, F.; Qu, F.; Ling, Y.; Mao, P.; Xia, P.; Chen, H.; Zhou, D. Biofilm-associated infections: Antibiotic resistance and novel therapeutic strategies. Future Microbiol. 2013, 8, 877–886. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hochbaum, A.I.; Kolodkin-Gal, I.; Foulston, L.; Kolter, R.; Aizenberg, J.; Losick, R. Inhibitory effects of D-amino acids on Staphylococcus aureus biofilm development. J. Bacteriol. 2011, 193, 5616–5622. [Google Scholar] [CrossRef] [Scilit]
- Furfaro, L.L.; Payne, M.S.; Chang, B.J. Bacteriophage therapy: Clinical trials and regulatory hurdles. Front. Cell. Infect. Microbiol. 2018, 8, 376. [Google Scholar] [CrossRef] [Scilit]
- Tkhilaishvili, T.; Lombardi, L.; Klatt, A.B.; Trampuz, A.; Di Luca, M. Bacteriophage Sb-1 enhances antibiotic activity against biofilm, degrades exopolysaccharide matrix and targets persisters of Staphylococcus aureus. Int. J. Antimicrob. Agents 2018, 52, 842–853. [Google Scholar] [CrossRef] [Scilit]
- Harper, D.R.; Parracho, H.M.R.T.; Walker, J.; Sharp, R.; Hughes, G.; Werthén, M.; Lehman, S.; Morales, S. Bacteriophages and biofilms. Antibiotics 2014, 3, 270–284. [Google Scholar] [CrossRef] [Scilit]
- Abedon, S.T. Bacteriophage exploitation of bacterial biofilms: Phage preference for less mature targets? FEMS Microbiol. Lett. 2016, 363, fnv246. [Google Scholar] [CrossRef] [Scilit]
- Gou, Y.; Liu, W.; Wang, J.J.; Tan, L.; Hong, B.; Guo, L.; Liu, H.; Pan, Y.; Zhao, Y. Crispr-cas9 knockout of qseb induced asynchrony between motility and biofilm formation in escherichia coli. Can. J. Microbiol. 2019, 65, 691–702. [Google Scholar] [CrossRef] [Scilit]
- Zuberi, A.; Misba, L.; Khan, A.U. CRISPR interference (CRISPRi) inhibition of luxS gene expression in E. coli: An approach to inhibit biofilm. Front. Cell. Infect. Microbiol. 2017, 7, 214. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zuberi, A.; Ahmad, N.; Khan, A.U. CRISPRi induced suppression of fimbriae gene (fimH) of a uropathogenic Escherichia coli: An approach to inhibit microbial biofilms. Front. Immunol. 2017, 8, 1552. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hegde, S.; Nilyanimit, P.; Kozlova, E.; Anderson, E.R.; Narra, H.P.; Sahni, S.K.; Heinz, E.; Hughes, G.L. CRISPR/Cas9-mediated gene deletion of the ompA gene in symbiotic Cedecea neteri impairs biofilm formation and reduces gut colonization of Aedes aegypti mosquitoes. PLoS Negl. Trop. Dis. 2019, 13, e0007883. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Parastan, R.; Kargar, M.; Solhjoo, K.; Kafilzadeh, F. Staphylococcus aureus biofilms: Structures, antibiotic resistance, inhibition, and vaccines. Gene Rep. 2020, 20, 100739. [Google Scholar] [CrossRef] [Scilit]
- O’Rourke, J.P.; Daly, S.M.; Triplett, K.D.; Peabody, D.; Chackerian, B.; Hall, P.R. Development of a mimotope vaccine targeting the Staphylococcus aureus quorum sensing pathway. PLoS ONE 2014, 9, e111198. [Google Scholar] [CrossRef] [Scilit]
- Novotny, L.A.; Jurcisek, J.A.; Ward, M.O.; Jordan, Z.B.; Goodman, S.D.; Bakaletz, L.O. Antibodies against the majority subunit of type IV pili disperse nontypeable Haemophilus influenzae biofilms in a LuxS-dependent manner and confer therapeutic resolution of experimental otitis media. Mol. Microbiol. 2015, 96, 276–292. [Google Scholar] [CrossRef] [Scilit]
- Hwang, G.; Paula, A.J.; Hunter, E.E.; Liu, Y.; Babeer, A.; Karabucak, B.; Stebe, K.; Kumar, V.; Steager, E.; Koo, H. Catalytic antimicrobial robots for biofilm eradication. Sci. Robot. 2019, 4, eaaw2388. [Google Scholar] [CrossRef] [Scilit]
- Schairer, D.O.; Martinez, L.R.; Blecher, K.; Chouake, J.S.; Nacharaju, P.; Gialanella, P.; Friedman, J.M.; Nosanchuk, J.D.; Friedman, A.J. Nitric oxide nanoparticles. Virulence 2012, 3, 62–67. [Google Scholar] [CrossRef] [Scilit]
- Fulaz, S.; Vitale, S.; Quinn, L.; Casey, E. Nanoparticle–Biofilm interactions: The role of the EPS Matrix. Trends Microbiol. 2019, 27, 915–926. [Google Scholar] [CrossRef] [Scilit]
- Kulshrestha, S.; Khan, S.; Hasan, S.; Khan, M.E.; Misba, L.; Khan, A.U. Calcium fluoride nanoparticles induced suppression of Streptococcus mutans biofilm: An in vitro and in vivo approach. Appl. Microbiol. Biotechnol. 2016, 100, 1901–1914. [Google Scholar] [CrossRef] [Scilit]
- Jiang, Y.; Geng, M.; Bai, L. Targeting biofilms therapy: Current research strategies and development hurdles. Microorganisms 2020, 8, 1222. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rocco, C.J.; Davey, M.E.; Bakaletz, L.O.; Goodman, S.D. Natural antigenic differences in the functionally equivalent extracellular DNABII proteins of bacterial biofilms provide a means for targeted biofilm therapeutics. Mol. Oral Microbiol. 2016, 32, 118–130. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Devaraj, A.; Justice, S.S.; Bakaletz, L.O.; Goodman, S.D. DNABII proteins play a central role in UPEC biofilm structure. Mol. Microbiol. 2015, 96, 1119–1135. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Novotny, L.A.; Jurcisek, J.A.; Goodman, S.D.; Bakaletz, L.O. Monoclonal antibodies against DNA-binding tips of DNABII proteins disrupt biofilms in vitro and induce bacterial clearance in vivo. EBioMedicine 2016, 10, 33–44. [Google Scholar] [CrossRef] [Scilit]
- Freire, M.O.; Devaraj, A.; Young, A.; Navarro, J.B.; Downey, J.S.; Chen, C.; Bakaletz, L.O.; Zadeh, H.H.; Goodman, S.D. A bacterial-biofilm-induced oral osteolytic infection can be successfully treated by immuno-targeting an extracellular nucleoid-associated protein. Mol. Oral Microbiol. 2017, 32, 74–88. [Google Scholar] [CrossRef] [Scilit]
- Estellés, A.; Woischnig, A.K.; Liu, K.; Stephenson, R.; Lomongsod, E.; Nguyen, D.; Zhang, J.; Heidecker, M.; Yang, Y.; Simon, R.J.; et al. A high-affinity native human antibody disrupts biofilm from Staphylococcus aureus bacteria and potentiates antibiotic efficacy in a mouse implant infection model. Antimicrob. Agents Chemother. 2016, 60, 2292–2301. [Google Scholar] [CrossRef] [Scilit]
- Huang, D.; Wang, J.; Ren, K.; Ji, J. Functionalized biomaterials to combat biofilms. Biomater. Sci. 2020, 8, 4126–4140. [Google Scholar] [CrossRef] [Scilit]
- Pelgrift, R.Y.; Friedman, A.J. Nanotechnology as a therapeutic tool to combat microbial resistance. Adv. Drug Deliv. Rev. 2013, 65, 1803–1815. [Google Scholar] [CrossRef] [Scilit]
- Ikuma, K.; Decho, A.W.; Lau, B.L.T. When nanoparticles meet biofilms—Interactions guiding the environmental fate and accumulation of nanoparticles. Front. Microbiol. 2015, 6, 591. [Google Scholar] [CrossRef] [Scilit]
- Baek, Y.W.; An, Y.J. Microbial toxicity of metal oxide nanoparticles (CuO, NiO, ZnO, and Sb2O3) to Escherichia coli, Bacillus subtilis, and Streptococcus aureus. Sci. Total Environ. 2011, 409, 1603–1608. [Google Scholar] [CrossRef] [Scilit]
- Hernández-Sierra, J.F.; Ruiz, F.; Cruz Pena, D.C.; Martínez-Gutiérrez, F.; Martínez, A.E.; de Jesús Pozos Guillén, A.; Tapia-Pérez, H.; Castañón, G.M. The antimicrobial sensitivity of Streptococcus mutans to nanoparticles of silver, zinc oxide, and gold. Nanomed. Nanotechnol. Biol. Med. 2008, 4, 237–240. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Iannitelli, A.; Grande, R.; di Stefano, A.; di Giulio, M.; Sozio, P.; Bessa, L.J.; Laserra, S.; Paolini, C.; Protasi, F.; Cellini, L. Potential antibacterial activity of carvacrol-loaded poly(DL-lactide-co-glycolide) (PLGA) nanoparticles against microbial biofilm. Int. J. Mol. Sci. 2011, 12, 5039–5051. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kulshrestha, S.; Khan, S.; Meena, R.; Singh, B.R.; Khan, A.U. A graphene/zinc oxide nanocomposite film protects dental implant surfaces against cariogenic Streptococcus mutans. Biofouling 2014, 30, 1281–1294. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Goto, T.; Nakame, Y.; Nishida, M.; Ohi, Y. In vitro bactericidal activities of betalactamases, amikacin, and fluoroquinolones against Pseudomonas aeruginosa biofilm in artificial urine. Urology 1999, 53, 1058–1062. [Google Scholar] [CrossRef] [Scilit]
- Carpenter, B.L.; Situ, X.; Scholle, F.; Bartelmess, J.; Weare, W.W.; Ghiladi, R.A. Antiviral, antifungal and antibacterial activities of a BODIPY-based photosensitizer. Molecules 2015, 20, 10604–10621. [Google Scholar] [CrossRef] [Scilit]
- Hu, X.; Huang, Y.Y.; Wang, Y.; Wang, X.; Hamblin, M.R. Antimicrobial photodynamic therapy to control clinically relevant biofilm infections. Front. Microbiol. 2018, 9, 1299. [Google Scholar] [CrossRef] [Scilit]
- Plaetzer, K.; Krammer, B.; Berlanda, J.; Berr, F.; Kiesslich, T. Photophysics and photochemistry of photodynamic therapy: Fundamental aspects. Lasers Med. Sci. 2009, 24, 259–268. [Google Scholar] [CrossRef] [Scilit]
- Li, M.; Li, L.; Su, K.; Liu, X.; Zhang, T.; Liang, Y.; Jing, D.; Yang, X.; Zheng, D.; Cui, Z.; et al. Highly effective and noninvasive near-infrared eradication of a Staphylococcus aureus biofilm on implants by a photoresponsive coating within 20 Min. Adv. Sci. 2019, 6, 1900599. [Google Scholar] [CrossRef] [Scilit]
- Patra, J.K.; Das, G.; Fraceto, L.F.; Campos, E.V.R.; Rodriguez-Torres, M.D.P.; Acosta-Torres, L.S.; Diaz-Torres, L.A.; Grillo, R.; Swamy, M.K.; Sharma, S.; et al. Nano based drug delivery systems: Recent developments and future prospects. J. Nanobiotechnology 2018, 16, 71. [Google Scholar] [CrossRef] [Scilit]
- Motta, J.P.; Wallace, J.L.; Buret, A.G.; Deraison, C.; Vergnolle, N. Gastrointestinal biofilms in health and disease. Nat. Rev. Gastroenterol. Hepatol. 2021, 18, 314–334. [Google Scholar] [CrossRef] [Scilit]
- Stewart, P.S. Prospects for anti-biofilm pharmaceuticals. Pharmaceuticals 2015, 8, 504–511. [Google Scholar] [CrossRef] [Scilit]
- Fleming, D.; Rumbaugh, K. Approaches to dispersing medical biofilms. Microorganisms 2017, 5, 15. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vuotto, C.; Donelli, G. Novel treatment strategies for biofilm-based infections. Drugs 2019, 79, 1635–1655. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Johnson, C.H.; Spilker, M.E.; Goetz, L.; Peterson, S.N.; Siuzdak, G. Metabolite and microbiome interplay in cancer immunotherapy. Cancer Res. 2016, 76, 6146–6152. [Google Scholar] [CrossRef] [Scilit]
- Li, S.; Konstantinov, S.R.; Smits, R.; Peppelenbosch, M.P. Bacterial biofilms in colorectal cancer initiation and progression. Trends Mol. Med. 2017, 23, 18–30. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Le, P.; Kunold, E.; Macsics, R.; Rox, K.; Jennings, M.C.; Ugur, I.; Reinecke, M.; Chaves-Moreno, D.; Hackl, M.W.; Fetzer, C.; et al. Repurposing human kinase inhibitors to create an antibiotic active against drug-resistant Staphylococcus aureus, persisters and biofilms. Nat. Chem. 2020, 12, 145–158. [Google Scholar] [CrossRef] [Scilit]
- Li, J.; Zhao, H.; Zheng, L.; An, W. Advances in synthetic biology and biosafety governance. Front. Bioeng. Biotechnol. 2021, 9, 173. [Google Scholar] [CrossRef] [Scilit]
- Hong, S.H.; Lee, J.; Wood, T.K. Engineering global regulator Hha of Escherichia coli to control biofilm dispersal. Microb. Biotechnol. 2010, 3, 717–728. [Google Scholar] [CrossRef] [Scilit]
- Volke, D.C.; Nikel, P.I. Getting bacteria in shape: Synthetic Morphology approaches for the design of efficient microbial cell factories. Adv. Biosyst. 2018, 2, 1800111. [Google Scholar] [CrossRef] [Scilit]
- Fang, K.; Park, O.J.; Hong, S.H. Controlling biofilms using synthetic biology approaches. Biotechnol. Adv. 2020, 40, 107518. [Google Scholar] [CrossRef] [Scilit]
- Wood, T.K.; Hong, S.H.; Ma, Q. Engineering biofilm formation and dispersal. Trends Biotechnol. 2011, 29, 87–94. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hong, S.H.; Hegde, M.; Kim, J.; Wang, X.; Jayaraman, A.; Wood, T.K. Synthetic quorum-sensing circuit to control consortial biofilm formation and dispersal in a microfluidic device. Nat. Commun. 2012, 3, 613. [Google Scholar] [CrossRef] [Scilit] [PubMed]



| Antibiofilm Agents | Functions |
|---|---|
| Class I | penetrate the biofilm EPS and decrease the growth of cells |
| Class II | interfere with the adherence of bacteria and the formation of biofilm phenotype |
| Class III | controls both the growth of bacteria with biofilm phenotype as well as the EPS synthesis |
| Class IV | disperse the mature biofilms |
| Name of the Compound | Type | Mode of Action | Effective Against | Reference |
|---|---|---|---|---|
| Triton X-100 | surfactant | autolysis, targeting EPS | S. aureus | [31,32] |
| Tween 80 | surfactant | N/A | P. aeruginosa, S. aureus | [30] |
| Quarternary ammonium compounds | surfactant | Cell lysis and death | several bacteria | [34] |
| Poloxamer containing non-ionic surfactant | surfactant | EPS metalloproteinase modulation | P. aeruginosa | [34] |
| Rhamnolipids | bio-surfactant | N/A | S. aureus, Salmonella Enteritidis, and Listeria monocytogenes | [36] |
| EDTA | chelators | damage to cell wall | P. aeruginosa | [40] |
| Chitosan | biomaterial | membrane damage | P. aeruginosa | [41] |
| Secondary metabolite from Citrus limonoids | secondary metabolite | quorum sensing | Vibriyo harveyi | [42] |
| Cyclo(l-Tyr-l-Leu) | secondary metabolite | inhibit EPS | S. epidermidis | [43] |
| Cahuitamycins | secondary metabolite | N/A | A. baumanii | [44] |
| Phlorotannin | secondary metabolite | damaging membrane permeability/ cell lysis | MRSA | [45] |
| α-amylase | enzyme | degrade EPS | MRSA | [46] |
| Polyamine norspermidine | polyamine | interacts with EPS | B. subtilis, E. coli and S. aureus | [47] |
| D-amino acids | amino acid | target YqxM | E. coli, S. aureus | [48] |
| N-acetylcysteine/NAC | amino acid | degrade EPS polysaccharide | Rapidly growing Mycobacterium | [49] |
| Esp (Serine protease) | enzymes | degrade EPS protein content | S. aureus | [50] |
| DNase I | enzymes | degrade eDNA | E. coli, S. aureus | [51] |
| tea-tree oil | secondary metabolite | metabolism | S. aureus | [52] |
| Protease from P. aeruginosa | enzymes | degrade EPS protein content | S. aureus | [53] |
| Compound/Molecule | Mode of Action | Effective Against | Reference |
|---|---|---|---|
| Garlic extracts | inhibits QS | P. aeruginosa | [62] |
| Garlic extracts | inhibit LasR and LuxR | P. aeruginosa | [63] |
| Isolimonic acid | cell-cell signaling | E. coli | [64,65] |
| Isolimonic acid | reduce LuxR DNA binding | Vibrio spp. | [65] |
| Cinnamaldehyde | swimming motility | E. coli | [66] |
| Hordenine | decrease in signaling molecule, inhibition of QS-related genes | P. aeruginosa | [67,68] |
| Autoinducing peptide type I (AIP-I) | inhibit QS | S. aureus | [74] |
| RNAIII-inhibiting peptide (RIP) | inhibit QS | S. aureus | [75] |
| Querentin | decrease LasI/R, RhlI/R expressions | P. aeruginosa | [73] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Shrestha, L.; Fan, H.-M.; Tao, H.-R.; Huang, J.-D. Recent Strategies to Combat Biofilms Using Antimicrobial Agents and Therapeutic Approaches. Pathogens 2022, 11, 292. https://doi.org/10.3390/pathogens11030292
Shrestha L, Fan H-M, Tao H-R, Huang J-D. Recent Strategies to Combat Biofilms Using Antimicrobial Agents and Therapeutic Approaches. Pathogens. 2022; 11(3):292. https://doi.org/10.3390/pathogens11030292
Chicago/Turabian StyleShrestha, Looniva, Hai-Ming Fan, Hui-Ren Tao, and Jian-Dong Huang. 2022. "Recent Strategies to Combat Biofilms Using Antimicrobial Agents and Therapeutic Approaches" Pathogens 11, no. 3: 292. https://doi.org/10.3390/pathogens11030292
APA StyleShrestha, L., Fan, H.-M., Tao, H.-R., & Huang, J.-D. (2022). Recent Strategies to Combat Biofilms Using Antimicrobial Agents and Therapeutic Approaches. Pathogens, 11(3), 292. https://doi.org/10.3390/pathogens11030292

