Next Article in Journal
Marker-Assisted Backcross Breeding for Improving Bruchid (Callosobruchus spp.) Resistance in Mung Bean (Vigna radiata L.)
Next Article in Special Issue
The Impact of Cell Wall Feruloylation on Plant Growth, Responses to Environmental Stress, Plant Pathogens and Cell Wall Degradability
Previous Article in Journal
Soil Waterlogging Conditions Affect Growth, Water Status, and Chlorophyll “a” Fluorescence in Coffee Plants (Coffea arabica L.)
Previous Article in Special Issue
Tomato Graft Union Failure Is Associated with Alterations in Tissue Development and the Onset of Cell Wall Defense Responses
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

OsVTC1-1 RNAi Mutant with Reduction of Ascorbic Acid Synthesis Alters Cell Wall Sugar Composition and Cell Wall-Associated Proteins

by
Kanyanat Lamanchai
1,
Deborah L. Salmon
2,
Nicholas Smirnoff
2,
Pornsawan Sutthinon
3,
Sittiruk Roytrakul
4,
Kantinan Leetanasaksakul
4,
Suthathip Kittisenachai
4 and
Chatchawan Jantasuriyarat
1,5,*
1
Department of Genetics, Faculty of Science, Kasetsart University, Chatuchak, Bangkok 10900, Thailand
2
Biosciences, College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QD, UK
3
Department of Botany, Faculty of Science, Kasetsart University, Chatuchak, Bangkok 10900, Thailand
4
Functional Proteomics Technology, National Center for Genetic Engineering and Biotechnology, National Science and Technology Development Agency, 113 Paholyothin Road, Klong 1, Klong Luang, Pathumthani 12120, Thailand
5
Center for Advanced Studies in Tropical Natural Resources, National Research University-Kasetsart University (CASTNAR, NRU-KU), Kasetsart University, Chatuchak, Bangkok 10900, Thailand
*
Author to whom correspondence should be addressed.
Agronomy 2022, 12(6), 1272; https://doi.org/10.3390/agronomy12061272
Submission received: 14 April 2022 / Revised: 24 May 2022 / Accepted: 24 May 2022 / Published: 26 May 2022
(This article belongs to the Special Issue Advances in Cell Wall Research of Crop Plants)

Abstract

Ascorbic acid (AsA) or Vitamin C is an antioxidant molecule and plays an important role in many biological processes in plants. GDP-D-mannose pyrophosphorylase (GMP or VTC1) catalyzes the synthesis of GDP-D-mannose, which is a precursor for AsA production and is used for cell wall polysaccharide and glycoprotein synthesis. In rice, the OsVTC1 gene consists of three homologs, including OsVTC1-1, OsVTC1-3 and OsVTC1-8. In this study, we characterized wild type (WT) and OsVTC1-1 RNAi lines (RI1-2 and RI1-3) and showed that the transcript levels of most genes in the AsA synthesis pathway, AsA content and leaf anatomical parameters in RNAi lines were reduced, revealing that OsVTC1-1 is involved in AsA synthesis. To further study the role of OsVTC1-1 gene, cell wall monosaccharide composition, transcriptome and proteome were compared, with specific attention paid to their wild type and OsVTC1-1 RNAi lines. Mannose and galactose composition (mole%) were decreased in OsVTC1-1 RNAi lines. Additionally, reduction of cell wall-associated proteins, such as kinesin, expansin, beta-galactosidase and cellulose synthase were observed in OsVTC1-1 RNAi lines. Our results suggest that OsVTC1-1 gene plays an important role in AsA synthesis and in cell wall-related processes.

1. Introduction

Ascorbic acid (AsA), or vitamin C, is a strong antioxidant molecule. AsA is required for multiple biological functions, for instance, the cofactors for enzyme activity, cell division, cross-linking of cell wall protein, photosynthesis, biotic and abiotic stresses and defense response [1,2,3,4]. Plants synthesize AsA mainly in photosynthetic tissues through the Smirnoff-Wheeler pathway via L-galactose [5,6]. There are several enzymes in the Smirnoff-Wheeler pathway, starting with phosphoglucose isomerase (PGI), which converts D-glucose-6-phosphate to D-fructose-6-phosphate, followed by phosphomannose isomerase (PMI), which converts D-fructose-6-phosphate to D-mannose-6-phosphate. Phosphomannose mutase (PMM), GDP-mannose pyrophosphorylase (GMP or VTC1), GDP-mannose-3′,5′-epimerase (GME), GDP-L-galactose phosphorylase (GGP or VTC2), L-galactose-1-phosphate phosphatase (GPP or VTC4), L-galactose dehydrogenase (GDH) and L-galactono-1,4-lactone dehydrogenase (GLDH) are sequentially catalyzed into the final product, L-ascorbic acid [5]. Rice genomes contain one copy of OsVTC2, OsVTC4 and OsGDH genes, but two copies of OsGME and OsGLDH and three copies of the OsVTC1 gene [6]. GDP-D-mannose pyrophosphorylase (GMP or VTC1) is required for the conversion of D-mannose-1-phosphate to GDP-D-mannose [7]. Among three homologs of rice OsVTC1, OsVTC1-1 is associated with the greatest AsA production in rice leaves, whereas OsVTC1-3 plays a role in AsA synthesis in roots. OsVTC1-8 may not be involved in AsA synthesis in both leaves and roots [8]. vtc1 mutants have been broadly used to study functional roles in plants. In Arabidopsis, vtc1 mutant has a smaller cell size than in the wild type [9]. Similarly, vtc1 mutant exhibited reduced shoot growth and delayed flowering, supporting the idea that AsA is required for normal plant growth and development [10]. The VTC1 gene is also involved in abiotic stress response. OsVTC1-1 RNAi rice, which decreases the expression of the OsVTC1-1 gene, exhibits reduced salt tolerance at both seedling and reproductive stages [11]. These reports indicate that the VTC1 gene plays multiple roles in plants.
Two intermediates of the Smirnoff-Wheeler pathway, GDP-D-mannose and GDP-L-galactose, are also precursors of the non-cellulosic components of the plant cell wall. GDP-mannose-3′,5′-epimerase (GME) catalyzes the synthesis of GDP-L-galactose, a precursor for both AsA and cell wall polysaccharides synthesis [3]. GME was revealed to be involved in plant growth, leaf senescence and tolerance to acid, drought and salt in Arabidopsis [12,13]. VTC2 catalyzes the conversion of GDP-L-galactose to L-galactose-1-phosphate. This step is the first rate-determining step in AsA synthesis [14]. Next, VTC4, GDH and GLDH catalyze the formation of AsA via sugar intermediates, including L-galactose and L-galactono-1,4-lactone [5]. The role of these enzymes has been reported in many studies. For example, VTC2 plays a role in salt tolerance in rice [15]. The bacterium Pseudomonas syringae infection is restricted in vtc2 mutant of Arabidopsis, indicating that VTC2 involves in defense response [9]. VTC4 is a bifunctional enzyme that affects the synthesis of both AsA and myo-inositol [16]. Moreover, glutathione peroxidases (GPX) is an antioxidation enzyme that reduces hydrogen peroxide (H2O2) to water against oxidative damage [17]. In this reaction, H2O2 is detoxified by GPX using hydrogens from reduced glutathione (GSH) resulting in water and oxidized glutathione (GSSG) that associates with the ascorbate-glutathione (ASA-GSH) cycle [18]. Due to antioxidant activity, GPX plays an essential role in various abiotic stress responses and defense mechanisms in plants [19].
Plant cell walls are important in their development and for environmental responses [20]. Cell wall polysaccharides, mainly contain of cellulose, hemicellulose and pectin, are built up of sugars by glycosidic linkages to form polymers [21]. Cellulose, a main component of the plant cell wall, is composed of β-(1,4)-D-Glucose residues [22]. Cellulose is synthesized by cellulose synthase complex that composed of different cellulose synthase (CESA) proteins [23]. Hemicellulose is composed of several different types of sugars. For example, Glucuronoxylan contains xylose and glucuronic acid (GlcA), and Galactomannan consists of mannose and galactose. The xylose backbone with arabinose is polymerized to arabinoxylan [24,25]. Pectin is mostly consisted of galacturonic acid (GalA) residues. It can be divided into different types, including homogalacturonan, xylogalacturonan, apiogalacturonan, rhamnogalacturonan I and rhamnogalacturonan II (RGII) [26]. The side chain of RGII consists of arabinose, apiose, fucose, galactose, rhamnose, aceric acid, glucuronic acid and xylose [27]. The plant cell wall is comprised of several different monosaccharides. In summary, mannose and galactose are required for both AsA synthesis as well as cell wall formation [7]. In this study, we examined the expression level of genes in the AsA synthesis pathway, AsA content, leaf anatomical structure and the monosaccharide composition of cell walls between wild type (WT) and OsVTC1-1 RNAi lines. Transcriptome and proteome techniques were also used to analyze and compare genes and proteins between WT and OsVTC1-1 RNAi lines. We confirmed that AsA synthesis genes and AsA content in OsVTC1-1 RNAi lines are lower than in wild type. Moreover, mannose and galactose composition as a percent mole of total sugars were significantly decreased in OsVTC1-1 RNAi lines. Genes and proteins were differentially expressed, especially proteins involved in cell wall biosynthesis. Our results suggest that the OsVTC1-1 gene is important in both AsA and cell wall biosynthesis. The obtained information will lead to a better understanding of the role of vitamin C in plants.

2. Materials and Methods

2.1. Plant Materials

Transgenic RNAi rice lines with reduced expression levels of an OsVTC1-1 gene, including RI1-2 and RI1-3 lines, were obtained from Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China. The japonica rice variety Zhonghua17 (ZH17) was used as wild type (WT), representing the genetic background of RNAi mutant lines. Eight rice seeds were germinated in a petri dish filled with moist tissue papers for 4–5 days then transferred to soil in 9 cm diameter plastic pots and placed in the greenhouses at 24 °C with 12-h light/dark cycle and 90% humidity. Three-week-old rice seedlings were used for gene expression analysis, AsA measurement, cell wall sugar composition analysis, transcriptome analysis and proteome analysis, whereas 2-month-old rice plants were used for anatomical observation. Moreover, the AsA contents in whole leaf and different parts of the leaf in RNAi lines were measured. Each leaf was equally divided into three parts: the top, middle and base.
For AsA measurement, eight rice seeds of three Thai rice varieties “Jao Hom Nin” (JHN), “Khaw Dok Mali 105” (KDML105) and “Gor Kor 6” (RD6) were germinated, grown in Yoshida nutrient solution [28] as modified by Gregorio et al. [29] and cultured in the greenhouse at 30 °C. The first and the second fully expanded leaves, stems and roots of three-week-old rice leaves were collected for AsA measurement. KDML105 was also used to determine the total AsA content in different growth stages including seed, seedling, 3-week-old, 12-week-old and 20-week-old plants. Leaves, stems and roots were separately collected, kept in liquid nitrogen and stored at −80 °C until measurement.

2.2. AsA Biosynthesis Gene Expression Analysis by Real-Time Quantitative PCR (qPCR)

Total RNA was extracted from 3-week-old leaf samples using an RNA extraction kit, according to the manufacturer’s instructions (Vivantis, Selangor, Malaysia). Total RNA was reverse transcribed to cDNA using oligo (dT) primer and M-MLV reverse transcriptase (Promega, Madison, WI, USA). The cDNA was diluted to 1:20 dilution and used as a template for qPCR assay. The reaction was performed with the KAPA SYBR® FAST qPCR Master Mix (2X) (KAPA Biosystems, Wilmington, MA, USA). PCR was performed at 94 °C for 2 min followed by 35 cycles of 94 °C for 15 s, 58 °C for 15 s and 72 °C for 20 s for OsActin (Os03g0718100), OSVTC1-1 (Os01g0847200), OSVTC1-8 (Os08g0237200), OsVTC4 (Os03g0587000), OsGDH (Os12g0482700) and OsGPX1 genes (Os02g0664000). For OsVTC1-3 (Os03g0268400), OsGME1 (Os10g0417600), OsGME2 (Os11g0591100) and OsVTC2 (Os12g0190000) reactions were performed at 94 °C for 2 min followed by 35 cycles of 94 °C for 15 s, 55 °C for 15 s and 72 °C for 20 s. OsActin gene was used as a reference gene and the relative expression levels of each gene were calculated using the 2−∆∆CT method [30]. The data were the mean of two biological replicates with three technical replicates for each sample. The primers used for qPCR were listed in Table 1.

2.3. AsA Content Measurement

Samples (approximately 50 mg fresh weight) were homogenized using a Qiagen TissueLyser with two 3-mm steel beads for 30 s at 30 Hz, turned the blocks around and ground for another 30 s. Samples were added with 1 mL of cold 3% metaphosphoric acid (w/v) and centrifuged at 12,000× g, 4 °C for 10 min; 20 µL of supernatants and AsA standards (0.1–1.0 mM) were transferred to a 96-well UV-transparent microplate and added 2 µL of 10 mM Tris (2-carboxyethyl) phosphine. The microplate was incubated at room temperature for 10 min. Then, 100 µL of 0.2 M pH 7.0 phosphate buffer was added to the microplate, and the absorbance at 265 or 280 nm was recorded. After that, 5 µL ascorbate oxidase (40 units mL−1) was added to the microplate and incubated at room temperature for 10 min. Finally, the absorbance was recorded again. The AsA concentration was calculated from the standard curve. Each experiment was repeated three times.
Another method to measure AsA in Thai rice varieties is described as follows. AsA content measurement was performed as previously described [34]. Samples were ground in liquid nitrogen into a fine powder of approximately 40 mg; 500 µL of 6% Trichloroacetic acid (TCA) (w/v) was added to a 1.5 mL microcentrifuge tube. Samples were centrifuged at 13,000× g, 4 °C for 10 min; 100 µL of supernatants were transferred to new microcentrifuge tubes and kept on ice. Then, 50 µL of 75 mM pH 7.0 phosphate buffer was added to 6% TCA (w/v) (blank), AsA standards (0.1–1.0 mM) and samples; 50 µL of 10 mM DTT was added to all assay tubes and incubated at room temperature for 15 min, and 50 µL of 0.5% NEM (w/v) was added to remove excess dithiothreitol (DTT) and incubated at room temperature for at least 30 s. Then, 250 µL of 10% TCA (w/v), 200 µL of 43% H3PO4 (v/v), 200 µL of 4% 2,2′-bipyridyl (w/v) and 100 µL of 3% FeCl3 (w/v) were added to all assay tubes and incubated at 37 °C for 1 h. Finally, all assay tubes were measured for absorbance by spectrophotometer at 525 nm. AsA concentration was calculated from the standard curve.

2.4. Anatomical Observation of Leaves

Leaf samples of the 2-month-old wild type and OsVTC1-1 RNAi lines were collected and cut into 0.5 cm sections. Samples were fixed in 50% formalin-acetic acid alcohol (FAAII) (v/v) fixative for 12 h, washed three times with 50% ethanol (v/v) for 3 h each and dehydrated with a tertiary butyl alcohol series (TBA) (50%, 70%, 85%, 95% and 100%) (v/v) for 12 h each. The dehydrated samples were infiltrated and embedded in histoplasts (Leica Biosystems, Wetzlar, Germany). The paraffin blocks were cut into sections 15 µm thick using a HistoCore BIOCUT manual rotary microtome (Leica Biosystems, Wetzlar, Germany). Sections were stained with Safranin and Fast green [35]. Photographs were taken using a Leica DM6 B light microscope equipped with a Leica DMC6200 digital camera (Leica Microsystems, Wetzlar, Germany). Ten random sites were photographed in three separate sections. The anatomical data were measured using ImageJ software version 1.53k (Wayne Rasband, National Institutes of Health, Bethesda, MD, USA).

2.5. Cell Wall Sugar Composition Analysis

2.5.1. Cell Wall Preparation

Leaf samples of 3-week-old wild type and OsVTC1-1 RNAi lines, approximately 25 mg, were collected. Leaf samples were snap-frozen in liquid nitrogen and then ground to a fine powder using a Qiagen TissueLyser, as described previously. Plant cell wall preparation was performed using alcohol-insoluble residue (AIR) preparation method according to Conklin et al. [36]. Following this step, ice-cold 80% ethanol (v/v) was added to samples. Then, centrifugation at 12,000× g for 2 min was used to collect insoluble material. The supernatant was discarded and washed three times with 80% ethanol (v/v). Oligosaccharides associated with glycoprotein and polysaccharides in samples were hydrolyzed with 2 M trifluoroacetic acid (TFA) at 110 °C for 1 h. Non-hydrolyzed component was eliminated by centrifugation at 12,000× g for 2 min. The supernatant was evaporated to remove TFA. After hydrolysis, dried samples were added with myo-inositol (5 µM final concentration) and derivatized using methoxyamine hydrochloride dissolved in pyridine, followed by N-Methyl-N-(trimethylsilyl)trifluoroacetamide (MSTFA) (Sigma-Aldrich, St. Louis, MO, USA).
A 25 µM standard mix was prepared to contain D-glucose, D-galactose, D-mannose, D-xylose, D-arabinose, L-fucose, L-rhamnose, D-galacturonic acid, D-glucuronic acid, ribitol and Myo-inositol. This was diluted by half 6 times to a final concentration of 0.39 µM, to produce a calibration curve.

2.5.2. GC-MS Analysis and Data Analysis

The soluble monosaccharide compositions of cell wall samples were analyzed using an Agilent 7200 series-accurate mass Q-TOF GC-MS together with a 7890A GC system (Agilent Technologies, Santa Clara, CA, USA), equipped with an EI (electron ionization) ion source; 0.6 μL of each sample was injected into a non-deactivated, baffled glass liner with a 12:1 split ratio (14.448 mL min−1 split flow) and the inlet temperature was maintained at 250 °C. A Zebron semi-volatile (Phenomenex, Torrance, CA, USA) column (30 m × 250 μm × 0.25 μm), with a 10 m guard column, was maintained at a constant helium flow of 1.2 mL min−1. The temperature gradient of the GC was ramped up at a rate of 15 °C min−1, from 70 °C to 310 °C, over 16 min, and then held at 310 °C for a further 6 min. The total run time of 22 min was followed by a 7 min backflush at 310 °C to clean the column at the end of every run. The MS emission current and emission voltage were held at 35 μA and 70 eV, respectively, and the MS was automatically calibrated after every run. The mass range was set from 50 to 600 amu, with an acquisition rate of 5 spectra s−1, and a solvent delay of 3.5 min.
Data were analyzed using Agilent technologies MassHunter qualitative version B.07.00 and quantitative software version B.08.00 (Agilent Technologies, Santa Clara, CA, USA). Samples were normalized to dry weight and the internal standard, Myo-inositol. Concentrations were calculated from the standard mix calibration curve.

2.6. Transcriptome Analysis

Leaf samples of wild type and OsVTC1-1 RNAi lines were collected and used for RNA extraction by using the GF-1 Total RNA extraction kit (Vivantis, Malaysia). RNA samples were shipped for RNA sequencing (Novogene Bioinformatics Technology Co., Ltd., Beijing, China). Sample integrity was assayed on the Agilent 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA, USA). Library construction and RNA sequencing were pair-end sequenced by Novogene Bioinformatics Technology Co., Ltd., Beijing, China using Illumina Novaseq 6000 platform (Illumina, San Diego, CA, USA).
For data analysis of Illumina sequencing, the quality of the RNA-seq raw data was evaluated using FastQC 0.11.5 (multi-file) app in the CyVerse Discovery Environment (DE) [37]. Low-quality raw reads were removed by Trimmomatic. Then, the clean reads were mapped to the International rice genome sequencing project-1.0 (IRGSP-1.0) using TopHat v2.1.1. To identify the differentially expressed genes (DEGs) between WT and OsVTC1-1 RNAi lines, we used Cuffdiff v.2.2.1 with a false discovery rate (FDR) less than 0.05 [37,38]. The value of Log2FC were used to determine significant differences in gene expression with log2FC > 1 (upregulated genes) or log2FC < −1 (downregulated genes). Gene descriptions of rice DEGs were identified using Gramene (http://www.gramene.org) (accessed on 11 March 2022). Heat map for differential gene expressions was performed using GraphPad Prism version 9.0.0 for Windows (San Diego, CA, USA).

2.7. Proteome Analysis

2.7.1. Protein Extraction

Leaf samples of wild type and OsVTC1-1 RNAi lines were individually ground into powder in a mortar with liquid nitrogen. A total of 0.2 g of powder samples was dissolved in 0.5% SDS (w/v), and then placed in a continuous vortex for 3 h at room temperature. Samples were centrifuged at 8000 rpm for 10 min at room temperature. The supernatant was transferred at a new 1.5 mL centrifuge tube and subsequently mixed with 72% TCA (w/v), and 0.15% deoxycholate (w/v) was added to the samples and vortexed vigorously before placing samples overnight at −20 °C. The mixture was precipitated by centrifugation at 10,000 rpm for 10 min at room temperature and the pellets were washed with cold acetone until the pellet became white. The pellets were resuspended again in 0.5% SDS (w/v). Protein concentration was determined with the Lowry method [39].

2.7.2. Protein Digestion

Protein samples were subjected to in-gel digestion. Samples were completely dissolved in 10 mM ammonium bicarbonate (AMBIC), reduced disulfide bonds using 5 mM dithiothreitol (DTT) in 10 mM AMBIC at 60 °C for 1 h and alkylation of sulfhydryl groups by using 15 mM Iodoacetamide in 10 mM AMBIC at room temperature for 45 min in the dark. For digestion, samples were mixed with 50 ng/µL of sequencing grade trypsin (1:20 ratio) (Promega, Madison, WI, USA) and incubated at 37 °C overnight. Prior to LC-MS/MS analysis, the digested samples must be dried and protonated with 0.1% formic acid (v/v) before injection into LC-MS/MS.

2.7.3. Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS)

The tryptic peptide samples were prepared for injection into an Ultimate3000 Nano/Capillary LC System (Thermo Fisher Scientific, Waltham, MA USA) coupled to a Hybrid quadrupole Q-Tof impact II™ (Bruker Daltonics GmbH, Bremen, Germany) equipped with a Nano-captive spray ion source. Briefly, peptides were enriched on a µ-Precolumn 300 µm i.d. × 5 mm C18 Pepmap 100, 5 µm, 100 A (Thermo Fisher Scientific, Waltham, MA USA), separated on a 75 μm I.D. × 15 cm and packed with Acclaim PepMap RSLC C18, 2 μm, 100 Å, nanoViper (Thermo Fisher Scientific, Waltham, MA USA). Solvents A and B containing 0.1% formic acid (v/v) in water and 0.1% formic acid (v/v) in 80% acetonitrile (v/v), respectively were supplied on the analytical column. A gradient of 5–55% solvent B was used to elute the peptides at a constant flow rate of 0.30 μL/min for 30 min. Electrospray ionization was carried out at 1.6 kV using the CaptiveSpray (Bruker Daltonics GmbH, Bremen, Germany). Mass spectra (MS) and MS/MS spectra were obtained in the positive-ion mode over the range (m/z) 150-2200 (Compass 1.9 software, Bruker Daltonics GmbH, Bremen, Germany).

2.7.4. Protein Identification

The analyzed MS/MS data from LC-MS were measured for peptide MS signal intensities by MaxQuant version 1.6.6.0 (Max-Planck Institute for Biochemistry, Martinsried, Germany), including the in-built andromeda search engine for label-free quantification [40]. The data were searched against the Uniprot database (released date 26 January 2022) for protein identification. Database interrogation was taxonomy (Oryza sativa); enzyme (trypsin); variable modifications (carbamidomethyl, oxidation of methionine residues); mass values (monoisotopic); protein mass (unrestricted); peptide mass tolerance (1.2 Da); fragment mass tolerance (±0.6 Da), peptide charge state (1+, 2+ and 3+) and max missed cleavages. The identified protein was analyzed with the MultiExperiment Viewer software (MeV, version 4.9.0, J. Craig Venter Institute, La Jolla, CA, USA) and filtered with a one-way ANOVA (p < 0.05) [41]. Uniprot (http://www.uniprot.ort/) (accessed on 26 January 2022) and search tools were used to identify gene ontology (GO). For visualizing, the overlapped proteins were generated by Venny v2.1.0 (https://bioinfogp.cnb.csic.es/tools/venny/) (accessed on 17 March 2022).

2.8. Statistical Analysis

All data are presented as mean ± SE. The qPCR experiment was repeated at two biological replicates (three technical replicates for each biological replicate). The AsA content and sugar composition experiments were repeated three times. Statistical analyses were performed using IBM SPSS Statistics v. 26 software (IBM, New York, NY, USA). The data were performed using Student’s t-test or one-way ANOVA followed by a Tukey’s HSD post-hoc test to determine statistical significance. Heat map of the fragments per kilobase of transcript per million fragments (FPKM) value was generated using GraphPad Prism version 9.0.0 for Windows (GraphPad Software, San Diego, CA, USA) to evaluate the similarity among three replicates. The principal component analysis (PCA) was also performed using FPKM values generated by factoextra package in RStudio [42].

3. Results

3.1. Gene Expression Analysis by Quantitative Real-Time PCR (qRT-PCR)

The transcript levels of genes in the ascorbic biosynthesis pathway including three copies of GDP-mannose pyrophosphorylase (VTC1), namely OsVTC1-1, OsVTC1-3 and OsVTC1-8, two copies of GDP-mannose-3′,5-epimerase (GME), OsGME1 and OsGME2, GDP-L-galactose phosphorylase (OsVTC2), L-galactose-1-phosphate phosphatase (OsVTC4), L-galactose dehydrogenase (OsGDH) and glutathione peroxidase (OsGPX1) genes were examined. The mRNA expression levels of OsVTC1-1, OsGME1, OsGME2, OsVTC2 and OsGPX1 genes were statistically significantly lower in RNAi mutant lines compared to the expression level in wild type (Figure 1a,d–f,i). The expression levels of OsVTC1-3, OsVTC1-8 and OsVTC4 genes were not different from the wild type (Figure 1b,c,g). However, the transcript levels of OsGDH genes were statistically significantly higher in RNAi mutant lines compared to wild type (Figure 1h). The results revealed that the reduction of OsVTC1-1 gene expression influenced the expression level of genes in the ascorbic biosynthesis pathway and OsGPX1.

3.2. AsA Measurement

To compare AsA content between wild type and OsVTC1 RNAi lines, we measured the amount of AsA in whole leaves. The AsA production was significantly reduced by ~34 and 40% in RI1-2 and RI1-3 lines compared to wild type (Figure 2a). The three different parts of fully expanded leaves referred to as top, middle and base areas were also measured for AsA content. The results revealed that the top part of the leaves contained the highest amount of AsA, followed by the middle and the base of the leaves. Moreover, the amount of AsA in the wild type was significantly higher than that in the mutant lines in the top part of leaves, but not different in the middle part and base of leaves, respectively (Figure 2b).
In addition, we measured the AsA contents in leaves, stems and roots of three different Thai rice cultivars (KDML105, JHN and RD6) and measured the AsA contents of KDML105 rice cultivar at different rice growth stages (seed, seedling, 3 weeks-old, 12 weeks-old and 20 weeks-old plants) in leaves, stems and roots. The results showed that the AsA content was not different in three Thai rice cultivars, but the AsA contents were significantly higher in leaves than in stems and roots (Figure 2c). The AsA was not detected in the seed and seedling stage. On the other hand, the AsA was detected at a 3-week-old plant at a relatively high level and stayed at this high level at 12- and 20-week-old plants, in which the highest amount was detected in leaves (Figure 2d).

3.3. Leaf Anatomical Comparison between Wild Type and OsVTC1-1 RNAi Lines

OsVTC1-1 RNAi lines were observed through cross-sections of flag leaves to compare cell size and tissue organization with the wild type (Figure 3a–c). The results revealed that parenchyma thickness, the thickness of large vascular bundle (LVB) and small vascular bundle (SVB), the distance between adjacent SVBs, the thickness of upper and lower cuticle and thickness of upper epidermis of OsVTC1-1 RNAi lines were significantly lower than in wild type (Figure 3d–g,i–k). However, there was no significant difference in the length of the largest bulliform cell and thickness of the lower epidermis between OsVTC1-1 RNAi lines and wild type (Figure 3h,l). Therefore, the limitation of OsVTC1-1 expression in leaves might affect cell size and tissue arrangement in leaves.

3.4. Cell Wall Sugar Composition Analysis

To investigate whether OsVTC1-1 gene is involved in the cell wall modification mechanism, we compared cell wall monosaccharide composition in wild type (WT) and OsVTC1-1 RNAi lines. Xylose, arabinose, galactose, galacturonic acid, fucose, mannose and glucuronic acid were detected in hydrolyzed cell wall samples. There was not a statistically significant difference in monosaccharide composition (µmol g−1 FW) from RNAi lines compared to the WT (Figure S1). Xylose is the most abundant monosaccharide, followed by arabinose and galactose (Figure S1a–c). However, galactose and mannose contents as mol% of the total acid-hydrolyzed sugars were significantly decreased in both RI1-2 and RI1-3 lines (Figure 4c,f). These data revealed that reduction of OsVTC1-1 gene expression affects sugar incorporation into the cell wall, especially galactose and mannose.

3.5. Transcriptome Analysis

We performed transcriptome analysis to identify differentially expressed genes (DEGs) between wild type (WT) and OsVTC1-1 RNAi lines. The RNA-seq data revealed that the raw reads and clean reads in each sample ranging from 39,859,454 to 43,623,072 reads and 19,704,679 to 23,321,544, respectively. The total mapped reads varied between 90.7% and 93.0% (Table S1). There were 25 and 19 down-regulated DEGs in RI1-2 and RI1-3, respectively. The down-regulated DEGs in RI1-2 and RI1-3 are listed in Table 2. Eleven down-regulated genes were common between RI1-2 and RI1-3 including thionin-like peptide, aspartokinase, aspartokinase/homoserine dehydrogenase 2, CBL-interacting protein kinase 14 (CIPK14), ARK protein, kinase, pheophorbide an oxygenase and photosystem II 10 kDa polypeptide. There were 100 and 256 up-regulated DEGs in RI1-2 and RI1-3, respectively. A list of the top 20 DEGs ranked by the log2FC value is listed in Table S2. F-box protein, jasmonate-induced protein, amino acid transporter and glycosyl transferase were found to be common in the top 20 up-regulated DEGs among RI1-2 and RI1-3 lines (Table S2). Heat map representing 100 common genes from WT and OsVTC1-1 RNAi lines correspond to the fragments per kilobase of transcript per million fragments (FPKM) value was generated using GraphPad Prism version 9.0.0 to evaluate the similarity among three replicates. The results showed that the expression profiles of most genes were similar among three replicates (Figure S2, Table S3). The principal component analysis (PCA) was also performed using FPKM values. PCA plots declared that the WT samples were grouped together, whereas six replicates of OsVTC1-1 RNAi lines were also clustered together with two replicates (RI1-2_3 and RI1-3_3) spaced a bit further apart (Figure S3).

3.6. Proteome Analysis

To identify differentially expressed proteins between wild type (WT) and OsVTC1-1 RNAi lines, we used liquid chromatography-tandem mass spectrometry (LC/MS-MS) to analyze peptide sequences. The peptide sequences data were searched using Uniprot (http://www.uniprot.ort/) (accessed on 26 January 2022). From an overall 115 proteins, 44, 85 and 86 were found in wild type, RI1-2 and RI1-3 lines, respectively, while 7, 8 and 6 proteins were uniquely observed in wild type, RI1-2 and RI1-3 lines, respectively. Six proteins were common in all samples (Figure 5). The differentially expressed proteins are shown in Table 3. Seven proteins were particularly found in wild type, including protein disulfide isomerase-like 1-1, anoctamin-like protein, minor outer capsid protein P2, peroxisomal fatty acid beta-oxidation multifunctional protein, mitogen-activated protein kinase, mixed-linked glucan synthase 6 and DNA topoisomerase 3-alpha. In addition, the NAC domain-containing protein 50, very-long-chain aldehyde decarbonylase, 2-hydroxyacyl-CoA lyase, kinesin-like protein KIN-13A, cysteine-tRNA ligase, double-stranded RNA-binding protein 6, zinc finger CCCH domain-containing protein 15 and endoribonuclease dicer homolog 1 were presented only in RI1-2 and RI1-3 lines. Some differentially expressed proteins are known to play a role in the cell wall structure. For example, kinesin-like protein KIN-4A, expansin-B2, beta-galactosidase 11 and cellulose synthase-like protein D5 were more abundant in wild type than in the RI1-2 line (Table 3).

4. Discussion

AsA biosynthesis in plants predominantly involves the conversion of D-glucose-6-phosphate to AsA via GDP-mannose and GDP-L-galactose [5]. Evidence for the importance of the L-galactose pathway in AsA production has been studied in several mutants. Many studies showed that the mutants affected the AsA levels, plant growth and development and abiotic stress tolerance. vtc1 mutant, which is a knock-down mutant of GDP-mannose pyrophosphorylase (VTC1) gene, contained 25% AsA levels compared to wild type [7]. Mutants in VTC2 (vtc2-1 and vtc2-2), which encodes GDP-L-galactose phosphorylase, contain ~20% of wild type AsA and are sensitive to ozone in Arabidopsis [43]. Similarly, the AsA content and seed germination rate in Arabidopsis was decreased in the T-DNA knockout vtc4 mutant (L-galactose-1-phosphate phosphatase). Although the L-galactose pathway was controlled by several genes, VTC2 gene was identified as the first rate-limiting step of the L-galactose pathway [14]. However, VTC1 gene is also required for ascorbate production in plants. For example, the AsA production of whole rice plants reduced ~30–60% in OsVTC1-1 RNAi lines and decreased salt tolerance under salt stress [8,11]. In potatoes, antisense down-regulation of VTC1 gene reduced AsA content and GMPase activity [44]. Overexpression of GMP or VTC1 gene increases the GMPase activity and leads to a two- to four-fold increase in the AsA content in leaves [45].
In this study, expression levels of eight genes in the L-galactose pathway and glutathione peroxidase (OsGPX1) gene in wild type and OsVTC1-1 RNAi lines were examined. Our results showed that OsVTC1-1 RNAi lines led to a reduced expression level of OsVTC1-1 gene, but it did not affect the expression of OsVTC1-3 and OsVTC1-8 genes. This result is consistent with a previous study [8]. The mRNA transcript levels of OsVTC1-1 and OsVTC1-3 genes showed the highest expression in leaves and roots, respectively, while OsVTC1-8 expression level was low in both leaves and roots. The transcript levels of GDP-mannose-3′,5-epimerase (OsGME1, OsGME2) and OsVTC2 also decreased in RNAi lines. There have been several studies on the mutation of AsA-related genes. vtc1 mutant had decreased AsA to 70% of wild type levels in Arabidopsis [10]. Overexpression of GMP gene had resulted in higher AsA levels in several plants species, including 2.0-fold in tobacco [46], 1.3-fold in Arabidopsis [47] and 1.7-fold in tomato [48]. On the other hand, the AsA content of GME RNAi lines in tomatoes was decreased by 40–60% [49]. Similarly, AsA content in Arabidopsis vtc2-4 and vtc2-1 mutant lines was 70% lower than in wild type [50]. There was no effect on the expression of L-galactose-1-phosphate phosphatase (OsVTC4) and L-galactose dehydrogenase (OsGDH) genes. VTC4 and GDH, which are downstream genes in the L-galactose pathway, are not a major rate-limiting step in the L-galactose pathway in rice. VTC4 has a wide substrate specificity and is involved in the synthesis of both myo-inositol and AsA [16]. In tomatoes, the AsA content was unchanged in GPP (VTC4) overexpression line [51]. The AsA concentration in leaves was not affected in GDH overexpression lines of tobacco, although the transgenic lines exhibited a 3.5-fold increase in GDH activity [52].
GPX gene expression also decreased in OsVTC1-1 RNAi lines. GPX is an important enzymatic antioxidant to scavenge hydrogen peroxide (H2O2) and peroxide radicals against oxidative damage. AsA is involved in the detoxification of ROS either directly or through the ascorbate-glutathione (AsA-GSH) pathway [53,54]. Previously, Zhang et al. reported that a tomato ethylene response factor, also called TERF1, plays a role in regulating ROS scavenging during stress responses. Overexpression of TERF1 in tobacco increased the expression of the oxidative-related genes—not only the GPX gene that catalyzes oxidative reactions but also the VTC1 gene in the AsA biosynthesis pathway. This finding suggests that the AsA and GPX coordinates function in the regulation of ROS detoxification. For this reason, decreasing the expression of VTC1 gene could affect the transcript level of genes related to oxidative stress, such as GPX [55,56].
AsA, which is a multifunctional molecule that plays a significant role in plant growth and development, including enzymes, is involved in multiple biological processes, photosynthesis, ROS scavenging and tolerance against both abiotic and biotic stresses [1,5,57]. The rice genome consists of three homologs of OsVTC1 gene. Among these homologs, OsVTC1-1 is associated with the greatest AsA production in rice leaves, whereas OsVTC1-3 plays a role in AsA synthesis in roots [8]. Our results were in agreement with a previous report [8]. The expression levels of genes in the L-galactose pathway in roots were quite low as compared to leaf levels, implying that rice synthesizes AsA mainly in leaves [15]. The amount of AsA was highest at the top and decreased down to the base of leaves. AsA is synthesized in all parts of leaves (and other parts of the plants). It has a concentration of more than 20 mM in chloroplasts [5]. This study showed that AsA accumulated more in the top of the leaves. It could possibly be related to higher light intensity because AsA acts as a photoprotectant during light exposure. Moreover, AsA acts as an electron donor in photosynthesis, while monodehydroascorbate acts as an electron acceptor [2]. It is involved in the removal of H2O2 generated by photoreduction and photorespiration [53]. Therefore, the AsA was accumulated in the area of plants that are exposed to higher light intensity. Supporting again in leaves contained a high amount of AsA but low in roots. Similarly, Shih et al. [58] showed that AsA activities of Moringa oleifera, Lam were high in leaves, followed by stems and stalks, respectively. The total AsA contents were the highest in flowering buds, then siliques and leaves, but low in stems [59]. In addition, the absence of AsA content was observed in seeds. To maintain metabolic activity at a low level, dry seed avoids its reduced form (AsA), and comprises only the oxidized form; dehydroascorbic acid (DHA) [60,61].
According to the comparative anatomical characteristics between OsVTC1-1 RNAi lines and WT plants in rice under a light microscope, the results revealed that the leaf anatomical parameters were altered in OsVTC1-1 RNAi lines. The decrease in size of parenchyma, large and small vascular bundles of RNAi lines reflect the roles of AsA in its photosynthetic tissue and vascular system. This is because leaf parenchyma generally contains abundant chloroplast, which is a source of high AsA accumulation [1,2]. In Arabidopsis, AsA was detected not only in parenchyma cells but also in xylem and phloem elements [62]. Moreover, AsA has been known to be required for vascular development at the different stages of xylem and phloem in larch (Larix sibirica Ldb.) and pine (Pinus sylvestris L.) trees [63]. In our study, the distance between adjacent small vascular bundle (SVBs) in OsVTC1-1 RNAi lines was also shorter than wild type, suggesting that cell size reduction of both parenchyma and vascular tissue may affect the length between adjacent SVBs. This result was supported by the distance between two adjacent vascular bundles decreased due to the reduction of mesophyll and bundle sheath cell thickness in the presence of NaCl [64]. Similarly, the thickness of cuticle and epidermis of the upper surface and lower cuticle thickness in OsVTC1-1 RNAi leaf was significantly smaller than in wild type. A previous study also showed that the cell size in vtc1 and vtc2 were smaller than wild type in Arabidopsis [9]. AsA is necessary for many biological processes in plants, including cell expansion, cell division and cross-linking of the cell walls [2,4]. Therefore, the reduction of AsA synthesis by knocking down OsVTC1-1 gene expression likely disrupts the cell size and cellular organization in leaves.
VTC1 catalyzes the synthesis of GDP-D-mannose, which is a substrate for cell wall polysaccharide and glycoprotein synthesis, and likewise GDP-L-galactose [3]. In grasses, xylose is the major component of hemicellulose monosaccharide (about 60%) [65]. Our study showed that xylose is abundantly present in leaf cell walls in both WT and OsVTC1 RNAi lines. In addition, mannose and galactose composition as mole percentages of total sugars decreased in both RI1-2 and RI1-3 RNAi lines. Similar to a previous study in potato, the GMPase (VTC1) antisense plants exhibited a reduction in the mannose content of cell walls in leaves, while other monosaccharides content in cell walls were not different from the wild type. Reduction in the mannose content of cell walls in GMPase antisense plants was a result of a reduction in GDP-mannose production [44]. In the cell walls of Arabidopsis vtc1 mutant, mannose and fucose levels were also decreased [66]. Decreasing VTC1 expression led to a reduction in the mannose and galactose composition, suggesting that VTC1 may be involved in cell wall formation because sugars are components of plant cell wall polymers [67]. Sugars play a role in plant development, as well as plant signaling pathways [68]. Consistent with anatomical results, OsVTC1-1 RNAi lines showed a decrease in cell size. AsA is involved in the regulation of plant development processes, acts as a cofactor in cell wall hydroxyproline-rich glycoproteins post-translation for cell growth and is required for cell division [2,5].
Transcriptome analysis revealed DEGs between wild type and OsVTC1-1 RNAi lines, and the 11 down-regulated differentially expressed genes (DEGs) were shared in both OsVTC1-1 RNAi lines. Several DEGs are involved in the signaling pathways, such as aspartokinase, CBL-interacting protein kinase 14 (CIPK14) and kinase. Consistent with our results, a previous study reported that 171 genes were differentially expressed between wild type and vtc1 mutants in Arabidopsis, including kinase and kinase receptors [69]. Aspartokinase catalyzes the phosphorylation of aspartic acid, which is the first step of amino acids synthesis, such as lysine, methionine and threonine [70]. Reduced aspartokinase activity in myxobacteria led to disruption of cell wall growth [71]. CIPK14 interacts with Calcineurin B-like (CBL) protein which responds to various abiotic stresses and associates with plant development [72]. In eukaryotic cells, kinases play a key role in cellular processes by adding phosphate groups and act as a major component which responds to abiotic and biotic stresses in plants [73]. Another identified DEG that involves in amino acids synthesis is aspartokinase/homoserine dehydrogenase 2. This enzyme is a bifunctional protein and catalyzes the synthesis of threonine, methionine and isoleucine [74]. The thionin-like peptide is a defense-related protein which has antimicrobial activity [75]. Some DEGs are associate with photosynthesis; pheophorbide an oxygenase controls chlorophyll breakdown during senescence, which is one part of plant development [76]; and photosystem II 10 kDa polypeptide is a chloroplast precursor in photosystem II [77]. Hence, decreasing OsVTC1-1 expression may affect many processes in plants.
Differentially expressed proteins between wild type and OsVTC1-1 RNAi lines were additionally determined. Cell wall-related proteins, including kinesin-like protein KIN-4A, expansin-B2, beta-galactosidase 11 and cellulose synthase-like protein D5 were reduced in mutant lines compared with wild type. Several studies on the mutation of cell wall-related genes have been reported. For example, the expansion of cells is accomplished through the activity of expansin as a cell wall protein [78]. Pollen tube growth retardation was observed in the double mutant of expansin genes (atexpa4 atexpb5) in Arabidopsis [79]. The mutation of rsw1 that encodes cellulose synthase reduced cellulose production and exhibited an abnormal phenotype in Arabidopsis [80]. Plant cell walls contain cellulose as a major component. Cellulose is synthesized by cellulose synthase complex in the plasma membrane [81,82]. Cellulose content was reduced in cellulose-deficient mutants in Arabidopsis [83]. In contrast, overexpression of CesA6-like genes in Arabidopsis enhances cellulose contents and wall thickness [84]. Our results concluded that depletion of cell wall proteins component in OsVTC1-1 RNAi lines may interfere with cell wall synthesis in rice.

5. Conclusions

The characteristics of wild type (WT) and OsVTC1-1 RNAi lines were studied. The expression of genes in AsA biosynthesis pathway, AsA content, leaf anatomical parameters and mannose and galactose content as a percent of total sugars were decreased in the OsVTC1-1 RNAi line. Notably, the expression of cell wall-associated proteins was decreased in the OsVTC1-1 RNAi line. These results suggest that OsVTC1-1 plays an essential role in AsA production and affects cell wall sugar composition. The results from this study may be useful in understanding the role of the OsVTC1-1 gene that is involved in cell walls and other mechanisms and processes in plants.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/agronomy12061272/s1, Figure S1: Cell wall sugar composition measurement in wild type (WT) and OsVTC1-1 RNAi lines from 3-week-old rice. (a) xylose; (b) arabinose; (c) galactose; (d) galacturonic acid; (e) fucose; (f) mannose; (g) glucuronic acid. Bars represent the means and standard errors of three replicates; Figure S2: Heat map representation of the expression patterns of 100 common genes from wild type (WT) and OsVTC1-1 RNAi lines among three replicates. The color scale on the right represents the fragments per kilobase of transcript per million fragments (FPKM) value. Red and green shows high and low expressions, respectively; Figure S3: Principal Component Analysis (PCA) plot of FPKM value of 100 genes from wild type (WT) and OsVTC1-1 RNAi lines; Table S1: Summary of RNA-seq data and reads mapping; Table S2: The top 20 upregulated differentially expressed genes in RI1-2 and RI1-3 as ranked by log2FC value; Table S3: FPKM expression values of 100 common genes from wild type (WT) and OsVTC1-1 RNAi lines with three replicates.

Author Contributions

K.L. (Kanyanat Lamanchai) carried out the experiment and wrote the manuscript; D.L.S. assisted K.L. (Kanyanat Lamanchai) to perform the cell wall sugar composition experiment and analyze the GC/MS data; P.S. helped carry out the anatomical study; N.S. designed the AsA measurement in RNAi lines experiment, suggested the cell wall sugar experiment and revised the manuscript; S.R., K.L. (Kantinan Leetanasaksakul) and S.K. performed proteome and data analysis. C.J. conceived the project, designed the experiments, supervised the research and revised manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This research and innovation activity is funded by National Research Council of Thailand (NRCT) as of fiscal year 2021 and Kasetsart University Research and Development Institute (KURDI) project FF(KU)5.64. Kanyanat Lamanchai was financially supported by Development and Promotion of Science and Technology Talents Project (DPST).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Not applicable.

Acknowledgments

We gratefully acknowledge Zhijin Zhang from Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China for providing OsVTC1 RNAi rice seeds in this experiment.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Zhang, Y. Biological Role of Ascorbate in Plants. In Ascorbic Acid in Plants; Springer Briefs in Plant Science; Springer: New York, NY, USA, 2013; pp. 7–33. [Google Scholar]
  2. Smirnoff, N. The Function and Metabolism of Ascorbic Acid in Plants. Ann. Bot. 1996, 78, 661–669. [Google Scholar] [CrossRef]
  3. Davey, M.W.; Montagu, M.V.; Inz, D.; Sanmartin, M.; Kanellis, A.; Smirnoff, N.; Benzie, I.J.J.; Strain, J.J.; Favell, D.; Fletcher, J. Plant L-ascorbic acid: Chemistry, function, metabolism, bioavailability and effects of processing. J. Sci. Food Agric. 2000, 80, 825–860. [Google Scholar] [CrossRef]
  4. Liso, R.; Calabrese, G.; Bitonti, M.B.; Arrigoni, O. Relationship between ascorbic acid and cell division. Exp. Cell Res. 1984, 150, 314–320. [Google Scholar] [CrossRef]
  5. Smirnoff, N.; Wheeler, G.L. Ascorbic Acid in Plants: Biosynthesis and Function. Crit. Rev. Biochem. Mol. Biol. 2000, 35, 291–314. [Google Scholar] [CrossRef]
  6. Höller, S.; Hajirezaei, M.-R.; von Wirén, N.; Frei, M. Ascorbate metabolism in rice genotypes differing in zinc efficiency. Planta 2014, 239, 367–379. [Google Scholar] [CrossRef]
  7. Conklin, P.; Norris, S.; Wheeler, G.; Williams, E.; Smirnoff, N.; Last, R. Genetic evidence for the role of GDP-mannose in plant ascorbic acid (vitamin c) biosynthesis. Proc. Natl. Acad. Sci. USA 1999, 96, 4198–4203. [Google Scholar] [CrossRef]
  8. Qin, H.; Deng, Z.; Zhang, C.; Wang, Y.; Wang, J.; Liu, H.; Zhang, Z.; Huang, R.; Zhang, Z. Rice GDP-mannose pyrophosphorylase OsVTC1-1 and OsVTC1-3 play different roles in ascorbic acid synthesis. Plant Mol. Biol. 2016, 90, 317–327. [Google Scholar] [CrossRef]
  9. Pavet, V.; Olmos, E.; Kiddle, G.; Mowla, S.; Kumar, S.; Antoniw, J.; Alvarez, M.; Foyer, C. Ascorbic acid deficiency activates cell death and disease resistance responses in Arabidopsis. Plant Physiol. 2005, 139, 1291–1303. [Google Scholar] [CrossRef]
  10. Veljovic-Jovanovic, S.D.; Pignocchi, C.; Noctor, G.; Foyer, C.H. Low ascorbic acid in the vtc-1 mutant of Arabidopsis is associated with decreased growth and intracellular redistribution of the antioxidant system. Plant Physiol. 2001, 127, 426–435. [Google Scholar] [CrossRef]
  11. Qin, H.; Wang, Y.; Wang, J.; Liu, H.; Zhao, H.; Deng, Z.; Zhang, Z.; Huang, R.; Zhang, Z. Knocking down the expression of GMPase gene OsVTC1-1 decreases salt tolerance of rice at seedling and reproductive stages. PLoS ONE 2016, 11, e0168650. [Google Scholar] [CrossRef]
  12. Qi, T.; Liu, Z.; Fan, M.; Chen, Y.; Tian, H.; Wu, D.; Gao, H.; Ren, C.; Song, S.; Xie, D. GDP-D-mannose epimerase regulates male gametophyte development, plant growth and leaf senescence in Arabidopsis. Sci. Rep. 2017, 7, 10309. [Google Scholar] [CrossRef]
  13. Ma, L.; Wang, Y.; Liu, W.; Liu, Z. Overexpression of an alfalfa GDP-mannose 3,5-epimerase gene enhances acid, drought and salt tolerance in transgenic Arabidopsis by increasing ascorbate accumulation. Biotechnol. Lett. 2014, 36, 2331–2341. [Google Scholar] [CrossRef]
  14. Fenech, M.; Amorim-Silva, V.; Esteban del Valle, A.; Arnaud, D.; Ruiz-Lopez, N.; Castillo, A.G.; Smirnoff, N.; Botella, M.A. The role of GDP-l-galactose phosphorylase in the control of ascorbate biosynthesis. Plant Physiol. 2021, 185, 1574–1594. [Google Scholar] [CrossRef] [PubMed]
  15. Zhang, G.Y.; Liu, R.R.; Zhang, C.Q.; Tang, K.X.; Sun, M.F.; Yan, G.H.; Liu, Q.Q. Manipulation of the rice L-galactose pathway: Evaluation of the effects of transgene overexpression on ascorbate accumulation and abiotic stress tolerance. PLoS ONE 2015, 10, e0125870. [Google Scholar] [CrossRef] [PubMed]
  16. Torabinejad, J.; Donahue, J.; Gunesekera, B.; Allen-Daniels, M.; Gillaspy, G. VTC4 is a bifunctional enzyme that affects myoinositol and ascorbate bosynthesis in plants. Plant Physiol. 2009, 150, 951–961. [Google Scholar] [CrossRef] [PubMed]
  17. Fanucchi, M.V. Chapter 11—Development of antioxidant and xenobiotic metabolizing enzyme systems. In The Lung, 2nd ed.; Harding, R., Pinkerton, K.E., Eds.; Academic Press: Boston, MA, USA, 2014; pp. 223–231. [Google Scholar]
  18. Pehlivan, F. Vitamin C: An antioxidant agent. In Vitamin C; IntechOpen: London, UK, 2017. [Google Scholar]
  19. Rajput, V.D.; Harish; Singh, R.K.; Verma, K.K.; Sharma, L.; Quiroz-Figueroa, F.R.; Meena, M.; Gour, V.S.; Minkina, T.; Sushkova, S.; et al. Recent developments in enzymatic antioxidant defence mechanism in plants with special reference to abiotic Stress. Biology 2021, 10, 267. [Google Scholar] [CrossRef]
  20. Held, M.A.; Jiang, N.; Basu, D.; Showalter, A.M.; Faik, A. Plant cell wall polysaccharides: Structure and biosynthesis. In Polysaccharides: Bioactivity and Biotechnology; Ramawat, K.G., Mérillon, J.M., Eds.; Springer International Publishing: Cham, Switzerland, 2015; pp. 3–54. [Google Scholar]
  21. Voiniciuc, C.; Pauly, M.; Usadel, B. Monitoring polysaccharide dynamics in the plant cell wall. Plant Physiol. 2018, 176, 2590–2600. [Google Scholar] [CrossRef]
  22. Ochoa-Villarreal, M.; Aispuro, E.; Vargas-Arispuro, I.; Martínez-Téllez, M. Plant cell wall polymers: Function, structure and biological activity of their derivatives. Polymerization 2012, 4, 63–86. [Google Scholar]
  23. Kumar, M.; Atanassov, I.; Turner, S. Functional analysis of cellulose synthase (CESA) protein class specificity. Plant Physiol. 2017, 173, 970–983. [Google Scholar] [CrossRef]
  24. Zhang, W.; Qin, W.; Li, H.; Wu, A.M. Biosynthesis and transport of nucleotide sugars for plant hemicellulose. Front. Plant Sci. 2021, 12, 723128. [Google Scholar] [CrossRef]
  25. Scheller, H.V.; Ulvskov, P. Hemicelluloses. Annu. Rev. Plant Biol. 2010, 61, 263–289. [Google Scholar] [CrossRef] [PubMed]
  26. Harholt, J.; Suttangkakul, A.; Vibe Scheller, H. Biosynthesis of pectin. Plant Physiol. 2010, 153, 384395. [Google Scholar] [CrossRef] [PubMed]
  27. Yapo, B.M. Pectin rhamnogalacturonan II: On the “small stem with four branches” in the primary cell walls of plants. Int. J. Carbohydr. Chem. 2011, 2011, 964521. [Google Scholar] [CrossRef]
  28. Yoshida, S.; Forno, D.A.; Cock, J.H.; Gomez, K.A. Laboratory Manual for Physiological Studies of Rice, 3rd ed.; International Rice Research Institutes: Manila, Philippines, 1976; pp. 61–66. [Google Scholar]
  29. Gregorio, G.; Senadhira, D.; Mendoza, R. Screening Rice for Salinity Tolerance; IRRI Discussion Paper Series; International Rice Research Institute: Los Banos, Philippines, 1997; Volume 22. [Google Scholar]
  30. Livak, K.J.; Schmittgen, T.D. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C(T)) Method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef]
  31. Höller, S.; Ueda, Y.; Wu, L.; Wang, Y.; Hajirezaei, M.R.; Ghaffari, M.R.; von Wirén, N.; Frei, M. Ascorbate biosynthesis and its involvement in stress tolerance and plant development in rice (Oryza sativa L.). Plant Mol. Biol. 2015, 88, 545–560. [Google Scholar] [CrossRef]
  32. Islam, T.; Manna, M.; Kaul, T.; Pandey, S.; Reddy, C.S.; Reddy, M.K. Genome-wide dissection of Arabidopsis and rice for the identification and expression analysis of glutathione peroxidases reveals their stress-specific and overlapping response patterns. Plant Mol. Biol. Report. 2015, 33, 1413–1427. [Google Scholar] [CrossRef]
  33. Chaipanya, C.; Telebanco-Yanoria, M.J.; Quime, B.; Longya, A.; Korinsak, S.; Korinsak, S.; Toojinda, T.; Vanavichit, A.; Jantasuriyarat, C.; Zhou, B. Dissection of broad-spectrum resistance of the Thai rice variety Jao Hom Nin conferred by two resistance genes against rice blast. Rice 2017, 10, 18. [Google Scholar] [CrossRef]
  34. Gillespie, K.; Ainsworth, E. Measurement of reduced, oxidized and total ascorbate content in plants. Nat. Protoc. 2007, 2, 871–874. [Google Scholar] [CrossRef]
  35. Ruzin, S.E. Plant Microtechnique and Microscopy; Oxford University Press: New York, NY, USA, 1999. [Google Scholar]
  36. Conklin, P.L.; Gatzek, S.; Wheeler, G.L.; Dowdle, J.; Raymond, M.J.; Rolinski, S.; Isupov, M.; Littlechild, J.A.; Smirnoff, N. Arabidopsis thaliana VTC4 encodes L-galactose-1-P phosphatase, a plant ascorbic acid biosynthetic enzyme. J. Biol. Chem. 2006, 281, 15662–15670. [Google Scholar] [CrossRef]
  37. Merchant, N.; Lyons, E.; Goff, S.; Vaughn, M.; Ware, D.; Micklos, D.; Antin, P. The iPlant collaborative: Cyberinfrastructure for enabling data to discovery for the life sciences. PLoS Biol. 2016, 14, e1002342. [Google Scholar] [CrossRef]
  38. Goff, S.; Vaughn, M.; McKay, S.; Lyons, E.; Stapleton, A.; Gessler, D.; Matasci, N.; Wang, L.; Hanlon, M.; Lenards, A.; et al. The iPlant collaborative: Cyberinfrastructure for plant biology. Front. Plant Sci. 2011, 2, 34. [Google Scholar] [CrossRef] [PubMed]
  39. Lowry, O.; Rosebrough, N.; Farr, A.L.; Randall, R. Protein measurement with the folin phenol reagent. J. Biol. Chem. 1951, 193, 265–275. [Google Scholar] [CrossRef]
  40. Tyanova, S.; Temu, T.; Cox, J. The MaxQuant computational platform for mass spectrometry-based shotgun proteomics. Nat. Protoc. 2016, 11, 2301–2319. [Google Scholar] [CrossRef] [PubMed]
  41. Saeed, A.I.; Sharov, V.; White, J.; Li, J.; Liang, W.; Bhagabati, N.; Braisted, J.; Klapa, M.; Currier, T.; Thiagarajan, M.; et al. TM4: A free, open-source system for microarray data management and analysis. BioTechniques 2003, 34, 374–378. [Google Scholar] [CrossRef]
  42. Kassambara, A.; Mundt, F. Extract and Visualize the Results of Multivariate Data Analyses [R Package Factoextra Version 1.0.7]. 2020. Available online: https://CRAN.R-project.org/package=factoextra (accessed on 20 May 2022).
  43. Conklin, P.; Saracco, S.; Norris, S.; Last, R. Identification of ascorbic acid-deficient Arabidopsis thaliana Mutants. Genetics 2000, 154, 847–856. [Google Scholar] [CrossRef]
  44. Keller, R.; Renz, F.S.; Kossmann, J. Antisense inhibition of the GDP-mannose pyrophosphorylase reduces the ascorbate content in transgenic plants leading to developmental changes during senescence. Plant J. 1999, 19, 131–141. [Google Scholar] [CrossRef]
  45. Wang, H.-S.; Yu, C.; Zhu, Z.-J.; Yu, X.-C. Overexpression in tobacco of a tomato GMPase gene improves tolerance to both low and high temperature stress by enhancing antioxidation capacity. Plant Cell Rep. 2011, 30, 1029–1040. [Google Scholar] [CrossRef]
  46. Badejo, A.A.; Tanaka, N.; Esaka, M. Analysis of GDP-d-mannose pyrophosphorylase gene promoter from acerola (Malpighia glabra) and increase in ascorbate content of transgenic tobacco expressing the acerola gene. Plant Cell Physiol. 2008, 49, 126–132. [Google Scholar] [CrossRef]
  47. Zhou, Y.; Tao, Q.C.; Wang, Z.N.; Fan, R.; Li, Y.; Sun, X.F.; Tang, K.X. Engineering ascorbic acid biosynthetic pathway in Arabidopsis leaves by single and double gene transformation. Biol. Plant. 2012, 56, 451–457. [Google Scholar] [CrossRef]
  48. Cronje, C.; George, G.; Fernie, A.; Bekker, J.; Kossmann, J.; Bauer, R. Manipulation of L-ascorbic acid biosynthesis pathways in Solanum lycopersicum: Elevated GDP-mannose pyrophosphorylase activity enhances L-ascorbate levels in red fruit. Planta 2012, 235, 553–564. [Google Scholar] [CrossRef]
  49. Gilbert, L.; Alhagdow, M.; Nunes-Nesi, A.; Quéméner, B.; Guillon, F.; Bouchet, B.; Faurobert, M.; Gouble, B.; Page, D.; Garcia, V.; et al. GDP-D-mannose 3,5-epimerase (GME) plays a key role at the intersection of ascorbate and non-cellulosic cell-wall biosynthesis in tomato. Plant J. 2009, 60, 499–508. [Google Scholar] [CrossRef] [PubMed]
  50. Lim, B.; Smirnoff, N.; Cobbett, C.; Golz, J. Ascorbate-deficient vtc2 mutants in Arabidopsis do not exhibit decreased growth. Front. Plant Sci. 2016, 7, 1025. [Google Scholar] [CrossRef] [PubMed]
  51. Li, X.; Ye, J.; Munir, S.; Yang, T.; Chen, W.; Liu, G.; Zheng, W.; Zhang, Y. Biosynthetic gene pyramiding leads to ascorbate accumulation with enhanced oxidative stress tolerance in tomato. Int. J. Mol. Sci. 2019, 20, 1558. [Google Scholar] [CrossRef] [PubMed]
  52. Gatzek, S.; Wheeler, G.; Smirnoff, N. Antisense suppression of L-galactose dehydrogenase in Arabidopsis thaliana provides evidence for its role in ascorbate synthesis and reveals light modulated L-galactose synthesis. Plant J. 2002, 30, 541–553. [Google Scholar] [CrossRef] [PubMed]
  53. Foyer, C.H.; Noctor, G. Ascorbate and glutathione: The heart of the redox hub. Plant Physiol. 2011, 155, 2–18. [Google Scholar] [CrossRef]
  54. Potters, G.; De Gara, L.; Asard, H.; Horemans, N. Ascorbate and glutathione: Guardians of the cell cycle, partners in crime? Plant Physiol. Biochem. 2002, 40, 537–548. [Google Scholar] [CrossRef]
  55. Mellidou, I.; Koukounaras, A.; Kostas, S.; Patelou, E.; Kanellis, A.K. Regulation of vitamin C accumulation for improved tomato fruit quality and alleviation of abiotic stress. Genes 2021, 12, 694. [Google Scholar] [CrossRef]
  56. Zhang, H.; Li, A.; Zhang, Z.; Huang, Z.; Lu, P.; Zhang, D.; Liu, X.; Zhang, Z.-F.; Huang, R. Ethylene response factor TERF1, regulated by ethylene-insensitive3-like factors, functions in reactive oxygen species (ROS) scavenging in tobacco (Nicotiana tabacum L.). Sci. Rep. 2016, 6, 29948. [Google Scholar] [CrossRef]
  57. Ortiz-Espín, A.M.; Sánchez Guerrero, A.; Sevilla, F.; Jiménez, A. The role of ascorbate in plant growth and development. In Ascorbic Acid in Plant Growth, Development and Stress Tolerance; Springer: Cham, Switzerland, 2017; pp. 25–45. [Google Scholar]
  58. Shih, M.C.; Chang, C.M.; Kang, S.M.; Tsai, M.L. Effect of different parts (leaf, stem and stalk) and seasons (summer and winter) on the chemical compositions and antioxidant activity of Moringa oleifera. Int. J. Mol. Sci. 2011, 12, 6077–6088. [Google Scholar] [CrossRef]
  59. Kka, N.; Rookes, J.; Cahill, D. Quantitation of ascorbic acid in Arabidopsis thaliana reveals distinct differences between organs and growth phases. Plant Growth Regul. 2017, 81, 283–292. [Google Scholar] [CrossRef]
  60. Arrigoni, O. Ascorbate system in plant development. J. Bioenerg. Biomembr. 1994, 26, 407–419. [Google Scholar] [CrossRef] [PubMed]
  61. Tommasi, F.; Paciolla, C.; de Pinto, M.; De Gara, L. A comparative study of glutathione and ascorbate metabolism during germination of Pinus pinea L. seeds. J. Exp. Bot. 2001, 52, 1647–1654. [Google Scholar] [CrossRef] [PubMed]
  62. Zechmann, B.; Stumpe, M.; Mauch, F. Immunocytochemical determination of the subcellular distribution of ascorbate in plants. Planta 2011, 233, 1–12. [Google Scholar] [CrossRef]
  63. Antonova, G. The role of ascorbate in growth and development of cells during the formation of annual rings in coniferous trees. In Oxidative Stress in Plants: Causes, Consequences and Tolerance; IK International Publishing House: New Delhi, India, 2011. [Google Scholar]
  64. Cárcamo, H.J.; Bustos, R.M.; Fernández, F.E.; Bastías, E. Mitigating effect of salicylic acid in the anatomy of the leaf of Zea mays L. lluteño ecotype from the Lluta valley (Arica-Chile) under NaCl stress. Idesia 2012, 30, 55–63. [Google Scholar] [CrossRef]
  65. Schädel, C.; Blöchl, A.; Richter, A.; Hoch, G. Quantification and monosaccharide composition of hemicelluloses from different plant functional types. Plant Physiol. Biochem. 2010, 48, 1–8. [Google Scholar] [CrossRef]
  66. Lukowitz, W.; Nickle, T.C.; Meinke, D.W.; Last, R.L.; Conklin, P.L.; Somerville, C.R. Arabidopsis cyt1 mutants are deficient in a mannose-1-phosphate guanylyltransferase and point to a requirement of N-linked glycosylation for cellulose biosynthesis. Proc. Natl. Acad. Sci. USA 2001, 98, 2262–2267. [Google Scholar] [CrossRef] [PubMed]
  67. Gibeaut, D.M.; Carpita, N.C. Biosynthesis of plant cell wall polysaccharides. Faseb J. 1994, 8, 904–915. [Google Scholar] [CrossRef]
  68. Ciereszko, I. Regulatory roles of sugars in plant growth and development. Acta Soc. Bot. Pol. 2018, 87. [Google Scholar] [CrossRef]
  69. Pastori, G.M.; Kiddle, G.; Antoniw, J.; Bernard, S.; Veljovic-Jovanovic, S.; Verrier, P.J.; Noctor, G.; Foyer, C.H. Leaf vitamin C contents modulate plant defense transcripts and regulate genes that control development through hormone signaling. Plant Cell 2003, 15, 939–951. [Google Scholar] [CrossRef]
  70. Newsholme, P.; Stenson, L.; Sulvucci, M.; Sumayao, R.; Krause, M. 1.02—Amino Acid Metabolism. In Comprehensive Biotechnology (Second Edition); Moo-Young, M., Ed.; Academic Press: Burlington, NJ, USA, 2011; pp. 3–14. [Google Scholar]
  71. Rosenberg, E.; Filer, D.; Zafriti, D.; Kindler, S.H. Aspartokinase activity and the developmental cycle of Myxococcus xanthus. J. Bacteriol. 1973, 115, 29–34. [Google Scholar] [CrossRef]
  72. Mo, C.; Wan, S.; Xia, Y.; Ren, N.; Zhou, Y.; Jiang, X. Expression patterns and identified protein-protein interactions suggest that cassava CBL-CIPK signal networks function in responses to abiotic stresses. Front. Plant Sci. 2018, 9. [Google Scholar] [CrossRef]
  73. Wang, P.; Hsu, C.-C.; Du, Y.; Zhu, P.; Zhao, C.; Fu, X.; Zhang, C.; Paez, J.S.; Macho, A.P.; Tao, W.A.; et al. Mapping proteome-wide targets of protein kinases in plant stress responses. Proc. Natl. Acad. Sci. USA 2020, 117, 3270–3280. [Google Scholar] [CrossRef] [PubMed]
  74. Wilson, B.J.; Gray, A.C.; Matthews, B.F. Bifunctional protein in carrot contains both aspartokinase and homoserine dehydrogenase activities. Plant Physiol. 1991, 97, 1323–1328. [Google Scholar] [CrossRef] [PubMed]
  75. Tam, J.P.; Wang, S.; Wong, K.H.; Tan, W.L. Antimicrobial peptides from plants. Pharmaceuticals 2015, 8, 711–757. [Google Scholar] [CrossRef] [PubMed]
  76. Pruzinská, A.; Tanner, G.; Anders, I.; Roca, M.; Hörtensteiner, S. Chlorophyll breakdown: Pheophorbide a oxygenase is a rieske-type iron-sulfur protein, encoded by the accelerated cell death 1 gene. Proc. Natl. Acad. Sci. USA 2003, 100, 15259–15264. [Google Scholar] [CrossRef] [PubMed]
  77. Webber, A.N.; Packman, L.C.; Gray, J.C. A 10 kDa polypeptide associated with the oxygen-evolving complex of photosystem II has a putative C-terminal non-cleavable thylakoid transfer domain. FEBS Lett. 1989, 242, 435–438. [Google Scholar] [CrossRef]
  78. McQueen-Mason, S.; Cosgrove, D.J. Disruption of hydrogen bonding between plant cell wall polymers by proteins that induce wall extension. Proc. Natl. Acad. Sci. USA 1994, 91, 6574–6578. [Google Scholar] [CrossRef]
  79. Liu, W.; Xu, L.; Lin, H.; Cao, J. Two expansin genes, AtEXPA4 and AtEXPB5, are redundantly required for pollen tube growth and AtEXPA4 is involved in primary root elongation in Arabidopsis thaliana. Genes 2021, 12, 249. [Google Scholar] [CrossRef]
  80. Arioli, T.; Peng, L.; Betzner, A.S.; Burn, J.; Wittke, W.; Herth, W.; Camilleri, C.; Höfte, H.; Plazinski, J.; Birch, R.; et al. Molecular analysis of cellulose biosynthesis in Arabidopsis. Science 1998, 279, 717–720. [Google Scholar] [CrossRef]
  81. Paredez, A.R.; Somerville, C.R.; Ehrhardt, D.W. Visualization of cellulose synthase demonstrates functional association with microtubules. Science 2006, 312, 1491–1495. [Google Scholar] [CrossRef]
  82. Taylor, N.G. Cellulose biosynthesis and deposition in higher plants. New Phytol. 2008, 178, 239–252. [Google Scholar] [CrossRef] [PubMed]
  83. Kumar, M.; Mishra, L.; Carr, P.; Pilling, M.; Gardner, P.; Mansfield, S.D.; Turner, S. Exploiting cellulose synthase (CESA) class specificity to probe cellulose microfibril biosynthesis. Plant Physiol. 2018, 177, 151–167. [Google Scholar] [CrossRef] [PubMed]
  84. Hu, H.; Zhang, R.; Feng, S.; Wang, Y.; Wang, Y.; Fan, C.; Ying, L.; Liu, Z.; Schneider, R.; Xia, T.; et al. Three AtCesA6-like members enhance biomass production by distinctively promoting cell growth in Arabidopsis. Plant Biotechnol. J. 2017, 16, 976–988. [Google Scholar] [CrossRef] [PubMed]
Figure 1. qPCR analysis of genes related in AsA biosynthesis pathway and antioxidant enzyme are shown as follows: (a) OsVTC1-1; (b) OsVTC1-3; (c) OsVTC1-8; (d) OsGME1; (e) OsGME2; (f) OsVTC2; (g) OsVTC4; (h) OsGDH; (i) OsGPX1 genes. Bars represent the means and standard errors of two biological replicates (three technical replicates per biological replicate). Asterisk indicates statistically significant differences from Zhonghua17 (wild type) analyzed using Student’s t-test (** p < 0.01).
Figure 1. qPCR analysis of genes related in AsA biosynthesis pathway and antioxidant enzyme are shown as follows: (a) OsVTC1-1; (b) OsVTC1-3; (c) OsVTC1-8; (d) OsGME1; (e) OsGME2; (f) OsVTC2; (g) OsVTC4; (h) OsGDH; (i) OsGPX1 genes. Bars represent the means and standard errors of two biological replicates (three technical replicates per biological replicate). Asterisk indicates statistically significant differences from Zhonghua17 (wild type) analyzed using Student’s t-test (** p < 0.01).
Agronomy 12 01272 g001
Figure 2. Measurement of the total AsA content in the wild type and RNAi lines, Thai rice cultivars and growth stages. (a) The total AsA content in the wild type and RNAi lines in whole leaf; (b) in different parts of leaves including top, middle and base; (c) The total AsA content in KDML, JHN and RD6 in leaves, stems and roots; (d) The total AsA content in KDML in different growth stages including; seed, seedling, 3 weeks, 12 weeks and 20 weeks old in leaves, stems and roots. Bars represent the means and standard errors of three replicates. (a) Asterisk indicates statistically significant differences from Zhonghua17 (wild type) analyzed using Student’s t-test. (b) Asterisk indicates statistically significant differences from wild type in each leave areas analyzed using Student’s t-test. (c,d) Asterisk indicates statistically significant differences from roots analyzed by one-way ANOVA with Tukey’s HSD test (* p < 0.05 and ** p < 0.01).
Figure 2. Measurement of the total AsA content in the wild type and RNAi lines, Thai rice cultivars and growth stages. (a) The total AsA content in the wild type and RNAi lines in whole leaf; (b) in different parts of leaves including top, middle and base; (c) The total AsA content in KDML, JHN and RD6 in leaves, stems and roots; (d) The total AsA content in KDML in different growth stages including; seed, seedling, 3 weeks, 12 weeks and 20 weeks old in leaves, stems and roots. Bars represent the means and standard errors of three replicates. (a) Asterisk indicates statistically significant differences from Zhonghua17 (wild type) analyzed using Student’s t-test. (b) Asterisk indicates statistically significant differences from wild type in each leave areas analyzed using Student’s t-test. (c,d) Asterisk indicates statistically significant differences from roots analyzed by one-way ANOVA with Tukey’s HSD test (* p < 0.05 and ** p < 0.01).
Agronomy 12 01272 g002
Figure 3. Leaf anatomical features of wild type (WT) and OsVTC1-1 RNAi lines. (a) Transverse paraffin sections of leaves from WT; (b) RI1-2 line; (c) RI1-3 line. (d) Parenchyma thickness; (e) Thickness of large vascular bundle (LVB); (f) Thickness of small vascular bundle (SVB); (g) Distance between adjacent SVBs; (h) Length of the largest bulliform cell; (i) Upper cuticle thickness; (j) Lower cuticle thickness; (k) Upper epidermis thickness; (l) Lower epidermis thickness. BL, bulliform cells; LVB, large vascular bundle; P (white color), parenchyma; SVB, small vascular bundle. Bars represent the means and standard errors of three replicates. Asterisk indicates statistically significant differences from wild type analyzed using Student’s t-test (* p < 0.05, ** p < 0.01).
Figure 3. Leaf anatomical features of wild type (WT) and OsVTC1-1 RNAi lines. (a) Transverse paraffin sections of leaves from WT; (b) RI1-2 line; (c) RI1-3 line. (d) Parenchyma thickness; (e) Thickness of large vascular bundle (LVB); (f) Thickness of small vascular bundle (SVB); (g) Distance between adjacent SVBs; (h) Length of the largest bulliform cell; (i) Upper cuticle thickness; (j) Lower cuticle thickness; (k) Upper epidermis thickness; (l) Lower epidermis thickness. BL, bulliform cells; LVB, large vascular bundle; P (white color), parenchyma; SVB, small vascular bundle. Bars represent the means and standard errors of three replicates. Asterisk indicates statistically significant differences from wild type analyzed using Student’s t-test (* p < 0.05, ** p < 0.01).
Agronomy 12 01272 g003
Figure 4. Cell wall monosaccharide composition (mol%) isolated from 3-week-old wild type (WT) and OsVTC1-1 RNAi lines. (a) xylose; (b) arabinose; (c) galactose; (d) galacturonic acid; (e) fucose; (f) mannose; (g) glucuronic acid. Bars represent the means and standard errors of three replicates. Asterisk indicates statistically significant differences between WT and OsVTC1-1 RNAi lines analyzed using Student’s t-test (* p < 0.05 and ** p < 0.01).
Figure 4. Cell wall monosaccharide composition (mol%) isolated from 3-week-old wild type (WT) and OsVTC1-1 RNAi lines. (a) xylose; (b) arabinose; (c) galactose; (d) galacturonic acid; (e) fucose; (f) mannose; (g) glucuronic acid. Bars represent the means and standard errors of three replicates. Asterisk indicates statistically significant differences between WT and OsVTC1-1 RNAi lines analyzed using Student’s t-test (* p < 0.05 and ** p < 0.01).
Agronomy 12 01272 g004
Figure 5. Venn diagram of wild type (green) proteome overlapped with RI1-2 (blue) and RI1-3 (yellow) lines.
Figure 5. Venn diagram of wild type (green) proteome overlapped with RI1-2 (blue) and RI1-3 (yellow) lines.
Agronomy 12 01272 g005
Table 1. Primer sequences used for qPCR analysis.
Table 1. Primer sequences used for qPCR analysis.
GenesPrimer Sequence (5′-3′)Product Size (bp)Reference
OsVTC1-1Forward: GTCATGTGAACTAACCCTCC229[8]
Reverse: GAGTTTCTTCTGGTCCTCTTG
OsVTC1-3Forward: CATCTCCAGCAGCATCATC239[8]
Reverse: CATCGTCACCACCATGTAAAC
OsVTC1-8Forward: GATTGTCATGTGAAATAATCC144[8]
Reverse: CTCATTGAGAAGCAGTTATG
OsGME1Forward: AGACTTCCACTGACAGGTTTG132[15]
Reverse: TTCCAATGTTCACTGGCTCAC
OsGME2Forward: GATGCCTATGGCTTGGAAAA187[31]
Reverse: CAAAACGGTCAGTGGAGGTT
OsVTC2Forward: GCAACCATCAACCACCTCCA109[15]
Reverse: CACTATTCATTGTGCCCTCAGC
OsVTC4Forward: GTTGGCCTTGAACATGTGTG106This study
Reverse: CCGAAGAATCAGAGCTCCAG
OsGDHForward: AAGGGGAAAAACATTACAAAG146[15]
Reverse: TTATCAATAGCGGAAGTAGACA
OsGPX1Forward: GCTTACTGCATCACTTTGCC76[32]
Reverse: GCAGTCGCAGGTCTCAATAA
OsActinForward: TCCATCTTGGCATCTCTCA337[33]
Reverse: GTACCCTCATCAGGCATCTG
Table 2. Downregulated differentially expressed genes in RI1-2 and RI1-3 as ranked by log2FC value.
Table 2. Downregulated differentially expressed genes in RI1-2 and RI1-3 as ranked by log2FC value.
Downregulated DEGs of RI1-2
No.Gene IDGene DescriptionLog2FC
1OS07G0677200Peroxidase−5.186
2OS07G0432201Similar to thionin-like peptide−4.666
3OS02G0139500Similar to beta-amyrin synthase−3.203
4OS12G0583300Peptidase aspartic, catalytic domain containing protein−3.163
5OS03G0850400Similar to aspartokinase−3.157
6OS09G0294000Similar to bifunctional aspartokinase/homoserine dehydrogenase 2,chloroplast precursor−2.759
7OS10G0562900Non-protein coding transcript−2.656
8OS01G0791033Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit−2.433
9OS12G0628600Similar to thaumatin-like pathogenesis-related protein 3 precursor−2.352
10OS03G0355300Protein of unknown function DUF1618 domain containing protein−2.136
11OS09G0541600Conserved hypothetical protein−2.089
12OS12G0113500Similar to CBL-interacting protein kinase 14−2.045
13OS01G0117200OsRLCK16 Similar to ARK protein (Fragment)−1.984
14OS07G0475900Similar to kinase family protein−1.951
15OS06G0581500Protein kinase, core domain containing protein−1.801
16OS12G0141400Conserved hypothetical protein−1.761
17OS12G0428000Similar to senescence-associated protein DIN1−1.753
18OS03G0805600Similar to pheophorbide a oxygenase−1.514
19OS07G0109700Conserved hypothetical protein−1.421
20OS07G0147500Similar to Photosystem II 10 kDa polypeptide, chloroplast precursor−1.341
21OS01G0762300Similar to predicted protein−1.340
22OS02G0202200SPX domain-containing protein−1.270
23OS08G0117200Similar to 40S ribosomal protein S13 (Fragment)−1.246
24OS10G0465800Similar to 60S ribosomal protein L21−1.229
25OS01G0949300EF-Hand type domain containing protein−1.113
Downregulated DEGs of RI1-3
No.Gene IDGene DescriptionLog2FC
1OS07G0432201Similar to thionin-like peptide−4.554
2OS09G0294000Similar to bifunctional aspartokinase/homoserine dehydrogenase 2,
chloroplast precursor
−2.996
3OS03G0850400Similar to aspartokinase−2.696
4OS06G0685300Similar to predicted protein−2.668
5OS11G0416900ABC transporter-like domain containing protein−2.440
6OS12G0113500Similar to CBL-interacting protein kinase 14−2.434
7OS01G0117200 Similar to ARK protein (Fragment)−2.182
8OS01G0162200Leucine-rich repeat domain containing protein−2.123
9OS07G0475900Similar to kinase family protein−2.089
10OS08G0100300Non-protein coding transcript−1.966
11OS07G0691200Similar to D-alanine--D-alanine ligase B−1.901
12OS06G0581500Protein kinase, core domain containing protein−1.758
13OS12G0141400Conserved hypothetical protein−1.745
14OS07G0663800Similar to oxidoreductase−1.662
15OS01G0762300Similar to predicted protein−1.584
16OS07G0147500Similar to Photosystem II 10 kDa polypeptide, chloroplast precursor−1.431
17OS10G0396300Similar to MOB1 MOB Kinase Activator 1A−1.357
18OS02G0814400Cytochrome c, monohaem domain containing protein−1.275
19OS03G0805600Similar to pheophorbide a oxygenase−1.244
Table 3. Differentially expressed proteins in WT and OsVTC1-1 RNAi lines.
Table 3. Differentially expressed proteins in WT and OsVTC1-1 RNAi lines.
Protein IDProtein NamePeptide SequenceLog2 Protein Abundance
WTRI1-2RI1-3
Q53LQ0Protein disulfide isomerase-like 1-1FLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKK15.6700
Q0JJZ6Anoctamin-like protein LSAPMGTLGR14.9500
O56834Minor outer capsid protein P2NLFSLLQKRK13.8900
Q8W1L6Peroxisomal fatty acid beta-oxidation
multifunctional protein
MNKAMSLLKGALDYSDFK13.6600
Q5QN75Mitogen-activated protein kinase RGKKPHK13.5900
Q84UP7Mixed-linked glucan synthase 6 SHPYMGRAQEEFVNDRR12.3800
C7J0A2DNA topoisomerase 3-alpha ASRYFRMSSEHTMK12.0300
Q9SQX9NAC domain containing protein 50 NASGQAS014.8814.80
Q6ETL8Very-long-chain aldehyde decarbonylaseLAAMRLPK013.1913.43
Q0JMH02-hydroxyacyl-CoA lyase ARDNVLKMEAQLAK015.5815.05
B9FMJ3Kinesin-like protein KIN-13A LARFQHRLK013.8514.66
Q0IZQ2Cysteine-tRNA ligase QYEKSDEIR012.4714.73
Q9AV50Double-stranded RNA-binding protein 6 ILPLFRPKSNSR016.4914.17
Q6K4V3Zinc finger CCCH domain-containing
protein 15
APSSTSK015.2214.92
Q9SP32Endoribonuclease dicer homolog 1 AEENKSKPEER014.7014.53
Q7FAD5Synaptonemal complex protein ZEP1ARLLYVDSRLECMEQELK12.4915.8215.43
Q6ZCZ2Brassinosteroid LRR receptor kinase BRL3NFARQSVFLAVTLSVLILFSLLIIHYKLWK11.7014.5614.02
Q0DV66Pheophorbide a oxygenaseAWWQLVPR14.2114.2612.17
Q0D5P3Formin-like protein 11 EASKVAPVK11.6214.1114.05
Q7XD96Endoribonuclease ASLCLHMSYFK12.2013.7814.07
Q67W65Transcription initiation factor TFIID
subunit 1
EDELQKAK13.8612.7213.59
Q6YUL8Kinesin-like protein KIN-4A ARNIQNKPIVNR14.76011.32
O24230Expansin-B2 MAGASAK14.52014.70
Q6ZJJ0Beta-galactosidase 11 DLHHALR13.713.20
Q2QNS6Cellulose synthase-like protein D4 LLIAIRLVALGFFLAWRIR12.9313.190
Q5Z6E5Cellulose synthase-like protein D5 ICYIQFPQRFEGIDPSDR10.74013.02
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Lamanchai, K.; Salmon, D.L.; Smirnoff, N.; Sutthinon, P.; Roytrakul, S.; Leetanasaksakul, K.; Kittisenachai, S.; Jantasuriyarat, C. OsVTC1-1 RNAi Mutant with Reduction of Ascorbic Acid Synthesis Alters Cell Wall Sugar Composition and Cell Wall-Associated Proteins. Agronomy 2022, 12, 1272. https://doi.org/10.3390/agronomy12061272

AMA Style

Lamanchai K, Salmon DL, Smirnoff N, Sutthinon P, Roytrakul S, Leetanasaksakul K, Kittisenachai S, Jantasuriyarat C. OsVTC1-1 RNAi Mutant with Reduction of Ascorbic Acid Synthesis Alters Cell Wall Sugar Composition and Cell Wall-Associated Proteins. Agronomy. 2022; 12(6):1272. https://doi.org/10.3390/agronomy12061272

Chicago/Turabian Style

Lamanchai, Kanyanat, Deborah L. Salmon, Nicholas Smirnoff, Pornsawan Sutthinon, Sittiruk Roytrakul, Kantinan Leetanasaksakul, Suthathip Kittisenachai, and Chatchawan Jantasuriyarat. 2022. "OsVTC1-1 RNAi Mutant with Reduction of Ascorbic Acid Synthesis Alters Cell Wall Sugar Composition and Cell Wall-Associated Proteins" Agronomy 12, no. 6: 1272. https://doi.org/10.3390/agronomy12061272

APA Style

Lamanchai, K., Salmon, D. L., Smirnoff, N., Sutthinon, P., Roytrakul, S., Leetanasaksakul, K., Kittisenachai, S., & Jantasuriyarat, C. (2022). OsVTC1-1 RNAi Mutant with Reduction of Ascorbic Acid Synthesis Alters Cell Wall Sugar Composition and Cell Wall-Associated Proteins. Agronomy, 12(6), 1272. https://doi.org/10.3390/agronomy12061272

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop