Next Article in Journal
Developing a Phototactic Electrostatic Insect Trap Targeting Whiteflies, Leafminers, and Thrips in Greenhouses
Next Article in Special Issue
The Development and Evaluation of Insect Traps for the Asian Citrus Psyllid, Diaphorina citri (Hemiptera: Psyllidae), Vector of Citrus Huanglongbing
Previous Article in Journal
An Integrative Study on Asphondylia spp. (Diptera: Cecidomyiidae), Causing Flower Galls on Lamiaceae, with Description, Phenology, and Associated Fungi of Two New Species
Previous Article in Special Issue
Silencing of Aquaporin Homologue Accumulates Uric Acid and Decreases the Lifespan of the Asian Citrus Psyllid, Diaphorina citri (Hemiptera: Liviidae)
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Brief Report

The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus

by
Yulica Santos-Ortega
1,2 and
Nabil Killiny
1,*
1
Department of Plant Pathology, Citrus Research and Education Center, IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA
2
Department of Biological Environmental and Earth Sciences, Discipline: Cell and Molecular Biology, The University of Southern Mississippi, 118 College Drive, Hattiesburg, MS 39406, USA
*
Author to whom correspondence should be addressed.
Insects 2021, 12(11), 959; https://doi.org/10.3390/insects12110959
Submission received: 30 September 2021 / Revised: 11 October 2021 / Accepted: 20 October 2021 / Published: 21 October 2021
(This article belongs to the Collection Psyllid Vectors: From Genetics to Pest Integrated Management)

Simple Summary

Huanglongbing is currently the most devastating disease of citrus worldwide. It is believed that controlling the vector, Diaphorina citri, is the most important and effective method of disease management. To achieve this goal, we have employed RNA interference (RNAi), a promising technique for controlling D. citri. Our present strategy is to target D. citri egg hatching. By reducing the rate of egg hatching, we will reduce the vector population and subsequently reduce the spread of disease. In order to interfere with the egg hatching mechanism, we studied the chorion proteome to identify potential gene candidates for RNAi.

Abstract

Nowadays, the Asian citrus psyllid, Diaphorina citri (Kuwayama) (Hemiptera: Liviidae) is considered the most devastating pest of citrus because it transmits “Candidatus Liberibacter asiaticus”, the putative causal agent of huanglongbing (HLB) or citrus greening. Controlling the vector is the main strategy used to mitigate HLB. Targeting D. citri at the very early stages of its development may offer an effective control strategy. Identifying chorion proteins will contribute to a better understanding of embryo development and egg hatching and thus could lead to valuable targets to better control psyllid populations. Herein, we analyze the chorion proteins of D. citri. Mass spectrometry-based bottom-up/shotgun proteomics and databases were queried to achieve protein identification. Fifty-one proteins were identified in D. citri chorion. The D. citri chorion proteins were divided into eight categories according to their biological or molecular function: i—enzymes (25%); ii—binding proteins (10%); iii—structural proteins (8%); iv—homeostasis-related proteins, mostly vitellogenins (8%); v—proteins related to gene expression (6%); vi—immune system proteins (6%); vii—other proteins (16%); and viii—uncharacterized proteins (21%). The composition of the chorion proteome suggested that the hatching rate could be reduced by silencing chorion-related genes. The proteomic analysis of D. citri chorion tissue allowed us to identify its proteins, providing promising new targets for D. citri control through RNA interference technology.

1. Introduction

The Asian citrus psyllid, Diaphorina citri (Kuwayama) (Hemiptera: Liviidae), is a sap-sucking hemipteran that serves as the main vector for “Candidatus Liberibacter asiaticus”, the putative causal agent of citrus huanglongbing (HLB) [1,2]. Once inoculated into the host tree, the bacterium multiplies and initiates a cascade of host plant responses that leads to callose deposition in leaves [3,4], starch accumulation, asymmetrical leaf mottling [5], and root loss [6]. HLB is rapidly transmitted by D. citri as it feeds on the phloem sap of Rutaceae species, which include Citrus and its relatives [1]. D. citri is the insect vector of “Ca. L. asiaticus” in Asia, Brazil, and the USA [7,8]. Severe economic losses result from the infestations with D. citri because it colonizes the new shoots, transmitting “Ca. L. asiaticus” to trees and causing damage to foliage. Trees infected with “Ca. L. asiaticus” are short-lived, have reduced yields, and produce smaller, lopsided fruit with poor quality juice [9,10,11,12].
Mitigation of HLB has been achieved primarily through the chemical control of D. citri, but it has failed to contain the spread of the disease in the US. Chemical pesticide use for D. citri control has led to reports of insecticide resistance [13,14] and is non-specific, and off-target effects may harm beneficial insects such as honeybees. Furthermore, most insecticides have negative environmental impacts, and applications are difficult to coordinate among growers [15]. Numerous non-chemical control strategies have been attempted with some degree of success, including kaolin clay treatments [16], heat treatments [17], enhanced nutritional programs [17,18,19], and biological control [20] (see reviews [21,22]), but nearly 100% of Florida citrus groves are currently affected by HLB disease.
A relatively modern biotechnological approach known as RNA interference (RNAi) has shown promising results for “silencing” genes in D. citri to study functional genomics. The sequencing of the D. citri genome and the resulting transcriptome has allowed the discovery of many diverse predicted proteins [23,24,25]. However, the new challenge is to identify the functions and roles these genes play in the lifecycle of D. citri and find those that can be exploited against it. RNAi techniques have been utilized extensively to study potential control targets. Double-stranded RNA (dsRNA) can be applied to adult psyllids topically [26], and through an artificial diet [27,28,29], while nymphs can be treated easily through topical feeding [30] or soaking in dsRNA solutions [31]. RNAi technologies were recently reviewed [32]. We targeted genes implicated in the development and metamorphosis of D. citri (abnormal wing disc, muscle protein 20) [31,33,34], gender ratios (boule and transformer-2 homologues) [27,28], metabolism (sucrose hydrolase) [35], and insecticide resistance (cytochrome P450, acetylcholinesterases, glutathione S-transferase) [26,29,30,36]. So far, RNAi treatments to D. citri have been restricted to the laboratory.
The order Hemiptera, which includes phloem-feeding aphids, psyllids, whiteflies and leafhoppers, pass through several life stages, from egg to nymphs to adult, without a pupal stage. D. citri females lay 400–600 eggs in the soft new flush of citrus or other host plants, which incubate at ambient temperatures for about 4 d [37]. Nymphs pass through five instar stages before molting into the adult form 12–13 d later [37]. During incubation, the chorion (eggshell) protects insect embryos from the environment [38]. During the later stages of oogenesis, the chorion matrix is secreted between the oocyte and overlaying somatic follicle cells [39]. Its multilayered structure performs a variety of specialized functions such as providing substrate attachment, resistance to acid or alkalis, preventing water loss, and allowing gas exchange throughout development [39,40]. The differences in ecological environment and, specifically, oviposition substrates have determined through evolution the chorion morphology, organization, and composition among different species [41]. Chorion proteins are the components that play a pivotal role in chorion assembling and stabilization and ensure the success of embryo development after oviposition [42].
To our knowledge, the very early developmental stages, including egg hatching and embryo development, have not been fully exploited to control D. citri, with only one report of embryo suppression using CRISPR gene knock-out [43,44]. To target egg production by RNAi, information about the proteins that function in chorion formation would be needed. Therefore, we used proteomic approaches to aid in the identification of D. citri chorion proteins to provide new targets to control psyllids from their earliest stages. To achieve this goal, we employed mass spectrometry-based bottom-up/shotgun proteomics in conjunction with the Uniprot database to identify the D. citri chorion proteins.

2. Materials and Methods

2.1. Insect Colonies

The laboratory colony of D. citri was reared continuously on healthy Citrus macrophylla seedlings 3–6 months old. The seedlings and D. citri were maintained in a controlled-temperature growth room with a 16:8 h L:D photoperiod, 27 ± 2 °C, and 60 ± 5% relative humidity. This facility is located at the Citrus Research and Education Center in Lake Alfred (28.092783° N, 81.72307° E), Florida.

2.2. Chorion Collection and Sample Preparation

Egg collection was carried out in an artificial medium created specifically for egg hatching from D. citri in our laboratory [45] (Figure 1A). Briefly, the medium was comprised of 25% of sucrose, 1% yeast, sterilized water (10 mL), and 0.56 g of unflavored gelatin. The leaves of Citrus macrophylla plants containing psyllid eggs were collected and washed for 5 min in 0.03% bleach (1% of a commercial product), followed by three rinses in sterile water. Afterwards, the eggs were carefully removed from the leaves using a modified dissecting needle (bent slightly at the tip), immediately placed on the artificial medium, and kept at ambient temperature (25 °C). Following the hatching of the first instar D. citri nymphs, approximately 420 choria were recovered. The choria were homogenized with a pestle in a solution of 0.1 M of ammonium acetate (NH4Ac) and were briefly centrifuged to discard debris. The sample was transferred to a new microcentrifuge tube, and the determination of protein concentration was performed using the Bicinchoninic acid method (PierceTM BCA Protein Assay Kit, ThermoFisher Scientific, Waltham, MA, USA). The sample was stored at −80 °C until analysis.

2.3. Reduction/Alkylation and In-Solution Digestion of Chorion Proteins

The chorion sample (25 µL initial volume) in 0.1 M of NH4Ac was reduced with 5 µL of 200 mM dithiothreitol (DTT) at 95 °C for 5 min and at 55 °C for 45 min. The sample was alkylated with 4 µL of 1 M chloroacetamide (CAA) at 25 °C for 45 min in the darkness, and the reaction was stopped with 20 µL of 200 mM DTT at 25 °C for 45 min. Trypsin solution was prepared in ammonium bicarbonate (NH4HCO3) for tryptic digestion of the sample in a 1:50 trypsin:protein ratio at 37 °C overnight (In-Solution Tryptic Digestion Kit, Thermo Scientific, Waltham, MA, USA) [46].

2.4. Desalting of Digested Protein

The digested chorion sample was desalted with micro ZipTip C18 (Millipore, St. Louis, MO, USA) by equilibrating the tip in 100% acetonitrile (ACN) (1 × 10 µL), 50% ACN/50% of 0.1% trifluoroacetic acid (TFA) (1 × 10 µL), and 0.1% TFA (3 × 10 µL). The sample was loaded into the ZipTip by pipetting the sample 10 times and washing with 0.1% TFA (10 × 10 µL) before eluting. The protein fragments were eluted with 80% ACN/0.1% TFA and dried in a SpeedVac.

2.5. LC-MS/MS Mass Spectrometry Analysis

LC-MS/MS was carried out at the Interdisciplinary Center for Biotechnological Research, University of Florida, Gainesville, FL. The digested sample was resuspended in 0.1% formic acid, and mass spectrometry was performed on an EASY-nLCTM 1200 ultra-high-performance liquid chromatography system (Thermo Fisher Scientific, Waltham, MA, USA) connected to an Orbitrap FusionTM TribridTM instrument equipped with a nano-electrospray source (Thermo Fisher Scientific, Waltham, MA, USA). The digested sample was loaded into a C18 trapping column (AcclaimTM PepMapTM 100, 75 µm inner diameter × 2 cm length, 3 µm particle size, and 100 Å pore size) and eluted with a C18 analytical column (AcclaimTM PepMapTM 100, 75 µm inter diameter × 15 cm length, 2 µm particle size, and 100 Å pore size) at a flow rate of 250 nL/min. The separation was using solvent A (0.1% formic acid in water) and solvent B (0.1% formic acid and 80% acetonitrile) as the mobile phases, increasing the gradient as follows: 2–35% of solvent B over 0–140 min; 35–80% of solvent B over 40–45 min, 80–98% of solvent B over 45–46 min, and kept at 98% of solvent B until 60 min [47]. The full MS1 scan (m/z 350–2000) was performed on the Orbitrap Fusion with a resolution of 120,000 at m/z 200 [48]. The automatic gain control (AGC) target was 2 × 105, with 50 ms as the maximum injection time. Monoisotopic precursor selection (MIPS) was enforced to filter for peptides. Peptides bearing +2–6 charges were selected with an intensity threshold of 1 × 104. Dynamic exclusion of 15 s was used to prevent resampling the high abundance peptides. The top speed method was used for data-dependent acquisition within a cycle of 3 s. The MS/MS was carried out in the ion trap, with a quadrupole isolation window of 1.3 Da. Fragmentation of the selected peptides by collision-induced dissociation (CID) was done at 35% of normalized collision energy. MS2 spectra were detected in the linear ion trap with the AGC target as 1e4 and the maximum injection time as 35 ms.

2.6. Database Searches

MS/MS data were analyzed using Mascot version 2.7.0.1 (Matrix Science, London, UK) by searching against the UnitProt-Diaphorina_citri_20200316 database (unknown version, 22,073 entries) (https://www.uniprot.org/proteomes/UP000079169/ accessed on 20 September 2021), assuming digestion with trypsin. Fragment ion mass tolerance was set at 1.00 Da and parent ion tolerance at 10 ppm 0+18 of pyrrolysine and carbamidomethyl of cysteine, specified in Mascot as fixed modifications [46,47]. Gln->pyro-Gln of the N-terminus, deamidate of asparagine and glutamine, and oxidation of methionine were specified in Mascot as variable modifications. Peptide identifications were accepted if they could be established at greater than 95.0% probability by the Scaffold Local FDR algorithm. Protein identifications were accepted if they could be established at greater than 99.0% probability and contained at least two identified peptides. Protein probabilities were assigned by the Protein Prophet algorithm [49]. Further, MS/MS-based peptide and protein identification was validated using Scaffold version 4.10.0 (Proteome Software Inc., Portland, OR, USA).

3. Results and Discussion

The chorion covers the whole surface area of the insect eggs to impair water loss, allow gas exchange during development, and protect the eggs from the maternal body [50]. The chorion is a highly specialized, multilayered barrier that allows for the fertilization of the oocyte and adjusts its permeability to allow optimal conditions for embryo development. These conditions vary dramatically depending on the insect species and its ecology, i.e., whether eggs are laid on plant leaves, in soil, above or below ground, or in water. Chorion composition, structure, and physical properties determine its permeability, restricting the egg’s development to specific environments [51]. Chorion is composed of proteinaceous and organic molecules [52] that can be identified, in part, through proteomics analysis [51,53,54].
In the current study, we identified 51 proteins (Table 1) in D. citri chorion. The proteins were categorized by their biological or molecular function, as indicated in Figure 1B. The D. citri chorion proteins putatively identified were divided into eight categories: (i) enzymes such as hydrolases, transferase, and enzymes related to GTPase and glycosidase activity; (ii) binding proteins; (iii) structural proteins; (iv) homeostasis-related proteins (mostly vitellogenins); (v) proteins related to gene expression; (vi) immune system proteins; (vii) other proteins; and (viii) uncharacterized proteins.

3.1. Enzymes

The largest group found in the chorion proteins were enzymes (25%), and these consisted largely of hydrolases such as the probable chitinase 10 GH18 family (306 kDa), the endochitinase GH18 family (68 kDa), chitooligosaccharidolytic β-N-acetylglucosaminidase-like (38 kDa), and alpha galactosidase (17 kDa). Several glycoside hydrolases were identified in D. citri chorion (chitinase or endo-N-acetyl-β-D-glucosaminidase (ENGase), chitinase-like lectins (chi-lectins/proteins (CLPs), alpha mannosidase, and alpha-glucosidase). Although the function of these enzymes in insect chorion is not completely understood, in general, they are involved in chitin biosynthesis and the degradation of insect anatomical structures, such as the trachea, mouthparts, and cuticle [55]. On the other hand, the presence of carbohydrates in chorion has been involved in fertilization as a putative ligand for sperm enzymes [56].
Three proteins were characterized as peptidases, including carboxypeptidase D-like (145 kDa), aminopeptidase (92 kDa), and an uncharacterized 91 kDa protein. We previously detected both a carboxypeptidase and a hypothetical aminopeptidase in the cytosolic protein fraction of adult D. citri [46] that are likely involved in general proteolysis. Similarly, in the saliva proteins of D. citri, Yu and Killiny [47] detected a 472.7 kDa protein with histone acetyltransferase activity similar to histone acetyltransferase p300, but its small size in the chorion fraction (30 kDa) suggests a different homology. The remaining enzymes identified included epoxide hydrolase 4-like (46 kDa) and apoptosis-inducing factor-1-mitochondrial (81 kDa), which was assigned as an oxyreductase.

3.2. Binding Proteins

Three types of binding proteins (10% of total proteins) were identified in the D. citri chorion—nucleic-acid-binding, odorant-binding, and chitin-binding proteins. The chitin binding proteins included protein obstructor-E-like (27 kDa) and an uncharacterized protein (51 kDa). Protein obstructor-E-like has been reported to be critical in Drosophila larval development, and mutants lacking this gene failed to metamorphose correctly [57]. Protein obstructor-E directs cuticle formation during the pupation of holometabolous insects, shifting the body shape from a longitudinal (larval) arrangement to a more lateral (adult) orientation [57]. Whether this gene applies to insects without a larval stage remains to be demonstrated but offers an interesting challenge.
A ubiquitous nucleic acid-binding protein identified as zinc finger homeobox protein 3-like (85 kDa) has been found in the chorion of D. citri, as was odorant-binding protein-1 (16 kDa), which is common to many insects. The identification of odorant-binding proteins (OBP) in our sample, which is considered a chemoattractant for sperm in Anopheles gambiae and Aedes aegypti [51,54], suggests that the chorion of D. citri is important for fertilization and, therefore, is an excellent silencing target to prevent gamete fertilization.

3.3. Structural and Protection Proteins

Two proteins, vegetative cell wall protein gp1-like (52 kDa) and a 39 kDa uncharacterized protein, were assigned as structural proteins (8% of total proteins). The gp1-like cell wall protein is the product of a gene primarily found in plants, but it was also identified in five hemipterans. Cuticle protein 7-like (protection function) was identified in the chorion, and interestingly, more than 800 cuticle proteins have been identified in insects as a major component of their main body covering [58]. Although we found no literature existing specifically about cuticle protein 7-like, it and the gp1-like protein present opportunities for further study.

3.4. Vitellogenins

Several proteins identified as homeostasis-related proteins (8%) in the chorion could be possible targets to control D. citri by RNAi. We identified two vitellogenins that functioned as a nutritional source of eggs (170 kDa), as well as for lipid transport (64 kDa), and two vitellogenins associated with the Von Willebrand factor domain (VWFD) that are required for normal homeostasis. Vitellogenin (Vg) is a precursor protein that produces the major storage protein, vitellin, in insect eggs [59]. Several Vg genes have been silenced by RNAi in Bemisia tabaci [60], Rhodnius prolixus [39], and Nilaparvata lugens [61], causing a significant decrease in survival rate, increased mortality, reduction in egg count, and distorted egg-laying patterns, suggesting that Vg genes are promising targets for pest control. Vg protein was also found in the body and head of white-backed planthoppers, and its gene expression was highest in mature females, suggesting an important role in reproduction [62].

3.5. Gene Expression Regulation Proteins

Two proteins identified as Golgin subfamily A member 4-like (180 and 192 kDA) were detected by LC-MS/MS of D. citri choria. Miao et al. [62] reported the presence of golgin subfamily genes in the salivary proteome of the plant hopper, Sogatella furcifera. Its biological function was assigned as a Golgi transporter. A third low-quality cytoskeletal protein, myosin-II-like (non-muscle) (151 kDa), was found in the sample and is thought to be active during the mitosis and invagination of eggs during Drosophila embryogenesis [63].

3.6. Immune Response

Two proteins related to immune response (6% of total proteins) were identified, including leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1) (60 kDa) and a 10 kDa uncharacterized protein. LRIG1 is thought to interact with epidermal growth factors during oogenesis in mammals, but its study in insects is incomplete [64]. However, in mammals, its immune response relates to the wound healing of the epidermis and suppresses cell proliferation in embryonic tissues [65].

3.7. Other Proteins and Uncharacterized Proteins

Two cellular process proteins (16% of total proteins), ubiquilin-1 (39 kDa) and the RNA polymerase-associated factor (Paf 1) CTR9 homolog (158 kDa), were identified and classified in the “others” category of Figure 1B. A similar ubiquilin protein was identified in B. tabaci fed a high phenylpropanoid/flavonoid diet. Up-regulation of this gene indicated an adaptation in B. tabaci for the detoxification of plant phenolics [66]. The RNA polymerase II-CTR9 homolog is present ubiquitously in all organisms and regulates DNA transcription to mRNA at the SH2 domain. It is essential for embryonic development, particularly the histone H3 trimethylation of lysine [67]. In Drosophila, the Paf1 homolog CTR9 is localized to the germ cells and maturing eggs, and knock-out results in aberrant polyploid morphology of the nuclei [67]. These defects eventually became lethal to embryos and early-stage larvae.
Interestingly, 21% of identified proteins were uncharacterized but were assigned a predicted function. Two of the predicted functions included environmental challenges and the calcium-dependent carbohydrate recognition domain (CRD) (Table 1). The uncharacterized genes with CRD-predicted function could be involved in plant lectin recognition as a part of the innate immune system of D. citri [68]. Although there were a large number of hypothetical proteins, the genes encoding these proteins could be subjected to silencing using RNAi in order to identify their biological function in D. citri.

4. Conclusions

Eggs are highly vulnerable when they are deposited on leaves because they are exposed to environmental conditions, predators, and infections [69]. In addition, Ammar et al. [70] showed that nymphs of D. citri acquire the bacterial pathogen of HLB at a higher rate than adult D. citri. Therefore, interrupting the lifecycle at the earliest stages should have the greatest impact on the transmission of the HLB pathogen. Silencing these chorion-related genes in the early stages of choriogenesis would be advantageous to reduce the viability of the eggs after oviposition, likely reducing the hatching rate. The proteomic analysis of recovered D. citri choria allowed us to identify its constituent proteins and provide promising new targets for further investigations of D. citri control through RNAi.

Author Contributions

N.K., together with Y.S.-O., conceptualized the idea. Y.S.-O. and N.K. carried out the work. Y.S.-O. and N.K. drafted the manuscript and finalized the figures and tables. Finally, N.K. revised and finalized the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This work was generously supported by grant No. 2020-08460 for N.K. from the National Institute of Food and Agriculture (NIFA-USDA).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data will be shared upon request to the corresponding authors.

Acknowledgments

We thank the members of our laboratory for helpful discussions, detailed comments, and constructive suggestions.

Conflicts of Interest

The authors declare there is no conflict of interest.

References

  1. Bové, J.M. Huanglongbing: A destructive, newly emerging, century-old disease of citrus. J. Plant Pathol. 2006, 88, 7–37. [Google Scholar]
  2. Jagoueix, S.; Bové, J.M.; Garnier, M. The phloem-limited bacterium of greening disease of citrus is a member of the alpha-subdivision of the proteobacteria. Int. J. of Syst. Bacteriol. 1994, 44, 379–386. [Google Scholar] [CrossRef] [Scilit]
  3. Achor, D.S.; Etxeberria, E.; Wang, N.; Folimonova, S.Y.; Chung, K.R.; Albrigo, L.G. Sequence of anatomical symptom observations in citrus affected with huanglongbing disease. Plant Pathol. J. 2010, 9, 56–64. [Google Scholar] [CrossRef] [Scilit]
  4. Koh, E.-J.; Zhou, L.; Williams, D.S.; Park, J.; Ding, N.; Duan, Y.-P.; Kang, B.-H. Callose deposition in the phloem plasmodesmata and inhibition of phloem transport in citrus leaves infected with “Candidatus Liberibacter asiaticus”. Protoplasma 2012, 249, 687–697. [Google Scholar] [CrossRef] [Scilit]
  5. Cimo, G.; Lo Bianco, R.; Gonzalez, P.; Bandaranayake, W.; Etxeberria, E.; Syvertsen, J.P. Carbohydrate and Nutritional Responses to Stem Girdling and Drought Stress with Respect to Understanding Symptoms of Huanglongbing in Citrus. Hortscience 2013, 48, 920–928. [Google Scholar] [CrossRef] [Scilit]
  6. Johnson, E.G.; Wu, J.; Bright, D.B.; Graham, J.H. Association of ‘Candidatus Liberibacter asiaticus’ root infection, but not phloem plugging with root loss on huanglongbing- affected trees prior to appearance of foliar symptoms. Plant. Pathol. 2014, 63, 290–298. [Google Scholar] [CrossRef] [Scilit]
  7. Halbert, S.E.; Manjunath, K.L. Asian citrus psyllids (Sternorrhyncha: Psyllidae) and greening disease of citrus: A literature review and assessment of risk in Florida. Fla. Entomol. 2004, 87, 330–353. [Google Scholar] [CrossRef] [Scilit]
  8. Teixeira, D.D.; Danet, J.L.; Eveillard, S.; Martins, E.C.; Junior, W.C.J.; Yamamoto, P.T.; Lopes, S.A.; Bassanezi, R.B.; Ayres, A.J.; Saillard, C.; et al. Citrus huanglongbing in Sao Paulo State, Brazil: PCR detection of the Candidatus Liberibacter species associated with the disease. Mol. Cell. Probes 2005, 19, 173–179. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Baldwin, E.; Plotto, A.; Manthey, J.; McCollum, G.; Bai, J.H.; Irey, M.; Cameron, R.; Luzio, G. Effect of Liberibacter Infection (Huanglongbing Disease) of Citrus on Orange Fruit Physiology and Fruit/Fruit Juice Quality: Chemical and Physical Analyses. J. Agric. Food Chem. 2010, 58, 1247–1262. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  10. Gottwald, T.R. Current Epidemiological Understanding of Citrus Huanglongbing. Annu. Rev. Phytopathol. 2010, 48, 119–139. [Google Scholar] [CrossRef] [Scilit]
  11. Stover, E.; McCollum, G. Incidence and Severity of Huanglongbing and Candidatus Liberibacter asiaticus Titer among Field-infected Citrus Cultivars. Hortscience 2011, 46, 1344–1348. [Google Scholar] [CrossRef] [Scilit]
  12. Court, C.D.; Hodges, A.W.; Stair, C.; Rahmani, M. Economic Contributions of the Florida Citrus Industry in 2016–2017; University of Florida: Gainesville, FL, USA, 2018. [Google Scholar]
  13. Tiwari, S.; Mann, R.S.; Rogers, M.E.; Stelinski, L.L. Insecticide resistance in field populations of Asian citrus psyllid in Florida. Pest. Manag. Sci. 2011, 67, 1258–1268. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Tiwari, S.; Stelinski, L.L.; Rogers, M.E. Biochemical Basis of Organophosphate and Carbamate Resistance in Asian Citrus Psyllid. J. Econ. Entomol. 2012, 105, 540–548. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Singerman, A.; Lence, S.H.; Useche, P. Is Area-Wide Pest Management Useful? The Case of Citrus Greening. Appl. Econ. Perspect. Policy 2017, 39, 609–634. [Google Scholar] [CrossRef] [Scilit]
  16. Hall, D.G.; Lapointe, S.L.; Wenninger, E.J. Effects of a particle film on biology and behavior of Diaphorina citri (Hemiptera: Psyllidae) and its infestations in citrus. J. Econ. Entomol. 2007, 100, 847–854. [Google Scholar] [CrossRef] [Scilit]
  17. Rouse, R.E.; Ozores-Hampton, M.; Roka, F.M.; Roberts, P. Rehabilitation of Huanglongbing-affected Citrus Trees Using Severe Pruning and Enhanced Foliar Nutritional Treatments. Hortscience 2017, 52, 972–978. [Google Scholar] [CrossRef] [Scilit]
  18. Gottwald, T.R.; Graham, J.H.; Irey, M.S.; McCollum, T.G.; Wood, B.W. Inconsequential effect of nutritional treatments on huanglongbing control, fruit quality, bacterial titer and disease progress. Crop. Prot. 2012, 36, 73–82. [Google Scholar] [CrossRef] [Scilit]
  19. Stansly, P.A.; Arevalo, H.A.; Qureshi, J.A.; Jones, M.M.; Hendricks, K.; Roberts, P.D.; Roka, F.M. Vector control and foliar nutrition to maintain economic sustainability of bearing citrus in Florida groves affected by huanglongbing. Pest. Manag. Sci. 2014, 70, 415–426. [Google Scholar] [CrossRef] [Scilit]
  20. Mann, R.S.; Qureshi, J.A.; Stansly, P.A.; Stelinski, L.L. Behavioral Response of Tamarixia radiata (Waterston) (Hymenoptera: Eulophidae) to Volatiles Emanating from Diaphorina citri Kuwayama (Hemiptera: Psyllidae) and Citrus. J. Insect. Behav. 2010, 23, 447–458. [Google Scholar] [CrossRef] [Scilit]
  21. Hunter, W.B.; Glick, E.; Paldi, N.; Bextine, B.R. Advances in RNA interference: dsRNA Treatment in Trees and Grapevines for Insect Pest Suppression. Southwest Entomol. 2012, 37, 85–87. [Google Scholar] [CrossRef] [Scilit]
  22. Qureshi, J.A.; Stansly, P.A. Asian Citrus Psyllid: Biology, Ecology and Management of the Huanglongbing Vector; Qureshi, J.A., Stansly, P.A., Eds.; CABI Press: Boston, MA, USA, 2020. [Google Scholar]
  23. Hunter, W.B.; Reese, J.; Consortium, I.P.G. The Asian Citrus Psyllid Genome (Diaphorina citri, Hemiptera). J. Citrus Pathol. 2014, 1. [Google Scholar] [CrossRef] [Scilit]
  24. Reese, J.; Christenson, M.K.; Leng, N.; Saha, S.; Cantarel, B.; Lindeberg, M.; Tamborindeguy, C.; MacCarthy, J.; Weaver, D.; Trease, A.J.; et al. Characterization of the Asian Citrus Psyllid Transcriptome. J. Genom. 2014, 2, 54–58. [Google Scholar] [CrossRef] [Scilit]
  25. Saha, S.; Hosmani, P.S.; Villalobos-Ayala, K.; Miller, S.; Shippy, T.; Flores, M.; Rosendale, A.; Cordola, C.; Bell, T.; Mann, H.; et al. Improved annotation of the insect vector of citrus greening disease: Biocuration by a diverse genomics community. Database J. Biol. Databases Curation 2017, 2017, bax032. [Google Scholar] [CrossRef] [Scilit]
  26. Killiny, N.; Hajeri, S.; Tiwari, S.; Gowda, S.; Stelinski, L.L. Double-Stranded RNA Uptake through Topical Application, Mediates Silencing of Five CYP4 Genes and Suppresses Insecticide Resistance in Diaphorina citri. PLoS ONE 2014, 9, e0110536. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Yu, X.D.; Killiny, N. Effect of silencing a boule homologue on the survival and reproduction of Asian citrus psyllid Diaphorina citri. Physiol. Entomol. 2018, 43, 268–275. [Google Scholar] [CrossRef] [Scilit]
  28. Yu, X.D.; Killiny, N. Effect of parental RNA interference of a transformer-2 homologue on female reproduction and offspring sex determination in Asian citrus psyllid. Physiol. Entomol. 2018, 43, 42–50. [Google Scholar] [CrossRef] [Scilit]
  29. Yu, X.D.; Killiny, N. RNA interference of two glutathione S-transferase genes, Diaphorina citri DcGSTe2 and DcGSTd1, increases the susceptibility of Asian citrus psyllid (Hemiptera: Liviidae) to the pesticides fenpropathrin and thiamethoxam. Pest. Manag. Sci. 2018, 74, 638–647. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Killiny, N.; Kishk, A. Delivery of dsRNA through topical feeding for RNA interference in the citrus sap piercing-sucking hemipteran, Diaphorina citri. Arch. Insect Biochem. Physiol. 2017, 95, e21394. [Google Scholar] [CrossRef] [Scilit]
  31. Yu, X.; Gowda, S.; Killiny, N. Double-stranded RNA delivery through soaking mediates silencing of the muscle protein 20 and increases mortality to the Asian citrus psyllid, Diaphorina citri. Pest. Manag. Sci. 2017, 73, 1846–1853. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  32. Hunter, W.B.; Sinisterra-Hunter, X.H. Chapter Six—Emerging RNA Suppression Technologies to Protect Citrus Trees from Citrus Greening Disease Bacteria. In Advances in Insect Physiology; Smagghe, G., Ed.; Academic Press: London, UK, 2018; Volume 55, pp. 163–197. [Google Scholar]
  33. El-Shesheny, I.; Hajeri, S.; El-Hawary, I.; Gowda, S.; Killiny, N. Silencing Abnormal Wing Disc Gene of the Asian Citrus Psyllid, Diaphorina citri Disrupts Adult Wing Development and Increases Nymph Mortality. PLoS ONE 2013, 8, e0065392. [Google Scholar] [CrossRef] [Scilit]
  34. Hajeri, S.; Killiny, N.; El-Mohtar, C.; Dawson, W.O.; Gowda, S. Citrus tristeza virus-based RNAi in citrus plants induces gene silencing in Diaphorina citri, a phloem-sap sucking insect vector of citrus greening disease (Huanglongbing). J. Biotechnol. 2014, 176, 42–49. [Google Scholar] [CrossRef] [Scilit]
  35. Santos-Ortega, Y.; Killiny, N. Silencing of sucrose hydrolase causes nymph mortality and disturbs adult osmotic homeostasis in Diaphorina citri (Hemiptera: Liviidae). Insect Biochem. Mol. Biol. 2018, 101, 131–143. [Google Scholar] [CrossRef] [Scilit]
  36. Kishk, A.; Hijaz, F.; Anber, H.A.I.; AbdEl-Raof, T.K.; El-Sherbeni, A.D.; Hamed, S.; Killiny, N. RNA interference of acetylcholinesterase in the Asian citrus psyllid, Diaphorina citri, increases its susceptibility to carbamate and organophosphate insecticides. Pestic. Biochem. Physiol. 2017, 143, 81–89. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Tsai, J.H.; Liu, Y.H. Biology of Diaphorina citri (Homoptera: Psyllidae) on Four Host Plants. J. Econ. Entomol. 2000, 93, 1721–1725. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Blum, M.S.; Hilker, M. Chemical Protection of Insect Eggs. In Chemoecology of Insect Eggs and Egg Deposition; Hilker, M., Meiners, T., Eds.; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2003; pp. 61–90. [Google Scholar]
  39. Bomfim, L.; Vieira, P.; Fonseca, A.; Ramos, I. Eggshell ultrastructure and delivery of pharmacological inhibitors to the early embryo of R. prolixus by ethanol permeabilization of the extraembryonic layers. PLoS ONE 2017, 12, e0185770. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  40. Wigglesworth, V.B.; Beament, J.W.L. The Respiratory Mechanisms of Some Insect Eggs. Q. J. Microsc. Sci. 1950, 3, 429–452. [Google Scholar]
  41. Kumari, A.; Kaushik, N. Oviposition Deterrents in Herbivorous Insects and their potential use in Integrated Pest Management. Indian J. Exp. Biol. 2016, 54, 163–174. [Google Scholar]
  42. Roy, A.S.; Ghosh, D. Chorion is a complex structure of protein and polysaccharide—A microscopical study in Oxya hyla hyla (Orthoptera: Acrididae). J. Entomol. Zool. Studies 2014, 2, 144–150. [Google Scholar]
  43. Hunter, W.B.; Gonzalez, M.T.; Tomich, J. BAPC-assisted-CRISPR-Cas9 Delivery into Nymphs and Adults for Heritable Gene Editing (Hemiptera). FASEB J. 2019, 33, 626-2. [Google Scholar] [CrossRef] [Scilit]
  44. Hunter, W.B.; Gonzalez, M.T.; Tomich, J. BAPC-assisted CRISPR/Cas9 System: Targeted Delivery into Adult Ovaries for Heritable Germline Gene Editing (Arthropoda: Hemiptera). bioRxiv 2018. [Google Scholar] [CrossRef] [Scilit]
  45. Santos-Ortega, Y.; Killiny, N. In vitro egg hatching of Diaphorina citri, the vector of Huanglongbing. Entomol. Exp. Appl. 2020, in press. [Google Scholar] [CrossRef] [Scilit]
  46. Lu, Z.; Hu, H.; Killiny, N. Proteomic maps of subcellular protein fractions of the Asian citrus psyllid Diaphorina citri, the vector of citrus huanglongbing. Physiol. Entomol. 2017, 42, 36–64. [Google Scholar] [CrossRef] [Scilit]
  47. Yu, X.D.; Killiny, N. The secreted salivary proteome of Asian citrus psyllid Diaphorina citri. Physiolog. Entomol. 2018, 43, 324–333. [Google Scholar] [CrossRef] [Scilit]
  48. Zhang, T.; Chhajed, S.; Schneider, J.D.; Feng, G.; Song, W.-Y.; Chen, S. Proteomic characterization of MPK4 signaling network and putative substrates. Plant. Mol. Biol. 2019, 101, 325–339. [Google Scholar] [CrossRef] [Scilit]
  49. Nesvizhskii, A.I.; Keller, A.; Kolker, E.; Aebersold, R. A Statistical Model for Identifying Proteins by Tandem Mass Spectrometry. Anal. Chem. 2003, 75, 4646–4658. [Google Scholar] [CrossRef] [Scilit]
  50. Kerkut, G.A.; Gilbert, L.I. Regulation: Digestion, Nutrition, Excretion. In Comprehensive Insect Physiology, Biochemistry, and Pharmacology; Kerkut, G.A., Gilbert, L.I., Eds.; Pergamon Press: Oxford, UK, 1985; Volume 4. [Google Scholar]
  51. Amenya, D.A.; Chou, W.; Li, J.; Yan, G.; Gershon, P.D.; James, A.A.; Marinotti, O. Proteomics reveals novel components of the Anopheles gambiae eggshell. J. Insect Physiol. 2010, 56, 1414–1419. [Google Scholar] [CrossRef] [Scilit]
  52. Margaritis, L.H. The egg-shell of Drosophila melanogaster III. Covalent crosslinking of the chorion proteins involves endogenous hydrogen peroxide. Tissue Cell 1985, 17, 553–559. [Google Scholar] [CrossRef] [Scilit]
  53. Gundappa; Shashank, P.R.; Bollineni, H. Insect proteomics: Present and future perspective. Curr. Biotica 2014, 7, 336–342. [Google Scholar]
  54. Marinotti, O.; Ngo, T.; Kojin, B.B.; Chou, S.P.; Nguyen, B.; Juhn, J.; Carballar-Lejarazu, R.; Marinotti, P.N.; Jiang, X.F.; Walter, M.F.; et al. Integrated proteomic and transcriptomic analysis of the Aedes aegypti eggshell. BMC Dev. Biol. 2014, 14, 15. [Google Scholar] [CrossRef] [Scilit]
  55. Zhu, Q.; Deng, Y.; Vanka, P.; Brown, S.J.; Muthukrishnan, S.; Kramer, K.J. Computational identification of novel chitinase-like proteins in the Drosophila melanogaster genome. Bioinformatics 2004, 20, 161–169. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Intra, J.; Cenni, F.; Pavesi, G.; Pasini, M.; Perotti, M.E. Interspecific Analysis of the Glycosidases of the Sperm Plasma Membrane in Drosophila. Mol. Reprod. Dev. 2009, 76, 85–100. [Google Scholar] [CrossRef] [Scilit]
  57. Tajiri, R.; Ogawa, N.; Fujiwara, H.; Kojima, T. Mechanical Control of Whole Body Shape by a Single Cuticular Protein Obstructor-E in Drosophila melanogaster. PLoS Genet. 2017, 13, e1006548. [Google Scholar] [CrossRef] [Scilit]
  58. Kriventseva, E.V.; Kuznetsov, D.; Tegenfeldt, F.; Manni, M.; Dias, R.; Simao, F.A.; Zdobnov, E.M. OrthoDB v10: Sampling the diversity of animal, plant, fungal, protist, bacterial and viral genomes for evolutionary and functional annotations of orthologs. Nucleic Acids Res. 2019, 47, D807–D811. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Tufail, M.; Takeda, M. Insect vitellogenin/lipophorin receptors: Molecular structures, role in oogenesis, and regulatory mechanisms. J. Insect Physiol. 2009, 55, 88–104. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Upadhyay, S.K.; Singh, H.; Dixit, S.; Mendu, V.; Verma, P.C. Molecular Characterization of Vitellogenin and Vitellogenin Receptor of Bemisia tabaci. PLoS ONE 2016, 11, e0155306. [Google Scholar] [CrossRef] [Scilit]
  61. Lou, Y.H.; Pan, P.L.; Ye, Y.X.; Cheng, C.; Xu, H.J.; Zhang, C.X. Identification and functional analysis of a novel chorion protein essential for egg maturation in the brown planthopper. Insect. Mol. Biol. 2018, 27, 393–403. [Google Scholar] [CrossRef] [Scilit]
  62. Miao, Y.T.; Deng, Y.; Jia, H.K.; Liu, Y.D.; Hou, M.L. Proteomic analysis of watery saliva secreted by white-backed planthopper, Sogatella furcifera. PLoS ONE 2018, 13, e0193831. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Tetley, R.J.; Blanchard, G.B.; Fletcher, A.G.; Adams, R.J.; Sanson, B. Unipolar distributions of junctional Myosin II identify cell stripe boundaries that drive cell intercalation throughout Drosophila axis extension. Elife 2016, 5, e12094. [Google Scholar] [CrossRef] [Scilit]
  64. Gur, G.; Rubin, C.; Katz, M.; Amit, I.; Citri, A.; Nilsson, J.; Amariglio, N.; Henriksson, R.; Rechavi, G.; Hedman, H.; et al. LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation. EMBO J. 2004, 23, 3270–3281. [Google Scholar] [CrossRef] [Scilit]
  65. Lindquist, D.; Kvarnbrink, S.; Henriksson, R.; Hedman, H. LRIG and cancer prognosis. Acta Oncol. 2014, 53, 1135–1142. [Google Scholar] [CrossRef] [Scilit]
  66. Alon, M.; Elbaz, M.; Ben-Zvi, M.M.; Feldmesser, E.; Vainstein, A.; Morin, S. Insights into the transcriptomics of polyphagy: Bemisia tabaci adaptability to phenylpropanoids involves coordinated expression of defense and metabolic genes. Insect Biochem. Mol. Biol. 2012, 42, 251–263. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  67. Chaturvedi, D.; Inaba, M.; Scoggin, S.; Buszczak, M. Drosophila CG2469 Encodes a Homolog of Human CTR9 and Is Essential for Development. G3-Genes Genomes Genet. 2016, 6, 3849–3857. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Xia, X.F.; You, M.S.; Rao, X.J.; Yu, X.Q. Insect C-type lectins in innate immunity. Develop. Comp. Immunol. 2018, 83, 70–79. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Hilker, M.; Fatouros, N.E. Plant Responses to Insect Egg Deposition. Annu. Rev. Entomol. 2015, 60, 493–515. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  70. Ammar, E.D.; Ramos, J.E.; Hall, D.G.; Dawson, W.O.; Shatters, R.G. Acquisition, Replication and Inoculation of Candidatus Liberibacter asiaticus following Various Acquisition Periods on Huanglongbing-Infected Citrus by Nymphs and Adults of the Asian Citrus Psyllid. PLoS ONE 2016, 11, e0159594. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. Chorion proteins of Diaphorina citri. (A) Egg hatching and recovery of chorion from the artificial medium. (B) Putative biological functions of D. citri eggshell proteins. The 51 D. citri chorion proteins were classified according to their biological activities using the UniProt browser for gene ontology terms and annotations and the SMART domain http://smart.embl-heidelberg.de/ accessed on 19 September 2021.
Figure 1. Chorion proteins of Diaphorina citri. (A) Egg hatching and recovery of chorion from the artificial medium. (B) Putative biological functions of D. citri eggshell proteins. The 51 D. citri chorion proteins were classified according to their biological activities using the UniProt browser for gene ontology terms and annotations and the SMART domain http://smart.embl-heidelberg.de/ accessed on 19 September 2021.
Insects 12 00959 g001
Table 1. Proteins identified from Diaphorina citri chorion.
Table 1. Proteins identified from Diaphorina citri chorion.
Identified ProteinAccession NumberM.W.
(kDa)
PeptidesCoverage (%)Biological Activity
Vitellogenin-1-like VWFD domainA0A1S3DT76_DIACI63(R)SEKEDPAMQIAAEAMWGENAQSGAK(I)
(R)KQYIANHPQAEQCR(K)
(R)LMVVEQGNQLCFSTK(A)
11.10Homeostasis
Vitellogenin-2-like VWFD domainA0A3Q0J6A6_DIACI52(R)ASSAIPSTPSK(N)
(R)SEKEDPAMQIAAEAMWGENAQSGAK(I)
(R)KQYIANHPQAEQCR(K)
10.80Homeostasis
Vitellogenin-A1-like VTG domainA0A3Q0JK51_DIACI170(R)TLAALHDVADQYTGTIIK(A)
(R)NQDSVLAWVTNAR(H)
(K)NLQVSQNLPTWELNIIK(S)
(K)GSNGDLIDIIK(T)
(K)FTILAGVIR(T)
4.44Source of nutrients
Vitellogenin-likeLOC103523837A0A1S4ERJ7_DIACI64(K)IAQMLNIK(R)
(K)YFQVNIPIK(A)
2.94Lipid transport
LOW QUALITY PROTEIN: probable
chitinase 10 GH18 family
A0A3Q0JIK7_DIACI306(K)KESCAPGLHWNK(V)
(R)SFLICSHGNLLK(Q)
(K)QSCGPSLLWNAK(K)
(R)IGPYAYSDNQWVGYDDVDMIR(T)
(K)SMNLGGGMIWALDLDDFK(N)
(R)AAFNPHDLLLSAAVSPSK(A)
(R)GFLAYYEICDK(I)
3.84Glycosyl hydrolases
Histone acetyltransferase p300A0A1S4EH08_DIACI30(K)TNGPHIYSAQATQYSGPQQTWADLQSSPVVILVK(N)
(K)LLLQNNDK(V)
(K)VGILYPTNAFPVNSFPDFPVGNLILPQDMSLSK(I)
27.60Transferase activity
Cluster of golgin subfamily A member 4-like LOC103519497A0A3Q0JE54_DIACI180(R)LEAETNLEKSLEQKNR(E)
(R)SNNEIDLDMELVIDKFKALQTQMK(T)
2.59Gene expression
regulation
Golgin subfamily A member 4-like LOC103510159A0A3Q0IWE5_DIACI192(K)VGILYPTNAFPVNSFPDFPVGNLILPQDMSLSK(I)
(R)SNNEIDLDMELVIDKFKALQTQMK(T)
0.96Gene expression
regulation
Endochitinase LOC103505867
GH18 family
A0A3Q0IKI3_DIACI68(R)GNWAGFADVHSPLYK(R)
(R)SFTLSSGNNNYNIGTYINK(E)
(K)MSVCDWPEKVDVTR(C)
8.00Glycosyl hydrolases
LOW QUALITY PROTEIN myosin-II-like LOC103524911A0A3Q0IIF7_DIACI151(R)SDSLTNVLNTTSSLNSSSLSNRSLNSSGLSNR(S)
(R)ITRVTNDAPIMEVNSNSLGR(R)
3.91Gene expression
regulation
Epoxide hydrolase 4-like LOC103509850A0A1S3D296_DIACI46(K)VKDERENAPTCLVDNSFGQHLYVK(L)
(K)QVNQQTGLVGKMYGAVSNTVK(Y)
(K)QVNQQTGLVGKMYGAVSNTVKYGNHYK(M)
12.80Hydrolase activity
Dynein heavy chain 2,
axonemal-like LOC103509704
A0A3Q0IU47_DIACI538(K)SETVKDLGKCMAYLVVITNCSDSLDYK(S)
(K)DLGKCMAYLVVITNCSDSLDYKSLAR(M)
(K)VIVEQMKVEMEENQVLVENYKK(E)
1.14Microtubule-based
movement
Odorant binding protein 1A0A2Z2GYV0_DIACI16(K)CKTELNSPPEAVALLGAK(S)
(K)TELNSPPEAVALLGAK(S)
12.20Odorant binding
Voltage-dependent calcium channel VWA domain LOC103507125A0A1S4E906_DIACI88(K)EGKLMVSVSTPVFDK(R)
(K)LERHSHFCDKSLVQSLVFDAMVTEGLEHPSAAYLK(G)
6.54Homeostasis
Cuticle protein 7-like LOC103507855A0A1S3CYX2_DIACI15(K)YDFAYDVADSYTGDIK(S)
(R)DGDYVSGYYSLVEADGSK(R)
(R)IVEYTADGYNGFNAVVK(K)
36.70Protection
Carboxypeptidase D-likeLOC103513394A0A3Q0J1P3_DIACI145(K)FLVAAAQQNPSK(V)
(R)DLWALQISR(N)
(R)SVMKVDSIVK(G)
2.38Carboxypeptidaseactivity
Vegetative cell wall protein gp1-like LOC113466980A0A3Q0IQY0_DIACI52(R)IDNDALQSMAAANINAEEVKATGVELLNK(G)
(R)QRKPRSAPSNSPGGSNVR(G)
9.61Structure
Protein obstructor-E-like LOC103517319A0A1S3DGK4_DIACI27(K)NSYYPDSIQCDLYYHCSDGQLVEEK(L)
(R)CDTNVNVECGER(T)
15.00Chitin-binding
Wiskott-Aldrich syndrome protein family member 2 LOC103507255A0A3Q0INT8_DIACI22(K)CITTAEYNPQCGTDGQDYSNPGR(V)
(K)VVEIEFPGVCK(S)
15.70Protease inhibitor
Alpha-mannosidase LOC103513787A0A3Q0J7L7_DIACI120(R)EQASLFSQMGYDGFMFGR(Q)
(R)SSGAYIFR(N)
2.46Glycosidase activity
Glutamic acid-rich protein LOC103510883A0A1S4EDL9_DIACI101(K)EKGNDSQSSLTRK(G)
(K)SQNKRESAEILEK(E)
2.88Other
Aminopeptidase LOC103519822A0A3Q0JIL4_DIACI92(K)EIMDSWTLQTGYPIVDVTR(E)
(K)KENGEIELNSRDEKPIVSGGGGSGNTR(N)
5.75Aminopeptidase activity
Leucine-rich repeats and immunoglobulin-like domains protein 1 LOC103522720A0A1S3DQ23_DIACI60(K)TQCQIFGLNSTLRIYLEGNPVLCDDSMR(A)
(R)IYLEGNPVLCDDSMRAVIDAMETINNNTK(I)
7.89Immune response
Apoptosis-inducing factor 1, mitochondrial LOC103519937A0A1S4ENS9_DIACI81(R)SSAAQEESTKTTAVTK(V)
(R)RVEHHDHAVVSGRLAGENMTGAHK(H)
5.45Oxyreductase activity
Ecotropic viral integration site 5 ortholog-like LOC103504936A0A3Q0IJ13_DIACI81(R)HLRSLVEANHNSCQSSMDEASLSK(E)
(R)LKVIEVETRADDVNPDK(K)
5.86GTPase-activity
Ubiquilin-1 LOC103506324A0A3Q0ILW3_DIACI39(R)ALSNLESIPGGYSALQR(M)
(R)DIQEPMLNAATQQFSR(N)
9.35Cellular processes
RNA polymerase-associated protein CTR9 homolog LOC103509140A0A3Q0ISU5_DIACI158(K)EEYFLKANTLYTTGDK(I)
(K)AQPGNYETMKILGSLYANSSSQSKR(D)
2.95Cellular processes
Chitooligosaccharidolytic beta-N- acetylglucosaminidase-like LOC103512791A0A3Q0J0G8_DIACI38(K)LLDQTSLNISNNPELK(S)
(K)SLIMGQEAALWSEQADAATLDGR(L)
11.70Hydrolase activity
Protein BTG2-like LOC103513815A0A3Q0J2K8_DIACI24(-)MQDQISAAVLFLAK(L)
(K)KDTILENAAKAVGMSYEDMR(L)
16.30Other
Zinc finger homeobox protein 3-like LOC113472870A0A3Q0JJ91_DIACI85(R)LLMLVDQSHWLNTVSRPSNANQQSSSESSSASKHEK(S)
(K)KMIQDILTGSSAVQK(S)
6.86Nucleic acid-binding protein
Alpha-galactosidase LOC103508314A0A1S4EAR0_DIACI17(R)CNTDCDNYPDECISENLFK(R)
(R)CNTDCDNYPDECISENLFKR(M)
13.70Hydrolase activity
Uncharacterized protein LOC103507240A0A1S3CXQ3_DIACI16(R)DFPGMCFASTK(C)
(R)LLELVEDCGPLPK(A)
(K)TAPFPDCCPTFECEPGVK(L)
43.40Environmental
challenges
Uncharacterized protein LOC103519250A0A1S3DJY7_DIACI44(K)NESSNGSTVNSPVAQAKPK(G)
(K)GLAVAGEGGVADSSPSGTALVGK(K)
10.30Uncharacterized
Uncharacterized protein LOC103508449A0A1S3CZS7_DIACI15(R)RNLPNAYNLCEPETQVCTR(Y)
(R)NLPNAYNLCEPETQVCTR(Y)
(K)QATAICGPSYVDKLVDFK(T)
27.60Uncharacterized
Uncharacterized protein LOC103512175A0A1S4EEU2_DIACI38(R)GSYSYVAPDGTPIK(V)
(R)GSYSYVAPDGTPIKVVYTSGR(E)
5.80Structure
Uncharacterized protein LOC113467831A0A3Q0IZD8_DIACI10(K)FAQDCDADGQIDCR(D)
(R)LGGYGCNAPLDATYLAR(F)
33.00Immune response
Uncharacterized protein LOC103507653A0A1S3CZP5_DIACI56(K)GNQVNGVRENEDLIDVTSNHVNK(L)
(R)AQMIYLQTELASAQNSGILPFDDSAK(N)
9.92Uncharacterized
Uncharacterized protein LOC103513825A0A1S3D966_DIACI11(R)QAQNTQLIPQGAEIQKVQEGIELAAFESIPGNQR(I)
(K)VQEGIELAAFESIPGNQR(I)
34.00Uncharacterized
Uncharacterized protein LOC103518044A0A3Q0JFF5_DIACI428(R)AIGQDCTVTK(S)
(R)QESIQGFCCPR(Y)
(K)QLGCLVEGQTYMVGEK(V)
0.91Homeostasis
VWFC domain
Uncharacterized protein LOC103505974A0A3Q0IQQ7_DIACI91(K)DTEVDRVQK(S)
(K)QLDQAAKEIEELKSENQIMK(R)
3.64Peptidase activity
Uncharacterized protein LOC103513107A0A1S3D7M4_DIACI136(K)VDNSPNRTQYGELLK(T)
(R)QNTINIAKLGGIESPEKDELK(N)
3.00Uncharacterized
Uncharacterized protein LOC113468219A0A3Q0IX19_DIACI)113(K)CVKTTKMLPGGQK(K)
(K)FKSRGLLGDNGFQSGGLLDDK(D)
3.43Uncharacterized
Uncharacterized protein LOC103506631A0A3Q0ISV1_DIACI30(K)IVTSTGGLPPQFVNPK(S)
(R)SQVCIAHGPYAAIPGINEWCETNCLR(F)
15.60Uncharacterized
Uncharacterized protein LOC103512422A0A1S3D6F7_DIACI22(R)SLEVDWLDAR(N)
(R)NTGDWSATGGFGQAQPDNR(E)
14.70Calcium-dependent carbohydrate-recognition domain
Uncharacterized protein LOC103516159A0A1S3DEF2_DIACI12(K)EVTQLASSIAPFSDPTICDDPFKCDEDTIIPDTICGK(L)
(K)LYTTAGNGLR(I)
43.90Uncharacterized
Uncharacterized protein LOC103516900A0A1S3DFS2_DIACI51(K)DVEFVCPDEGGNGNYADPSTCR(R)
(K)SETAPLEACNLPNK(C)
7.95Chitin binding
Uncharacterized protein LOC103519755A0A1S3DJA9_DIACI36(K)VAKPSYVVQEQVIPVQKPAYVIEEAVEK(V)
(K)VTKPAFVVETIVETVPVPEFK(L)
14.90Uncharacterized
Uncharacterized protein LOC103506731A0A3Q0ISB2_DIACI21(R)SIGLQLTSFESR(E)
(K)SDSITQYLTNAGYNK(Y)
14.60Calcium-dependent carbohydrate-recognition domain
Uncharacterized protein LOC103509128A0A3Q0IST9_DIACI233(R)STDGKNQRPSALPSAMAPNKLDSDR(R)
(R)QIHVMLHAFIREGGAVLQMQQESR(L)
2.34Actin binding
Uncharacterized protein LOC103509950A0A3Q0IUI2_DIACI86(K)SDFVQNDGSAGKFGAGDSRSK(D)
(R)TPLERTSASGASQSPMSINKATNINR(M)
5.84Uncharacterized
Uncharacterized protein LOC103512184A0A3Q0J4A1_DIACI149(K)NQVMYKPDIPSGGSLSSLPIYAEVNK(K)
(K)VKDIDQLSTTSNNSNINVFIVNKR(S)
3.72Uncharacterized
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Santos-Ortega, Y.; Killiny, N. The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects 2021, 12, 959. https://doi.org/10.3390/insects12110959

AMA Style

Santos-Ortega Y, Killiny N. The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects. 2021; 12(11):959. https://doi.org/10.3390/insects12110959

Chicago/Turabian Style

Santos-Ortega, Yulica, and Nabil Killiny. 2021. "The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus" Insects 12, no. 11: 959. https://doi.org/10.3390/insects12110959

APA Style

Santos-Ortega, Y., & Killiny, N. (2021). The Chorion Proteome of Diaphorina citri, the Vector of Huanglongbing Disease in Citrus. Insects, 12(11), 959. https://doi.org/10.3390/insects12110959

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop