Next Article in Journal
Histology Classification Highlights Differences in Efficacy of S-1 versus Capecitabine, in Combination with Cisplatin, for HER2-Negative Unresectable Advanced or Recurrent Gastric Cancer with Measurable Disease
Previous Article in Journal
Activated Eosinophils Predict Longer Progression-Free Survival under Immune Checkpoint Inhibition in Melanoma
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Cancers
Volume 14
Issue 22
10.3390/cancers14225678
cancers-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Combined Vaccination with B Cell Peptides Targeting Her-2/neu and Immune Checkpoints as Emerging Treatment Option in Cancer

by
Joshua Tobias
1,*,
Mirjana Drinić
1,
Anna Schmid
1,
Anastasiya Hladik
2,
Martin L. Watzenböck
2,
Claire Battin
3,
Erika Garner-Spitzer
1,
Peter Steinberger
3,
Michael Kundi
4,
Sylvia Knapp
2,
Christoph C. Zielinski
5 and
Ursula Wiedermann
1,*
1
Center for Pathophysiology, Infectiology and Immunology, Institute of Specific Prophylaxis and Tropical Medicine, Medical University of Vienna, 1090 Vienna, Austria
2
Department of Medicine I, Research Division of Infection Biology, Medical University of Vienna, 1090 Vienna, Austria
3
Center for Pathophysiology, Infectiology and Immunology, Division of Immune Receptors and T Cell Activation, Institute of Immunology, Medical University of Vienna, 1090 Vienna, Austria
4
Department of Environmental Health, Center for Public Health, Medical University of Vienna, 1090 Vienna, Austria
5
Central European Cancer Center, Wiener Privatklinik and Central European Cooperative Oncology Group (CECOG), 1090 Vienna, Austria
*
Authors to whom correspondence should be addressed.
Cancers 2022, 14(22), 5678; https://doi.org/10.3390/cancers14225678
Submission received: 12 October 2022 / Revised: 7 November 2022 / Accepted: 12 November 2022 / Published: 18 November 2022
(This article belongs to the Section Cancer Immunology and Immunotherapy)
Browse Figures
Versions Notes

Abstract

:

Simple Summary

Therapies with monoclonal antibodies (mAbs) targeting tumor-associated antigens (TAAs) or immune checkpoint inhibitors (ICIs) have revolutionized cancer treatment. Nevertheless, the inevitable development of resistance and the failure to respond are among this approach’s disadvantages, limiting the duration of disease- or progression-free and overall survival. As an alternative to therapeutically efficacious monoclonal antibodies, the concept of active immunization with vaccines has been repeatedly discussed. In particular, mimotopes, representing the B cell epitope of therapeutic mAbs, have been shown to induce immunological memory and effectively produce antibodies with similar functionality to the respective mAbs/ICIs. This review focuses on a new frontier of vaccinations directed against two cancer-relevant targets, addresses concerns about the safety of active immunization targeting PD-1 and discusses limitations and outlooks.

Abstract

The application of monoclonal antibodies (mAbs), targeting tumor-associated (TAAs) or tumor-specific antigens or immune checkpoints (ICs), has shown tremendous success in cancer therapy. However, the application of mAbs suffers from a series of limitations, including the necessity of frequent administration, the limited duration of clinical response and the emergence of frequently pronounced immune-related adverse events. However, the introduction of mAbs has also resulted in a multitude of novel developments for the treatment of cancers, including vaccinations against various tumor cell-associated epitopes. Here, we reviewed recent clinical trials involving combination therapies with mAbs targeting the PD-1/PD-L1 axis and Her-2/neu, which was chosen as a paradigm for a clinically highly relevant TAA. Our recent findings from murine immunizations against the PD-1 pathway and Her-2/neu with peptides representing the mimotopes/B cell peptides of therapeutic antibodies targeting these molecules are an important focus of the present review. Moreover, concerns regarding the safety of vaccination approaches targeting PD-1, in the context of the continuing immune response, as a result of induced immunological memory, are also addressed. Hence, we describe a new frontier of cancer treatment by active immunization using combined mimotopes/B cell peptides aimed at various targets relevant to cancer biology.

1. Introduction

A range of cancer immunotherapy approaches enabling and reactivating the patient’s anti-tumor immune response have shown remarkable advances in recent years [1,2]. The application of therapeutic and tumor-targeting monoclonal antibodies (mAbs), possessing an intrinsic antineoplastic activity, represents the passive form of immunotherapy [3,4,5,6]. Contrarily, anticancer vaccines enhance the activation of the host’s immune system [7,8], referred to as active immunotherapy. Cancer immunotherapy based on the application of mAbs has been successfully established in recent years [9,10,11,12,13]; however, tumor heterogeneity, intra-tumoral factors, the interaction between cancer cells and the immune system, as well as the tumor microenvironment, are amongst factors limiting the efficacy of therapeutically applied monoclonal antibodies [14].
The interaction between T cell receptors and antigens presented in the context of MHC molecules and costimulatory receptors (such as CD28 or CD86) results in the activation of T cells [15]. However, co-inhibitory receptors on T cells result in counterbalanced stimulatory signals. Such co-inhibitory molecules, i.e., immune checkpoints (ICs) include programmed cell death 1 (PD-1), which binds to PD-L1 (B7-H1 or CD274) and PD-L2 (B7-DC or CD273), and cytotoxic T lymphocyte antigen 4 (CTLA-4), which interacts with CD80 or CD86 [16,17,18,19]. Preclinical and clinical evidence has repeatedly demonstrated the ability of tumors to escape immunosurveillance via the expression of surface ligands that engage inhibitory receptors on tumor-specific T cells, thus, resulting in immune tolerance and failure to induce tumor cell death due to T cell anergy/exhaustion [7,20]. Consequently, the blockade of the PD-1/PD-L1 interaction by various mAbs, i.e., immune checkpoint inhibitors (ICIs) [6,21,22,23], which target PD-1 (e.g., nivolumab, pembrolizumab and cemiplimab), PD-L1 (e.g., atezolizumab, avelumab and durvalumab) or CTLA-4 (ipilimumab and tremelimumab) [23,24,25], is considered a milestone in cancer treatment. This has been registered in manifold indications [26,27,28], for example, in the treatment of gastroesophageal cancer [29], hepatocellular carcinoma [30], cervical cancer [31], head and neck cancer [32], urothelial carcinoma [33] and lymphoma [34]. Treatment with ICIs still holds tremendous promise, be it as monotherapy or in combination with either chemotherapy, targeted therapies or other immunomodulatory compounds [35].
Her-2/neu, a 185 kDa transmembrane protein, is a member of the human epidermal growth factor receptors (EGFR) family, and its overexpression has been demonstrated in approximately 15–30% of breast and gastric cancers [36,37,38,39,40,41,42]. The receptor is an attractive tumor-associated antigen (TAA) for cancer therapy due to the association of Her-2/neu overexpression with an aggressive biological cancer phenotype and reduced survival in patients with Her-2/neu-positive tumors, as well as improvable response to traditional chemotherapy and, consequently, poor prognosis [42,43,44,45,46]. The extracellular domain of Her-2/neu is divided into four subdomains (I, II, III, IV), with its intracellular domain exhibiting tyrosine kinase activity similar to the other receptors in this family, i.e., Her-1 or EGFR, Her-3 and Her-4 [47,48]. Because no ligand has been identified for Her-2/neu and it is in a constitutively active conformation, the receptor is a preferred partner for dimerization with other members via the dimerization loop located on its extracellular subdomain II. Once paired, the tyrosine residues on the receptor’s intracellular domains are mutually phosphorylated, leading to the initiation of signaling pathways, including the phosphatidylinositol 3-kinase/protein kinase B (PI3K/Akt) pathway, and, consequently, tumor cell proliferation, angiogenesis, invasion and metastasis [49,50,51,52]. By way of different mechanisms, such as antibody-dependent cellular cytotoxicity (ADCC), dimerization inhibition in a ligand-independent manner, the receptor’s degradation and/or internalization and PI3K–AKT signaling pathway inhibition, the first FDA-approved anti-Her-2/neu humanized mAb, trastuzumab, interferes with Her-2/neu signaling [53,54] (Figure 1). The initial therapeutic effect evaluation of trastuzumab showed that treatment with mAb after adjuvant chemotherapy improved overall survival (OS) in women with Her-2/neu-positive metastatic breast cancer [55] and resulted in significantly improved disease-free survival one year after the treatment [56]. As a standard first line of care, trastuzumab is used for the treatment of both early-stage and metastatic Her-2/neu-positive breast cancer. Differing from trastuzumab in its mechanisms of action, pertuzumab, the second FDA-approved anti-Her-2/neu mAb, which is used for the treatment of Her-2/neu-positive metastatic breast cancer, targets the dimerization domain/loop of Her-2/neu and, consequently, results in the inhibition of the receptor’s ligand-induced/dependent dimerization [57,58] (Figure 1). Therefore, by complementary mechanisms of action and in a synergistic manner, which results in a maximal blockade of the Her-2/neu oncogenic pathway [58], the inhibition of tumor growth by the combination of trastuzumab and pertuzumab in both in vitro and in vivo preclinical models has been shown [59,60]. The addition of pertuzumab to trastuzumab and docetaxel was shown in the phase III CLEOPATRA trial to significantly prolong median OS by 15.7 months compared to placebo plus trastuzumab and docetaxel [61].
ICIs have been proposed to strengthen an emerging immune response following vaccination against TAAs. Here, we summarize the latest reports on the application of Her-2/neu-targeting mAbs and ICIs and vaccination strategies for targeting Her-2/neu and immune checkpoints.

2. Combination of Her-2/neu-Targeted Therapy with Immune Checkpoint Blockade

2.1. Basic Considerations

Trastuzumab’s capacity in upregulating PD-L1 expression, by the recruitment of IFNgamma-secreting immune effector cells, has been shown as a mechanism of resistance to trastuzumab [63]. Furthermore, the mAbs that are bound to tumor cells engage innate immune effector cells via their Fc receptor, resulting in ADCC [64,65], which in turn also results in the upregulation of PD-L1 [66]. It has been shown that the increased ability of tumor cells to evade the immune system is attributed to their PD-L1 expression capacity, allowing their interaction with PD-1-expressing immune cells [67]. Because the application of ICIs aims to inhibit the interaction of PD-1 with PD-L1 and increase T cell survival and proliferation, consequently leading to an enhanced tumor-directed immune response, it has been suggested that combining ICIs with anti-Her-2/neu mAbs, such as Trastuzumab, could act in a synergistic manner to delay or even prevent resistance to the mAb [68]. Thus, the progression of Her-2/neu-positive metastatic breast cancer, as a result of primary or secondary resistance to Her-2/neu-targeted therapies with trastuzumab [69], might be hindered by combining with an immune checkpoint blockade [70,71].

2.2. Clinical Trials for Combination Therapies of Her-2/neu-Targeting Compounds plus ICIs

A phase II trial (ClinicalTrials.gov Identifier: NCT02129556) enrolled 52 patients with advanced Her-2/neu-positive breast cancer who had progressed on trastuzumab treatment [72] (Table 1). Patients received anti-PD-1 mAb pembrolizumab and standard trastuzumab. Patients with PD-L1-positive tumors demonstrated a disease control rate of 25% (90% CI, 14–39), with a 12-month progression-free survival (PFS) and OS of 12% and 65%, respectively, whereas patients with PD-L1-negative tumors did not experience a benefit from such treatment. The results from this trial were promising and indicated that Her-2/neu-positive PD-L1 overexpressing breast cancer patients benefited from anti-PD-1 therapy [72]. In a recently completed randomized phase II trial (ClinicalTrials.gov Identifier: NCT02924883), the addition of anti-PD-L1 mAb atezolizumab to T-DM1 (trastuzumab covalently linked to the cytotoxic agent DM1) [73] was evaluated in patients with unresectable or metastatic Her-2/neu-positive breast cancer who had received prior trastuzumab- and taxane-based therapy [74] (Table 1). Patients with PD-L1-positive breast cancers from the atezolizumab group had longer PFS than those with PD-L1-negative tumors. Furthermore, patients in the atezolizumab group whose tumors had ≥ 5% infiltrating-tumor lymphocytes (TILs) had longer PFS than patients with a TILs of <5% [74]. On the basis of the results of this trial, a randomized phase III trial (ClinicalTrials.gov Identifier: NCT04873362; Table 1) is now being conducted to evaluate T-DM1 ± atezolizumab in PD-L1 overexpressing breast cancers with residual invasive Her-2/neu-positive breast cancer following neoadjuvant taxane-based and Her-2/neu-targeted therapy.
As also shown in the case of other types of cancer [75], patients with PD-L1-positive tumors may potentially benefit more from PD-1 or PD-L1 inhibition than those with PD-L1-negative tumors. Ongoing trials aim to evaluate PD-1-, PD-L1- or CTLA4-targeting ICIs in combination with standard anti-Her-2/neu therapy for Her-2/neu-positive breast cancer (Table 1).
Table
Table 1. List of main completed/active/recruiting clinical trials with ICIs and anti-Her-2/neu-targeted therapies, with or without combination with biological drugs.
Table 1. List of main completed/active/recruiting clinical trials with ICIs and anti-Her-2/neu-targeted therapies, with or without combination with biological drugs.
Evaluated DrugsCondition/DiseasePhaseStatusNCT/
Trial’s
Identifier		SettingReference
Anti-Her-2 mAbICIBiological/
Other Drug
-AvelumabTaxane and anthracyclineMetastatic or locally advanced solid tumorsICompletedNCT01772004Dose escalation trial[76]
Trastuzumab, pertuzumab and trastuzumab emtansineAtezolizumabCarboplatin, docetaxel, doxorubicin and cyclophosphamideHer-2/neu-positive and negative metastatic breast cancer and locally advanced early breast cancerICompletedNCT02605915Two cohorts with several arms, which evaluated the different combinations of the examined drugs[77]
TrastuzumabPembrolizumab Advanced, trastuzumab-resistant Her-2/neu-positive metastatic breast cancerIb, IICompletedNCT02129556
(PANACEA)		trastuzumab with pembrolizumab[72]
Trastuzumab emtansineAtezolizumab Her-2/neu-positive locally advanced or metastatic breast cancerIICompletedNCT02924883Arm 1:
trastuzumab emtansine and placebo
Arm 2:
trastuzumab emtansine and atezolizumab		[74]
Trastuzumab and pertuzumabAtezolizumab Her-2/neu-positive metastatic breast cancer that has spread to the brainIIActiveNCT03417544Arm:
trastuzumab,
pertuzumab and
atezolizumab		Clinicaltrials.gov
Trastuzumab and pertuzumabAtezolizumabDoxorubicin, cyclophosphamid and paclitaxelEarly Her-2/neu-positive breast cancerIIIActiveNCT03726879Arm 1:
placebo, doxorubicin,
cyclophosphamide, paclitaxel,
trastuzumab, pertuzumab and
trastuzumab emtansine
Arm 2:
atezolizumab, doxorubicin,
cyclophosphamide, paclitaxel,
trastuzumab, pertuzumab and
trastuzumab emtansine		Clinicaltrials.gov
Trastuzumab and
pertuzumab		AtezolizumabTaxane,
paclitaxel and docetaxel		Neoadjuvant treatment of Her-2/neu-positive early high-risk and locally advanced breast cancerIIIActiveNCT03595592Arm 1:
trastuzumab, pertuzumab,
paclitaxel and carboplatin
Arm 2:
trastuzumab, pertuzumab,
paclitaxel, carboplatin,
doxorubicin, cyclophosphamide and atezolizumab
Arm 3:
trastuzumab, pertuzumab,
paclitaxel, carboplatin and atezolizumab		Clinicaltrials.gov
Trastuzumab and pertuzumabAtezolizumabTaxane,
paclitaxel and docetaxel		Her-2/neu-positive metastatic breast cancerIIIActiveNCT03199885Arm 1:
trastuzumab, pertuzumab, taxane therapy and placebo
Arm 2:
trastuzumab, pertuzumab, taxane therapy and atezolizumab		Clinicaltrials.gov
Trastuzumab deruxtecan
(T-DXd), trastuzumab and pertuzumab		DurvalumabDeruxtecan,
paclitaxel and tucatinib		Her-2/neu-positive metastatic breast cancer, without (part 1) or with brain metastases (part 2)I, IIRecruitingNCT04538742Part 1:
Arm 1:
T-DXd
Arm 2:
T-DXd and durvalumab
Arm 3:
T-DXd and pertuzumab
Arm 4:
T-DXd and paclitaxel
Arm 5:
T-DXd and durvalumab and paclitaxel
Arm 6:
T-DXd and tucatinib
Part 2:
Arm 7:
T-DXd
Arm 8:
T-DXd and tucatinib		Clinicaltrials.gov
VRP-Her-2/neu and pembrolizumab Patients with Her-2/neu breast cancerIIRecruitingNCT03632941Arm 1:
VRP-Her-2/neu vaccine
Arm 2:
pembrolizumab
Arm 3:
VRP-Her-2/neu vaccine and pembrolizumab		[78]
TrastuzumabAtezolizumabVinorelbineHer-2/neu-positive advanced/
metastatic breast cancer		IIRecruitingNCT04759248Arm:
trastuzumab, atezolizumab and vinorelbine		Clinicaltrials.gov
TrastuzumabTremelimumab and
durvalumab		 Her-2/neu-positive metastatic breast cancerIIRecruitingBCT 1703Arm:
durvalumab, tremelimumab and trastuzumab		breastcancertrials.org.au
TrastuzumabAvelumab and
utomilumab [79]		VinorelbineAdvanced Her-2/neu-positive breast cancerIIRecruitingNCT03414658Arm 1:
trastuzumab and vinorelbine
Arm 2:
trastuzumab, vinorelbine and avelumab
Arm 3:
trastuzumab, vinorelbine, avelumab and utomilumab
Arm 4:
trastuzumab, avelumab and utomilumab		Clinicaltrials.gov
Trastuzumab and
pertuzumab		PembrolizumabPaclitaxelChemo naive patients with invasive Her-2/neu-positive breast cancerIIRecruitingNCT03747120Arm 1:
trastuzumab, pertuzumab and
paclitaxel
Arm 2: trastuzumab,
pertuzumab, pembrolizumab and paclitaxel
Arm 3: trastuzumab, pembrolizumab and paclitaxel		Clinicaltrials.gov
Trastuzumab emtansineAtezolizumab Her-2/neu-positive breast cancer at high risk of recurrence following preoperative therapyIIIRecruitingNCT04873362Arm 1:
placebo and trastuzumab emtansine
Arm 2: atezolizumab and trastuzumab emtansine		Clinicaltrials.gov
Trastuzumab emtansineAtezolizumab Her-2/neu-positive and PD-L1-positive locally advanced or metastatic breast cancerIIIRecruitingNCT04740918Arm 1:
T-DM1 and placebo
Arm 2:
T-DM1 and atezolizumab		Clinicaltrials.gov
Trastuzumab emtansineAtezolizumab Her-2/neu-positive primary breast cancerIIIRecruitingNCT04873362Arm 1:
trastuzumab emtansine and placebo
Arm 2:
trastuzumab emtansine and atezolizumab		Clinicaltrials.gov
ICI: Immune Checkpoint Inhibitor; and VRP-Her-2/neu: virus-like replicon particles (VRP) packaged with an alphaviral vector encoding the extracellular domain and transmembrane regions of Her-2/neu.

2.3. B Cell Peptides/Mimotopes-Based Vaccination Targeting Her-2/neu and ICs

Despite tremendous therapeutic success with the use of mAbs, their continuous application over a long period, their half-life [80] and lack of capacity to induce immunological memory [81] may limit the duration of therapy, resulting in only temporary disease control, in particular, once the tumor has metastasized [82,83,84,85,86,87,88,89]. Further drawbacks of treatments with mAbs include the high frequencies of non-responsiveness [90], the development of resistance [91], and immune-related adverse events and hypersensitivity to treatments with mAbs [92,93], possibly due to the high doses of mAbs that ensure their immediate therapeutic effect [94,95]. In contrast, vaccines based on TAAs or mimotopes representing therapeutic mAb binding epitopes can induce prolonged activation of the immune system and mount immunological memory, which, in association with booster vaccinations, potentially results in tumor involution [96].
Mimotopes are peptides that mimic and represent the immunodominant epitopes on a target protein (TAA or tumor-specific antigens) or the binding epitopes of therapeutic mAbs [97]. Mimotopes identified by antibodies or therapeutic mAbs are solely a representation of the antibodies’ B cell epitopes and, thus, are considered as B cell peptides. Such mimotopes, consequently, not only inhibit the binding of the antibodies to the respective antigen or protein but also, upon conjugation to an immunogenic carrier protein, induce an epitope-specific antibody response. As depicted in Figure 1, the application of mAbs represents the passive immunotherapy approach, while vaccination with B cell peptides/mimotopes is the active immunotherapy approach (Figure 2). Endogenously generated antibodies after vaccination can induce anti-tumor responses for prolonged periods of time by the induction of immunological memory [98].
The identification of mimotopes can be based on the use of phase display strategies [99,100] or, alternatively, as applied in our group, by computer algorithms or the use of synthesized overlapping bio-peptides from the sequence of the respective protein [62,101,102,103]. The peptides are screened and the mimotope candidates are selected based on their capacity to inhibit the binding of the examined mAb to the respective protein [62,101,102,104]. For the evaluation of immunogenicity by vaccination strategy and the anti-tumor effect, the mimotopes (B cell peptides) are conjugated to a carrier protein and administered together with an adjuvant [62,101,102,104] (Figure 2). Mimotopes have demonstrated a promising approach in the field of allergy [105,106], infectious diseases [107,108,109] and for cancer therapy, by inducing an anti-tumor effect targeting PD-1 [101], and Her-2/neu-expressing solid tumors [62,100] and lung metastasis [62,102]. The use of overlapping peptides as mimotopes with T cell immunodominant epitopes has also been evaluated in a phase I immunotherapeutic trial against human papillomavirus 16, and shown tolerability and the induction of the T cell response, even in the patients with end-stage disease [110].
Cancers 14 05678 g002 550
Figure 2. Schematic description of active immunotherapy with B cell peptides/mimotopes representing the B cell epitopes of therapeutic mAbs on TAAs, for example, a B cell peptide/mimotope of pertuzumab. The binding epitope of pertuzumab indicates the mAb B cell epitope on Her-2/neu. B cell peptides/mimotopes representing the mAb binding epitopes are identified, as described in the text and previously [62,101,102,103]. The selected B cell peptide/mimotope of the mAbs is conjugated to an immunogenic carrier protein, and an admixture-based vaccine comprising the conjugate and an adjuvant is then formulated. The formulated vaccine directly activates B cells for the production of antibodies in the host. The production of the antibodies is also induced further by the presence of T cell epitopes in the carrier protein, resulting in stimulation of T cells and further activation of B cells. The endogenously produced antibodies have the same functionality and modes of action as the respective therapeutic mAbs, such as pertuzumab. Adapted with permission from Ref. [62]. Elsevier, 2022.
Figure 2. Schematic description of active immunotherapy with B cell peptides/mimotopes representing the B cell epitopes of therapeutic mAbs on TAAs, for example, a B cell peptide/mimotope of pertuzumab. The binding epitope of pertuzumab indicates the mAb B cell epitope on Her-2/neu. B cell peptides/mimotopes representing the mAb binding epitopes are identified, as described in the text and previously [62,101,102,103]. The selected B cell peptide/mimotope of the mAbs is conjugated to an immunogenic carrier protein, and an admixture-based vaccine comprising the conjugate and an adjuvant is then formulated. The formulated vaccine directly activates B cells for the production of antibodies in the host. The production of the antibodies is also induced further by the presence of T cell epitopes in the carrier protein, resulting in stimulation of T cells and further activation of B cells. The endogenously produced antibodies have the same functionality and modes of action as the respective therapeutic mAbs, such as pertuzumab. Adapted with permission from Ref. [62]. Elsevier, 2022.
Cancers 14 05678 g002

2.3.1. Her-2/neu B Cell Peptide/Mimotope

In line with active immunization/vaccination with B cell peptides [8,62,101,102,103], we have formulated the anti-Her-2/neu vaccine HER-Vaxx [111] consisting of a hybrid peptide (P467) [111,112]. The cross-reacting material CRM197, a mutated and nontoxic form of diphtheria toxin [113] with the capacity to activate B cells and CD4+ T cells with a heterogeneous Th1 and Th2 cytokine profile [114], is used as a carrier protein conjugated to the peptide, and the conjugate is administered with the Th1/Th2-driving adjuvant Montanide (ISA-51-VG) [62,102,103,111,115,116]. The Her-2/neu-directed B cell peptide-based vaccine HER-Vaxx has been evaluated in an array of preclinical experiments [102,111,112,117]. In phase 1b and Phase II trials involving patients suffering from Her-2/neu overexpressing metastatic or advanced adenocarcinoma of the stomach the vaccine was shown to be safe, immunogenic, and to prolong progression-free survival [118,119,120].
Given that, in Her-2/neu-positive metastatic breast cancer patients, the combined treatment of trastuzumab with pertuzumab has established an incredible achievement, and to broaden the binding spectrum of the induced antibodies by our vaccine, we recently constructed a multi-peptide B cell vaccine comprising HER-Vaxx and pertuzumab’s mimotope (HSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPY; amino acids (AAs) 260–301, Uniprot P04626) and tested its capacity to prevent the formation of metastases in a mouse model with Her-2/neu lung metastases [62,102]. Active immunization with the multi-peptide vaccine combining HER-Vaxx and the mimotope of pertuzumab resulted in a significant reduction of lung metastasis formation, reflected by the reduction of lung weight and the size of the metastases, which was shown to be prominently associated with the formation of Her-2/neu-negative tumors with increased PD-L1 expression [102]. Because ICIs have been proposed to strengthen an emerging immune response following vaccination against TAAs, this observation suggests that a combination of a multi-peptide B cell Her-2/neu vaccine together with anti-PD-L1 ICI or active immunization with a mimotope from PD-L1 might serve as a suitable intervention to prevent metastasis formation.

2.3.2. PD-L1 B Cell Peptide/Mimotope

We recently used avelumab as one of the therapeutic mAbs targeting PD-L1 to identify its mimotope. On the basis of the crystal structure of human PD-L1 (hPD-L1) complexed with the single-chain Fv fragment of avelumab, it has been shown that the mAb binds to the IgV domain of the immune checkpoint [121]. By applying our platform for the identification of avelumab mimotope [101], 20-mer overlapping peptides spanning the IgV domain of hPD-L1 were tested and two B cell epitopes (EKQLDLAALIVYWEMEDKNIIQFVH, AAs 45-69; VYRCMISYGGADYKR, AAs 111–125; Uniprot Q9NZQ7) were selected. The peptide ‘hybrid hPDL1-mimotope’ consisting of the two mimotopes linked with a flexible glycine linker (GGGG) was generated. A cellular binding assay [122] using Jurkat reporter cells expressing hPD-L1 was employed to examine the inhibitory capacity of the hybrid peptide. As shown in Figure 3, avelumab alone could effectively bind to hPD-L1-expressing Jurkat cells. However, pre-incubation of the mAb with the peptide dose-dependently inhibited the binding of the mAb. On the basis of these data, in vivo investigations are ongoing to examine the effect of vaccination/active immunization with the hybrid peptide on inducing anti-tumor effects in a mouse model with syngeneic tumors expressing Her-2/neu [101].

2.3.3. PD-1 B Cell Peptide/Mimotope

An alternative approach to target the PD-1/PD-L1 axis and block their interaction is by targeting PD-1. The sequences of human PD-1 (hPD-1) and mouse PD-1 (mPD-1) were used to identify the mimotopes JT-N1 (PGWFLDSPDRPWNPP; AAs 21–35, Uniprot Q15116) and JT-mPD1 (ISLHPKAKIEESPGA; AAs 126–140, Uniprot Q02242), respectively, and we have presented, for the first time, the concept of targeting PD-1 by vaccination using mimotopes [101,103]. A strong induced anti-tumor effect in vivo, to an extent similar to the corresponding mAb, was shown after active immunization with the mimotope [101]. The combination of the mimotope JT-mPD1 with the anti-Her-2/neu vaccine HER-Vaxx [111,120] led to an increase in the HER-Vaxx-generated anti-tumor effect [101]. In that manner, a strong anti-tumor effect in vivo was also shown by a peptide (PD-1-Vaxx) residing at the position 92–101 of hPD-1 [123]; the safety, tolerability and immunogenicity of the peptide as monotherapy in patients with PD-L1 expressing non-small cell lung cancer (NSCLC) is being evaluated in a phase I clinical trial [124].
The use of ICIs is often hampered by immune-related adverse events (irAEs) and hypersensitivity [92,93,125,126]. As mentioned above, vaccination with mimotopes/B cell peptides results in immunological memory. With this approach, targeting PD-1 or PD-L1 may result in the continuous inhibition of the PD-1/PD-L1 interaction and, thus, increased irAEs. Therefore, we were prompted to evaluate the safety of this approach in an influenza infection mouse model, as described in the next section.

2.3.4. Safety of B Cell Peptide/Mimotope-Based Vaccination Targeting PD-1

In 2018, a small study reported an unexpectedly high incidence (52% of 23 patients) of irAEs in influenza-vaccinated patients receiving anti-PD-1 inhibitors [127]. However, in a larger study with 127 lung cancer patients receiving nivolumab therapy, 47 patients who received vaccinations against influenza showed no difference in incidence or severity of irAEs [128]. In a retrospective study involving 370 patients receiving ICI therapy (nivolumab and pembrolizumab), 20% experienced an irAE of any grade [129]. These results were confirmed by a follow-up study [130]. Furthermore, in a small study involving 24 patients treated with anti-PD-1 or PD-L1 mAbs, the majority of the irAEs following vaccination with inactivated influenza vaccine were graded 1–2, therefore not requiring a change of ICI therapy [131]. Taken together, these results did not raise safety concerns regarding the application of an influenza vaccination in combination with ICI treatment. Nevertheless, we made use of the described observations and examined whether active immunization with a mimotope targeting PD-1 could affect the antiviral immune response. As described in Figure S1, an influenza infection model was established in BALB/c mice. A selected dose of 50 plaque-forming units (PFU) was used to examine whether active immunization with the mimotope from mouse PD-1 or treatment with the corresponding mAb (ICI) enhanced the antiviral cellular immune response. Following active immunization with the mimotope (JT-mPD1) or, for comparison, after the application of a functional anti-mouse PD-1 mAb, which was used for the identification of the mimotope [101], mice were infected with the influenza virus strain (A/PR/8/34) and sacrificed on days five and nine post-infection for clinical and immunological evaluations (Figure S2A).
As shown in Figure 4, the viral infection resulted in a significant decrease in body weight in all the infected mice around the peak day (day eight) of the infection. However, the observed body weight reduction was similar in all the infected groups, indicating that neither active immunizations with the mimotope nor the application of the corresponding mAb were associated with increased disease severity.
The level of viral load in the lungs of the infected mice was assessed based on the mRNA level of the influenza A virus matrix protein gene (M) and showed no significant difference between the viral loads in the infected groups of mice (Figure S2B).
Active immunization with the mimotope induced PD-1-specific serum IgG antibody response in the immunized mice, detected on days five and nine post-infection (Figure S2C). An induction of PD-1-specific serum IgG antibody response was also observed on day nine but not on day five post-infection in mice treated with the mAb (a rat anti-mouse PD-1 antibody) (Figure S2C). A similar observation was shown in clinical settings with patients treated with Nivolumab or Pembrolizumab [132], which might be attributed to a gradual induction of serum Abs against secreted soluble PD-1 as a consequence of the anti-PD-1 treatment. The evaluation of lymphoid (Figure S3A,B) and myeloid (Figure S4) cell populations, the mRNA level of the Th1 cytokine IFNgamma and the pro-inflammatory cytokines IL-6 and TNF (Figure S5) showed no significant difference between the infected mice, which were either untreated, actively immunized with the mimotope from PD-1 or treated with an anti-mPD-1 mAb. Overall, these findings suggest that active immunization with the mimotope is safe and is not associated with increased inflammatory responses, i.e., increased weight loss, an elevated influx of inflammatory immune cells or higher levels of pro-inflammatory cytokines.

3. Further Compounds for Targeting Her-2/neu and ICs by Active and Passive Immunotherapies

As described above, the Her-2/neu-directed trastuzumab and pertuzumab have shown a tremendous effect in the clinic. However, the resistance to treatment with such mAbs has resulted in the development of additional mAbs. Increased trastuzumab-mediated ADCC has been shown as a result of polymorphism in the Fc receptors (FcγRs) of IgGs expressed on cytotoxic cells, affecting the ADDC capacity of the respective mAbs [133]. Accordingly, a chimeric anti-Her-2 mAb, margetuximab (MGAH22), with an Fc domain modification for improved binding to FcγRIIIa was constructed [134]. On the basis of a first-in-human phase 1 study of margetuximab, in patients with Her-2/neu-positive advanced solid tumors, the mAb exhibited safety and an anti-tumor effect [135], and, in a phase 3 trial, the treatment with the mAb was associated with improved clinical outcomes in FcγRIIIa 158F allele carriers [136]. An FDA-approved trastuzumab-based drug conjugate, as a second-line therapy for the treatment of Her-2/neu-positive metastatic breast cancer patients with disease progression, is T-DM1 (Kadcyla®, Roche Pharma AG, Grenzach-Wyhlen, Germany), which is comprised of the mAb conjugated to DM1 (emtansine) [137,138]. In addition to retaining the ADCC activity of the mAb, the drug results in a cytotoxic effect by the delivered microtubule-inhibitory agent DM1 (derivative of maytansine) [137].
The tremendous success of the application of ICIs is also evident, as described above and by others [139,140,141]. However, the development of irAEs, fatal toxicities and resistance are the significant drawbacks of treatments with ICIs therapy [142,143], with the latter drawback often associated with decreased or loss of neoantigens immunogenicity, increased levels of immunosuppressive immune cells and also the upregulation of other ICs [144]. Therefore, targeting newer ICs associated with tumor microenvironment is a strategy to overcome the limitations of ICIs [145]. Such new ICs include lymphocyte activation gene-3 (LAG-3) [146], T cell immunoglobulin and ITIM domain (TIGIT) [147], T cell immunoglobulin and mucin-domain containing-3 (TIM-3) [148], V-domain immunoglobulin suppressor of T cell activation (VISTA) [149,150,151], B7 homolog 3 protein (B7-H3) [152] and inducible T cell costimulatory (ICOS) [153]. These ICs represent promising options for treating solid tumors, with clinical trials currently under active investigation for evaluating their effectiveness as monotherapy or combination therapy together with other ICIs [145]. An additional approach for combatting resistance to ICs treatment is by the use of bispecific antibodies [154,155]. FS118 is a novel, tetravalent (bispecific) antibody targeting LAG-3 and PD-L1 [156]. Treatment with the mAb resulted in a decreased expression of LAG-3 on T cells, and it was shed from the target cells, whereas the expression of the IC increased following treatment involving a combination of mAbs singularly targeting LAG-3 and PD-L1 [156]. A durable response to the mAb in a patient with anaplastic thyroid carcinoma who had progressed after PD-1 monotherapy was recently reported [157].
In line with the active immunotherapy/vaccination approach against Her-2/neu and ICs, the application of computer-aided analyses and X-ray structures of mAbs-bound proteins led to the identification of two B cell epitopes representing trastuzumab-binding and pertuzumab-binding epitopes [158,159]. A vaccine (B-Vaxx) comprising the two epitopes [158,159] was shown to be safe and immunogenic in a phase 1 trial [160]. With a similar approach, a vaccine (PD1-Vaxx) with a PD-1 B cell peptide linked to a measles virus fusion peptide via a four amino acid residue (GPSL) was constructed [160] and demonstrated synergistic vaccine combinations with a Her-2-targeted vaccine (B-Vaxx) [123]. Applying the same strategy, a PD-L1 B cell peptide vaccine (PDL1-Vaxx) was also constructed and in combination with a dual Her-2 B cell vaccine (B-Vaxx) was recently shown to induce potent immune responses and effective anti-tumor immunity in multiple syngeneic mice models [161]. In line with these results and our earlier findings showing that targeting Her-2/neu results in the loss of the receptor [102,120] associated with the upregulation of PD-L1 expression [102], two clinical trials were planned (Imugene Limited, Sydney, Australia) to assess: the combination of HER-Vaxx with chemotherapy or with anti-PD-1 antibody pembrolizumab in patients with Her-2/neu overexpressing gastric cancer who have failed treatment with trastuzumab and the combination of HER-Vaxx with chemotherapy ± the anti-PD-L1 antibody avelumab in patients with Her-2/neu overexpressing gastric cancer.

4. Conclusions

The downregulation of T cell activation by the PD-1/PD-L1 axis, which is necessary for peripheral tolerance, can be exploited by tumor cells, resulting in the induction of an immunosuppressive state and their growth and immune escape. The application of therapeutic vaccines, based on immunogenic peptides inducing the production of antibodies in the host with a functionality similar to ICIs in inhibiting the PD-1/PD-L1 interaction, is a promising approach for immunotherapy. Additionally, such an approach might potentially overcome some of the disadvantages of the therapeutic mAbs as discussed in this review. A continuous inhibition of the PD-1/PD-L1 interaction may result from a peptide-based vaccination, consequently leading to immunological memory and elevated T cell activity. However, the results of our investigations did not indicate any safety concerns regarding the targeting of immune checkpoint PD-1 by active immunization, nor showed association with the hyper induction of pro-inflammatory cytokine production, known as ‘cytokine storm’ [162]. Nevertheless, the evaluation of the safety, immunogenicity and tolerability of vaccination with a PD-1 peptide (PD-1-Vaxx) is the aim of the ongoing phase 1 clinical trial (ClinicalTrials.gov Identifier: NCT04432207).
On the basis of the findings reviewed here, combined vaccination concepts co-targeting Her-2/neu and the PD-1 pathway seem to present a new treatment strategy to overcome mAbs above-mentioned associated disadvantages. These aspects are currently the topic of ongoing clinical trials, which will shed more light on the clinical outcomes of the discussed approach.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/cancers14225678/s1, Figure S1: Established influenza infection model in BALB/c mice infected with 50PFU of mouse-adapted influenza A/PR/8/34 virus, Figure S2: Immunization schedule, levels of mRNA expression and levels of antibodies, Figure S3: Distribution of immune cell profiles, Figure S4: Distribution of myeloid cell profiles in the examined mice measured by flow cytometry in lungs on day 5 and 9 after infection, Figure S5: The levels of mRNA expression of IFNgamma, IL-6 and TNF in lungs, measured by RT-PCR.

Author Contributions

Conceptualization, J.T. and U.W.; validation, J.T., P.S., M.K., S.K. and U.W.; formal analysis, J.T., M.D., C.B., P.S. and M.K.; methodology, J.T., M.D., A.S., A.H., M.L.W. and C.B.; investigation, J.T., M.D., P.S. and M.K.; resources, P.S., S.K. and U.W.; data curation, J.T.; writing—original draft preparation, J.T. and U.W.; writing—review and editing, J.T., M.D., C.B., P.S., E.G.-S., M.K., S.K. and C.C.Z.; visualization, J.T., M.D. and C.B.; supervision, J.T.; project administration, J.T. and U.W. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding. The presented pre-clinical studies were supported by a research grant from Imugene Ltd. (until 31 October 2020) to the Medical University of Vienna.

Data Availability Statement

The data presented in this study are available in the article and supplementary materials.

Conflicts of Interest

J.T., M.D., A.S., A.H., M.W., C.B., P.S., E.G.,S., M.K. and S.K. declare no potential conflicts of interest; C.C.Z. was CSO of Imugene until June 2018; Consultancies and Speaker’s Honoraria from Roche, Novartis, BMS, MSD, Imugene, Ariad, Pfizer, Merrimack, Merck KGaA, Fibrogen, AstraZeneca, Tesaro, Gilead, Servier, Shire, Eli Lilly, Athenex; Institution (CECOG): BMS, MSD, Pfizer, AstraZeneca; U.W. was CSO of Imugene until Sept. 2018 and has received from GSK, Pfizer and Themis, funding to the Institute as the principal investigator (PI) of clinical.

References

  1. Esfahani, K.; Roudaia, L.; Buhlaiga, N.; Del Rincon, S.V.; Papneja, N.; Miller, W.H., Jr. A review of cancer immunotherapy: From the past, to the present, to the future. Curr. Oncol. 2020, 27, S87–S97. [Google Scholar] [CrossRef]
  2. Abbott, M.; Ustoyev, Y. Cancer and the Immune System: The History and Background of Immunotherapy. Semin. Oncol. Nurs. 2019, 35, 150923. [Google Scholar] [CrossRef] [PubMed]
  3. Costa, R.L.B.; Czerniecki, B.J. Clinical development of immunotherapies for HER2(+) breast cancer: A review of HER2-directed monoclonal antibodies and beyond. NPJ Breast Cancer 2020, 6, 10. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  4. Strebhardt, K.; Ullrich, A. Paul Ehrlich’s magic bullet concept: 100 years of progress. Nat. Rev. Cancer 2008, 8, 473–480. [Google Scholar] [CrossRef] [PubMed]
  5. Galluzzi, L.; Vacchelli, E.; Bravo-San Pedro, J.M.; Buque, A.; Senovilla, L.; Baracco, E.E.; Bloy, N.; Castoldi, F.; Abastado, J.P.; Agostinis, P.; et al. Classification of current anticancer immunotherapies. Oncotarget 2014, 5, 12472–12508. [Google Scholar] [CrossRef] [Green Version]
  6. Lesterhuis, W.J.; Haanen, J.B.; Punt, C.J. Cancer immunotherapy—Revisited. Nat. Rev. Drug Discov. 2011, 10, 591–600. [Google Scholar] [CrossRef]
  7. Pardoll, D.M. The blockade of immune checkpoints in cancer immunotherapy. Nat. Rev. Cancer 2012, 12, 252–264. [Google Scholar] [CrossRef] [Green Version]
  8. Wiedermann, U.; Davis, A.B.; Zielinski, C.C. Vaccination for the prevention and treatment of breast cancer with special focus on Her-2/neu peptide vaccines. Breast Cancer Res. Treat. 2013, 138, 1–12. [Google Scholar] [CrossRef]
  9. Hafeez, U.; Parakh, S.; Gan, H.K.; Scott, A.M. Antibody-Drug Conjugates for Cancer Therapy. Molecules 2020, 25, 4764. [Google Scholar] [CrossRef]
  10. Parakh, S.; Parslow, A.C.; Gan, H.K.; Scott, A.M. Antibody-mediated delivery of therapeutics for cancer therapy. Expert Opin. Drug Deliv. 2016, 13, 401–419. [Google Scholar] [CrossRef]
  11. Scott, A.M.; Wolchok, J.D.; Old, L.J. Antibody therapy of cancer. Nat. Rev. Cancer 2012, 12, 278–287. [Google Scholar] [CrossRef]
  12. Weiner, L.M.; Dhodapkar, M.V.; Ferrone, S. Monoclonal antibodies for cancer immunotherapy. Lancet 2009, 373, 1033–1040. [Google Scholar] [CrossRef] [Green Version]
  13. Weiner, L.M.; Surana, R.; Wang, S. Monoclonal antibodies: Versatile platforms for cancer immunotherapy. Nat. Rev. Immunol. 2010, 10, 317–327. [Google Scholar] [CrossRef] [Green Version]
  14. Lu, R.M.; Hwang, Y.C.; Liu, I.J.; Lee, C.C.; Tsai, H.Z.; Li, H.J.; Wu, H.C. Development of therapeutic antibodies for the treatment of diseases. J. Biomed. Sci. 2020, 27, 1. [Google Scholar] [CrossRef]
  15. Sharpe, A.H. Mechanisms of costimulation. Immunol. Rev. 2009, 229, 5–11. [Google Scholar] [CrossRef] [Green Version]
  16. Greenwald, R.J.; Freeman, G.J.; Sharpe, A.H. The B7 family revisited. Annu. Rev. Immunol. 2005, 23, 515–548. [Google Scholar] [CrossRef]
  17. Zou, W.; Chen, L. Inhibitory B7-family molecules in the tumour microenvironment. Nat. Rev. Immunol. 2008, 8, 467–477. [Google Scholar] [CrossRef]
  18. Grywalska, E.; Pasiarski, M.; Gozdz, S.; Rolinski, J. Immune-checkpoint inhibitors for combating T-cell dysfunction in cancer. Onco Targets Ther. 2018, 11, 6505–6524. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  19. Saibil, S.D.; Ohashi, P.S. Targeting T cell activation in immuno-oncology. Curr. Oncol. 2020, 27, S98–S105. [Google Scholar] [CrossRef]
  20. Li, Y.; Li, F.; Jiang, F.; Lv, X.; Zhang, R.; Lu, A.; Zhang, G. A Mini-Review for Cancer Immunotherapy: Molecular Understanding of PD-1/PD-L1 Pathway & Translational Blockade of Immune Checkpoints. Int. J. Mol. Sci. 2016, 17, 1151. [Google Scholar] [CrossRef]
  21. Reichert, J.M.; Rosensweig, C.J.; Faden, L.B.; Dewitz, M.C. Monoclonal antibody successes in the clinic. Nat. Biotechnol. 2005, 23, 1073–1078. [Google Scholar] [CrossRef] [PubMed]
  22. Mullard, A. FDA approves 100th monoclonal antibody product. Nat. Rev. Drug Discov. 2021, 20, 491–495. [Google Scholar] [CrossRef] [PubMed]
  23. De Sousa Linhares, A.; Battin, C.; Jutz, S.; Leitner, J.; Hafner, C.; Tobias, J.; Wiedermann, U.; Kundi, M.; Zlabinger, G.J.; Grabmeier-Pfistershammer, K.; et al. Therapeutic PD-L1 antibodies are more effective than PD-1 antibodies in blocking PD-1/PD-L1 signaling. Sci. Rep. 2019, 9, 11472. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  24. Vaddepally, R.K.; Kharel, P.; Pandey, R.; Garje, R.; Chandra, A.B. Review of Indications of FDA-Approved Immune Checkpoint Inhibitors per NCCN Guidelines with the Level of Evidence. Cancers 2020, 12, 738. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  25. Xu, C.; Chen, Y.P.; Du, X.J.; Liu, J.Q.; Huang, C.L.; Chen, L.; Zhou, G.Q.; Li, W.F.; Mao, Y.P.; Hsu, C.; et al. Comparative safety of immune checkpoint inhibitors in cancer: Systematic review and network meta-analysis. BMJ 2018, 363, k4226. [Google Scholar] [CrossRef]
  26. Dine, J.; Gordon, R.; Shames, Y.; Kasler, M.K.; Barton-Burke, M. Immune Checkpoint Inhibitors: An Innovation in Immunotherapy for the Treatment and Management of Patients with Cancer. Asia-Pac. J. Oncol. Nurs. 2017, 4, 127–135. [Google Scholar] [CrossRef]
  27. Granier, C.; De Guillebon, E.; Blanc, C.; Roussel, H.; Badoual, C.; Colin, E.; Saldmann, A.; Gey, A.; Oudard, S.; Tartour, E. Mechanisms of action and rationale for the use of checkpoint inhibitors in cancer. ESMO Open 2017, 2, e000213. [Google Scholar] [CrossRef] [Green Version]
  28. Iwai, Y.; Hamanishi, J.; Chamoto, K.; Honjo, T. Cancer immunotherapies targeting the PD-1 signaling pathway. J. Biomed. Sci. 2017, 24, 26. [Google Scholar] [CrossRef] [Green Version]
  29. Chenard-Poirier, M.; Smyth, E.C. Immune Checkpoint Inhibitors in the Treatment of Gastroesophageal Cancer. Drugs 2019, 79, 1–10. [Google Scholar] [CrossRef]
  30. Liu, X.; Qin, S. Immune Checkpoint Inhibitors in Hepatocellular Carcinoma: Opportunities and Challenges. Oncologist 2019, 24, S3–S10. [Google Scholar] [CrossRef]
  31. Liu, Y.; Wu, L.; Tong, R.; Yang, F.; Yin, L.; Li, M.; You, L.; Xue, J.; Lu, Y. PD-1/PD-L1 Inhibitors in Cervical Cancer. Front. Pharmacol. 2019, 10, 65. [Google Scholar] [CrossRef] [Green Version]
  32. Forster, M.D.; Devlin, M.J. Immune Checkpoint Inhibition in Head and Neck Cancer. Front. Oncol. 2018, 8, 310. [Google Scholar] [CrossRef] [Green Version]
  33. Kim, H.S.; Seo, H.K. Immune checkpoint inhibitors for urothelial carcinoma. Investig. Clin. Urol. 2018, 59, 285–296. [Google Scholar] [CrossRef]
  34. Shah, G.L.; Moskowitz, C.H. Checkpoint inhibition in lymphoma. Clin. Adv. Hematol. Oncol. 2018, 16, 45–55. [Google Scholar]
  35. Ma, X.; Zhang, Y.; Wang, S.; Wei, H.; Yu, J. Immune checkpoint inhibitor (ICI) combination therapy compared to monotherapy in advanced solid cancer: A systematic review. J. Cancer 2021, 12, 1318–1333. [Google Scholar] [CrossRef]
  36. Hynes, N.E.; Lane, H.A. ERBB receptors and cancer: The complexity of targeted inhibitors. Nat. Rev. Cancer 2005, 5, 341–354. [Google Scholar] [CrossRef]
  37. Iqbal, N.; Iqbal, N. Human Epidermal Growth Factor Receptor 2 (HER2) in Cancers: Overexpression and Therapeutic Implications. Mol. Biol. Int. 2014, 2014, 852748. [Google Scholar] [CrossRef]
  38. Meza-Junco, J.; Sawyer, M.B. Metastatic gastric cancer—Focus on targeted therapies. Biologics 2012, 6, 137–146. [Google Scholar] [CrossRef] [Green Version]
  39. Oh, D.Y.; Bang, Y.J. HER2-targeted therapies—A role beyond breast cancer. Nat. Rev. Clin. Oncol. 2020, 17, 33–48. [Google Scholar] [CrossRef]
  40. Ross, J.S.; Slodkowska, E.A.; Symmans, W.F.; Pusztai, L.; Ravdin, P.M.; Hortobagyi, G.N. The HER-2 receptor and breast cancer: Ten years of targeted anti-HER-2 therapy and personalized medicine. Oncologist 2009, 14, 320–368. [Google Scholar] [CrossRef] [Green Version]
  41. Slamon, D.J.; Godolphin, W.; Jones, L.A.; Holt, J.A.; Wong, S.G.; Keith, D.E.; Levin, W.J.; Stuart, S.G.; Udove, J.; Ullrich, A.; et al. Studies of the HER-2/neu proto-oncogene in human breast and ovarian cancer. Science 1989, 244, 707–712. [Google Scholar] [CrossRef] [PubMed]
  42. Arienti, C.; Pignatta, S.; Tesei, A. Epidermal Growth Factor Receptor Family and its Role in Gastric Cancer. Front. Oncol. 2019, 9, 1308. [Google Scholar] [CrossRef] [PubMed]
  43. Cui, N.; Shi, J.; Yang, C. HER2-Based Immunotherapy for Breast Cancer. Cancer Biother. Radiopharm. 2018, 33, 169–175. [Google Scholar] [CrossRef] [PubMed]
  44. Hynes, N.E.; Stern, D.F. The biology of erbB-2/neu/HER-2 and its role in cancer. Biochim. Biophys. Acta 1994, 1198, 165–184. [Google Scholar] [CrossRef] [PubMed]
  45. Slamon, D.J.; Clark, G.M.; Wong, S.G.; Levin, W.J.; Ullrich, A.; McGuire, W.L. Human breast cancer: Correlation of relapse and survival with amplification of the HER-2/neu oncogene. Science 1987, 235, 177–182. [Google Scholar] [CrossRef] [Green Version]
  46. Tai, W.; Mahato, R.; Cheng, K. The role of HER2 in cancer therapy and targeted drug delivery. J. Control. Release 2010, 146, 264–275. [Google Scholar] [CrossRef] [Green Version]
  47. Carpenter, G. Receptors for epidermal growth factor and other polypeptide mitogens. Annu. Rev. Biochem. 1987, 56, 881–914. [Google Scholar] [CrossRef]
  48. Lemmon, M.A.; Schlessinger, J. Cell signaling by receptor tyrosine kinases. Cell 2010, 141, 1117–1134. [Google Scholar] [CrossRef] [Green Version]
  49. Citri, A.; Skaria, K.B.; Yarden, Y. The deaf and the dumb: The biology of ErbB-2 and ErbB-3. Exp. Cell Res. 2003, 284, 54–65. [Google Scholar] [CrossRef]
  50. Citri, A.; Yarden, Y. EGF-ERBB signalling: Towards the systems level. Nat. Rev. Mol. Cell Biol. 2006, 7, 505–516. [Google Scholar] [CrossRef]
  51. Moasser, M.M. The oncogene HER2: Its signaling and transforming functions and its role in human cancer pathogenesis. Oncogene 2007, 26, 6469–6487. [Google Scholar] [CrossRef]
  52. Yarden, Y.; Sliwkowski, M.X. Untangling the ErbB signalling network. Nat. Rev. Mol. Cell Biol. 2001, 2, 127–137. [Google Scholar] [CrossRef]
  53. Klapper, L.N.; Vaisman, N.; Hurwitz, E.; Pinkas-Kramarski, R.; Yarden, Y.; Sela, M. A subclass of tumor-inhibitory monoclonal antibodies to ErbB-2/HER2 blocks crosstalk with growth factor receptors. Oncogene 1997, 14, 2099–2109. [Google Scholar] [CrossRef] [Green Version]
  54. Klapper, L.N.; Waterman, H.; Sela, M.; Yarden, Y. Tumor-inhibitory antibodies to HER-2/ErbB-2 may act by recruiting c-Cbl and enhancing ubiquitination of HER-2. Cancer Res. 2000, 60, 3384–3388. [Google Scholar]
  55. Slamon, D.J.; Leyland-Jones, B.; Shak, S.; Fuchs, H.; Paton, V.; Bajamonde, A.; Fleming, T.; Eiermann, W.; Wolter, J.; Pegram, M.; et al. Use of chemotherapy plus a monoclonal antibody against HER2 for metastatic breast cancer that overexpresses HER2. N. Engl. J. Med. 2001, 344, 783–792. [Google Scholar] [CrossRef]
  56. Piccart-Gebhart, M.J.; Procter, M.; Leyland-Jones, B.; Goldhirsch, A.; Untch, M.; Smith, I.; Gianni, L.; Baselga, J.; Bell, R.; Jackisch, C.; et al. Trastuzumab after adjuvant chemotherapy in HER2-positive breast cancer. N. Engl. J. Med. 2005, 353, 1659–1672. [Google Scholar] [CrossRef] [Green Version]
  57. Sakai, K.; Yokote, H.; Murakami-Murofushi, K.; Tamura, T.; Saijo, N.; Nishio, K. Pertuzumab, a novel HER dimerization inhibitor, inhibits the growth of human lung cancer cells mediated by the HER3 signaling pathway. Cancer Sci. 2007, 98, 1498–1503. [Google Scholar] [CrossRef]
  58. Smith, M.B.; Reardon, J.; Olson, E.M. Pertuzumab for the treatment of patients with previously untreated HER2-positive metastatic breast cancer. Drugs Today 2012, 48, 713–722. [Google Scholar] [CrossRef] [Green Version]
  59. Nahta, R.; Hung, M.C.; Esteva, F.J. The HER-2-targeting antibodies trastuzumab and pertuzumab synergistically inhibit the survival of breast cancer cells. Cancer Res. 2004, 64, 2343–2346. [Google Scholar] [CrossRef] [Green Version]
  60. Scheuer, W.; Friess, T.; Burtscher, H.; Bossenmaier, B.; Endl, J.; Hasmann, M. Strongly enhanced antitumor activity of trastuzumab and pertuzumab combination treatment on HER2-positive human xenograft tumor models. Cancer Res. 2009, 69, 9330–9336. [Google Scholar] [CrossRef] [Green Version]
  61. Baselga, J.; Cortes, J.; Kim, S.B.; Im, S.A.; Hegg, R.; Im, Y.H.; Roman, L.; Pedrini, J.L.; Pienkowski, T.; Knott, A.; et al. Pertuzumab plus trastuzumab plus docetaxel for metastatic breast cancer. N. Engl. J. Med. 2012, 366, 109–119. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  62. Tobias, J.; Garner-Spitzer, E.; Drinic, M.; Wiedermann, U. Vaccination against Her-2/neu, with focus on peptide-based vaccines. ESMO Open 2022, 7, 100361. [Google Scholar] [CrossRef]
  63. Chaganty, B.K.R.; Qiu, S.; Gest, A.; Lu, Y.; Ivan, C.; Calin, G.A.; Weiner, L.M.; Fan, Z. Trastuzumab upregulates PD-L1 as a potential mechanism of trastuzumab resistance through engagement of immune effector cells and stimulation of IFNgamma secretion. Cancer Lett. 2018, 430, 47–56. [Google Scholar] [CrossRef] [PubMed]
  64. Baselga, J.; Albanell, J. Mechanism of action of anti-HER2 monoclonal antibodies. Ann. Oncol. 2001, 12 (Suppl. 1), S35–S41. [Google Scholar] [CrossRef] [PubMed]
  65. Bianchini, G.; Gianni, L. The immune system and response to HER2-targeted treatment in breast cancer. Lancet Oncol. 2014, 15, e58–e68. [Google Scholar] [CrossRef]
  66. Yamashita, K.; Iwatsuki, M.; Yasuda-Yoshihara, N.; Morinaga, T.; Nakao, Y.; Harada, K.; Eto, K.; Kurashige, J.; Hiyoshi, Y.; Ishimoto, T.; et al. Trastuzumab upregulates programmed death ligand-1 expression through interaction with NK cells in gastric cancer. Br. J. Cancer 2021, 124, 595–603. [Google Scholar] [CrossRef]
  67. Butte, M.J.; Keir, M.E.; Phamduy, T.B.; Sharpe, A.H.; Freeman, G.J. Programmed death-1 ligand 1 interacts specifically with the B7-1 costimulatory molecule to inhibit T cell responses. Immunity 2007, 27, 111–122. [Google Scholar] [CrossRef] [Green Version]
  68. Krasniqi, E.; Barchiesi, G.; Pizzuti, L.; Mazzotta, M.; Venuti, A.; Maugeri-Sacca, M.; Sanguineti, G.; Massimiani, G.; Sergi, D.; Carpano, S.; et al. Immunotherapy in HER2-positive breast cancer: State of the art and future perspectives. J. Hematol. Oncol. 2019, 12, 111. [Google Scholar] [CrossRef]
  69. Pohlmann, P.R.; Mayer, I.A.; Mernaugh, R. Resistance to Trastuzumab in Breast Cancer. Clin. Cancer Res. 2009, 15, 7479–7491. [Google Scholar] [CrossRef] [Green Version]
  70. Chung, A.; Cui, X.; Audeh, W.; Giuliano, A. Current status of anti-human epidermal growth factor receptor 2 therapies: Predicting and overcoming herceptin resistance. Clin. Breast Cancer 2013, 13, 223–232. [Google Scholar] [CrossRef] [Green Version]
  71. Derakhshani, A.; Rezaei, Z.; Safarpour, H.; Sabri, M.; Mir, A.; Sanati, M.A.; Vahidian, F.; Gholamiyan Moghadam, A.; Aghadoukht, A.; Hajiasgharzadeh, K.; et al. Overcoming trastuzumab resistance in HER2-positive breast cancer using combination therapy. J. Cell. Physiol. 2020, 235, 3142–3156. [Google Scholar] [CrossRef]
  72. Loi, S.; Giobbie-Hurder, A.; Gombos, A.; Bachelot, T.; Hui, R.; Curigliano, G.; Campone, M.; Biganzoli, L.; Bonnefoi, H.; Jerusalem, G.; et al. Pembrolizumab plus trastuzumab in trastuzumab-resistant, advanced, HER2-positive breast cancer (PANACEA): A single-arm, multicentre, phase 1b-2 trial. Lancet Oncol. 2019, 20, 371–382. [Google Scholar] [CrossRef]
  73. Peddi, P.F.; Hurvitz, S.A. Ado-trastuzumab emtansine (T-DM1) in human epidermal growth factor receptor 2 (HER2)-positive metastatic breast cancer: Latest evidence and clinical potential. Ther. Adv. Med. Oncol. 2014, 6, 202–209. [Google Scholar] [CrossRef] [Green Version]
  74. Emens, L.A.; Esteva, F.J.; Beresford, M.; Saura, C.; De Laurentiis, M.; Kim, S.B.; Im, S.A.; Wang, Y.; Salgado, R.; Mani, A.; et al. Trastuzumab emtansine plus atezolizumab versus trastuzumab emtansine plus placebo in previously treated, HER2-positive advanced breast cancer (KATE2): A phase 2, multicentre, randomised, double-blind trial. Lancet Oncol. 2020, 21, 1283–1295. [Google Scholar] [CrossRef]
  75. Davis, A.A.; Patel, V.G. The role of PD-L1 expression as a predictive biomarker: An analysis of all US Food and Drug Administration (FDA) approvals of immune checkpoint inhibitors. J. Immunother. Cancer 2019, 7, 278. [Google Scholar] [CrossRef]
  76. Dirix, L.Y.; Takacs, I.; Jerusalem, G.; Nikolinakos, P.; Arkenau, H.T.; Forero-Torres, A.; Boccia, R.; Lippman, M.E.; Somer, R.; Smakal, M.; et al. Avelumab, an anti-PD-L1 antibody, in patients with locally advanced or metastatic breast cancer: A phase 1b JAVELIN Solid Tumor study. Breast Cancer Res. Treat. 2018, 167, 671–686. [Google Scholar] [CrossRef] [Green Version]
  77. Hamilton, E.P.; Kaklamani, V.; Falkson, C.; Vidal, G.A.; Ward, P.J.; Patre, M.; Chui, S.Y.; Rotmensch, J.; Gupta, K.; Molinero, L.; et al. Atezolizumab in combination with trastuzumab emtansine or with trastuzumab and pertuzumab in patients with HER2-positive breast cancer and atezolizumab with doxorubicin and cyclophosphamide in HER2-negative breast cancer: Safety and biomarker outcomes from a multi-cohort Phase Ib study. Cancer Res. 2020, 80 (Suppl. 4), PD1–PD5. [Google Scholar] [CrossRef]
  78. Crosby, E.J.; Acharya, C.R.; Haddad, A.F.; Rabiola, C.A.; Lei, G.; Wei, J.P.; Yang, X.Y.; Wang, T.; Liu, C.X.; Wagner, K.U.; et al. Stimulation of Oncogene-Specific Tumor-Infiltrating T Cells through Combined Vaccine and alphaPD-1 Enable Sustained Antitumor Responses against Established HER2 Breast Cancer. Clin. Cancer Res. 2020, 26, 4670–4681. [Google Scholar] [CrossRef]
  79. Cohen, E.E.W.; Pishvaian, M.J.; Shepard, D.R.; Wang, D.; Weiss, J.; Johnson, M.L.; Chung, C.H.; Chen, Y.; Huang, B.; Davis, C.B.; et al. A phase Ib study of utomilumab (PF-05082566) in combination with mogamulizumab in patients with advanced solid tumors. J. Immunother. Cancer 2019, 7, 342. [Google Scholar] [CrossRef]
  80. Ovacik, M.; Lin, K. Tutorial on Monoclonal Antibody Pharmacokinetics and Its Considerations in Early Development. Clin. Transl. Sci. 2018, 11, 540–552. [Google Scholar] [CrossRef]
  81. Naran, K.; Nundalall, T.; Chetty, S.; Barth, S. Principles of Immunotherapy: Implications for Treatment Strategies in Cancer and Infectious Diseases. Front. Microbiol. 2018, 9, 3158. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  82. Scolnik, P.A. mAbs: A business perspective. MAbs 2009, 1, 179–184. [Google Scholar] [CrossRef] [PubMed]
  83. Chames, P.; Van Regenmortel, M.; Weiss, E.; Baty, D. Therapeutic antibodies: Successes, limitations and hopes for the future. Br. J. Pharmacol. 2009, 157, 220–233. [Google Scholar] [CrossRef] [PubMed]
  84. Martins, F.; Sofiya, L.; Sykiotis, G.P.; Lamine, F.; Maillard, M.; Fraga, M.; Shabafrouz, K.; Ribi, C.; Cairoli, A.; Guex-Crosier, Y.; et al. Adverse effects of immune-checkpoint inhibitors: Epidemiology, management and surveillance. Nat. Rev. Clin. Oncol. 2019, 16, 563–580. [Google Scholar] [CrossRef] [PubMed]
  85. Fares, C.M.; Van Allen, E.M.; Drake, C.G.; Allison, J.P.; Hu-Lieskovan, S. Mechanisms of Resistance to Immune Checkpoint Blockade: Why Does Checkpoint Inhibitor Immunotherapy Not Work for All Patients? Am. Soc. Clin. Oncol. Educ. Book 2019, 39, 147–164. [Google Scholar] [CrossRef]
  86. Verma, V.; Sprave, T.; Haque, W.; Simone, C.B., 2nd; Chang, J.Y.; Welsh, J.W.; Thomas, C.R., Jr. A systematic review of the cost and cost-effectiveness studies of immune checkpoint inhibitors. J. Immunother. Cancer 2018, 6, 128. [Google Scholar] [CrossRef] [Green Version]
  87. van Holstein, Y.; Kapiteijn, E.; Bastiaannet, E.; van den Bos, F.; Portielje, J.; de Glas, N.A. Efficacy and Adverse Events of Immunotherapy with Checkpoint Inhibitors in Older Patients with Cancer. Drugs Aging 2019, 36, 927–938. [Google Scholar] [CrossRef] [Green Version]
  88. Ishii, K.; Morii, N.; Yamashiro, H. Pertuzumab in the treatment of HER2-positive breast cancer: An evidence-based review of its safety, efficacy, and place in therapy. Core Evid. 2019, 14, 51–70. [Google Scholar] [CrossRef] [Green Version]
  89. Bettaieb, A.; Paul, C.; Plenchette, S.; Shan, J.; Chouchane, L.; Ghiringhelli, F. Precision medicine in breast cancer: Reality or utopia? J. Transl. Med. 2017, 15, 139. [Google Scholar] [CrossRef] [Green Version]
  90. Oude Munnink, T.H.; Henstra, M.J.; Segerink, L.I.; Movig, K.L.; Brummelhuis-Visser, P. Therapeutic drug monitoring of monoclonal antibodies in inflammatory and malignant disease: Translating TNF-alpha experience to oncology. Clin. Pharmacol. Ther. 2016, 99, 419–431. [Google Scholar] [CrossRef]
  91. Torka, P.; Barth, M.; Ferdman, R.; Hernandez-Ilizaliturri, F.J. Mechanisms of Resistance to Monoclonal Antibodies (mAbs) in Lymphoid Malignancies. Curr. Hematol. Malig. Rep. 2019, 14, 426–438. [Google Scholar] [CrossRef]
  92. Isabwe, G.A.C.; Garcia Neuer, M.; de Las Vecillas Sanchez, L.; Lynch, D.M.; Marquis, K.; Castells, M. Hypersensitivity reactions to therapeutic monoclonal antibodies: Phenotypes and endotypes. J. Allergy Clin. Immunol. 2018, 142, 159–170.e2. [Google Scholar] [CrossRef]
  93. Pintea, I.; Petricau, C.; Dumitrascu, D.; Muntean, A.; Branisteanu, D.C.; Branisteanu, D.E.; Deleanu, D. Hypersensitivity reactions to monoclonal antibodies: Classification and treatment approach (Review). Exp. Ther. Med. 2021, 22, 949. [Google Scholar] [CrossRef]
  94. Hendrikx, J.; Haanen, J.; Voest, E.E.; Schellens, J.H.M.; Huitema, A.D.R.; Beijnen, J.H. Fixed Dosing of Monoclonal Antibodies in Oncology. Oncologist 2017, 22, 1212–1221. [Google Scholar] [CrossRef] [Green Version]
  95. Price, L.; Brunt, A.M. Trastuzumab infusion reactions in breast cancer. Should we routinely observe after the first dose? Eur. J. Hosp. Pharm. 2018, 25, 331–333. [Google Scholar] [CrossRef]
  96. Pollard, A.J.; Bijker, E.M. A guide to vaccinology: From basic principles to new developments. Nat. Rev. Immunol. 2021, 21, 83–100. [Google Scholar] [CrossRef]
  97. Geysen, H.M.; Rodda, S.J.; Mason, T.J. A priori delineation of a peptide which mimics a discontinuous antigenic determinant. Mol. Immunol. 1986, 23, 709–715. [Google Scholar] [CrossRef]
  98. Zhang, L.; Huang, Y.; Lindstrom, A.R.; Lin, T.Y.; Lam, K.S.; Li, Y. Peptide-based materials for cancer immunotherapy. Theranostics 2019, 9, 7807–7825. [Google Scholar] [CrossRef]
  99. Riemer, A.B.; Bramswig, K.H.; Quaglino, E.; Forni, G.; Pehamberger, H.; Scheiner, O.; Zielinski, C.C.; Jensen-Jarolim, E. Vaccination with trastuzumab epitope mimics leads to prolonged tumor-free survival in HER-2/neu transgenic mice. Cancer Res. 2006, 66, 151–152. [Google Scholar]
  100. Singer, J.; Manzano-Szalai, K.; Fazekas, J.; Thell, K.; Bentley-Lukschal, A.; Stremnitzer, C.; Roth-Walter, F.; Weghofer, M.; Ritter, M.; Pino Tossi, K.; et al. Proof of concept study with an HER-2 mimotope anticancer vaccine deduced from a novel AAV-mimotope library platform. Oncoimmunology 2016, 5, e1171446. [Google Scholar] [CrossRef] [Green Version]
  101. Tobias, J.; Battin, C.; De Sousa Linhares, A.; Lebens, M.; Baier, K.; Ambroz, K.; Drinic, M.; Hogler, S.; Inic-Kanada, A.; Garner-Spitzer, E.; et al. A New Strategy Toward B Cell-Based Cancer Vaccines by Active Immunization With Mimotopes of Immune Checkpoint Inhibitors. Front. Immunol. 2020, 11, 895. [Google Scholar] [CrossRef] [PubMed]
  102. Tobias, J.; Drinic, M.; Hogler, S.; Ambroz, K.; Baier, K.; Kodajova, P.; Tomasich, E.; Berghoff, A.S.; Schmid, A.; Garner-Spitzer, E.; et al. Active immunization with a Her-2/neu-targeting Multi-peptide B cell vaccine prevents lung metastases formation from Her-2/neu breast cancer in a mouse model. Transl. Oncol. 2022, 19, 101378. [Google Scholar] [CrossRef] [PubMed]
  103. Tobias, J.; Steinberger, P.; Drinic, M.; Wiedermann, U. Emerging targets for anticancer vaccination: PD-1. ESMO Open 2021, 6, 100278. [Google Scholar] [CrossRef]
  104. Kaumaya, P.T. B-cell epitope peptide cancer vaccines: A new paradigm for combination immunotherapies with novel checkpoint peptide vaccine. Future Oncol. 2020, 16, 1767–1791. [Google Scholar] [CrossRef] [PubMed]
  105. Knittelfelder, R.; Riemer, A.B.; Jensen-Jarolim, E. Mimotope vaccination--from allergy to cancer. Expert Opin. Biol. Ther. 2009, 9, 493–506. [Google Scholar] [CrossRef] [Green Version]
  106. Leung, N.Y.H.; Wai, C.Y.Y.; Chu, K.H.; Leung, P.S.C. Mimotope-based allergen-specific immunotherapy: Ready for prime time? Cell. Mol. Immunol. 2019, 16, 890–891. [Google Scholar] [CrossRef]
  107. Charalambous, B.M.; Feavers, I.M. Mimotope vaccines. J. Med. Microbiol. 2001, 50, 937–939. [Google Scholar] [CrossRef] [Green Version]
  108. Pashov, A.D.; Plaxco, J.; Kaveri, S.V.; Monzavi-Karbassi, B.; Harn, D.; Kieber-Emmons, T. Multiple antigenic mimotopes of HIV carbohydrate antigens: Relating structure and antigenicity. J. Biol. Chem. 2006, 281, 29675–29683. [Google Scholar] [CrossRef] [Green Version]
  109. Steward, M.W. The development of a mimotope-based synthetic peptide vaccine against respiratory syncytial virus. Biologicals 2001, 29, 215–219. [Google Scholar] [CrossRef]
  110. Kenter, G.G.; Welters, M.J.; Valentijn, A.R.; Lowik, M.J.; Berends-van der Meer, D.M.; Vloon, A.P.; Drijfhout, J.W.; Wafelman, A.R.; Oostendorp, J.; Fleuren, G.J.; et al. Phase I immunotherapeutic trial with long peptides spanning the E6 and E7 sequences of high-risk human papillomavirus 16 in end-stage cervical cancer patients shows low toxicity and robust immunogenicity. Clin. Cancer Res. 2008, 14, 169–177. [Google Scholar] [CrossRef] [Green Version]
  111. Tobias, J.; Jasinska, J.; Baier, K.; Kundi, M.; Ede, N.; Zielinski, C.; Wiedermann, U. Enhanced and long term immunogenicity of a Her-2/neu multi-epitope vaccine conjugated to the carrier CRM197 in conjunction with the adjuvant Montanide. BMC Cancer 2017, 17, 118. [Google Scholar] [CrossRef] [Green Version]
  112. Jasinska, J.; Wagner, S.; Radauer, C.; Sedivy, R.; Brodowicz, T.; Wiltschke, C.; Breiteneder, H.; Pehamberger, H.; Scheiner, O.; Wiedermann, U.; et al. Inhibition of tumor cell growth by antibodies induced after vaccination with peptides derived from the extracellular domain of Her-2/neu. Int. J. Cancer 2003, 107, 976–983. [Google Scholar] [CrossRef]
  113. Malito, E.; Bursulaya, B.; Chen, C.; Lo Surdo, P.; Picchianti, M.; Balducci, E.; Biancucci, M.; Brock, A.; Berti, F.; Bottomley, M.J.; et al. Structural basis for lack of toxicity of the diphtheria toxin mutant CRM197. Proc. Natl. Acad. Sci. USA 2012, 109, 5229–5234. [Google Scholar] [CrossRef]
  114. Kamboj, K.K.; King, C.L.; Greenspan, N.S.; Kirchner, H.L.; Schreiber, J.R. Immunization with Haemophilus influenzae type b-CRM197 conjugate vaccine elicits a mixed Th1 and Th2 CD4+ T cell cytokine response that correlates with the isotype of antipolysaccharide antibody. J. Infect. Dis. 2001, 184, 931–935. [Google Scholar] [CrossRef] [Green Version]
  115. Habjanec, L.; Halassy, B.; Tomašić, J. Immunomodulatory activity of novel adjuvant formulations based on Montanide ISA oil-based adjuvants and peptidoglycan monomer. Int. Immunopharmacol. 2008, 8, 717–724. [Google Scholar] [CrossRef]
  116. Ascarateil, S.; Puget, A.; Koziol, M.-E. Safety data of Montanide ISA 51 VG and Montanide ISA 720 VG, two adjuvants dedicated to human therapeutic vaccines. J. Immunother. Cancer 2015, 3 (Suppl. 2), P428. [Google Scholar] [CrossRef] [Green Version]
  117. Wagner, S.; Jasinska, J.; Breiteneder, H.; Kundi, M.; Pehamberger, H.; Scheiner, O.; Zielinski, C.C.; Wiedermann, U. Delayed tumor onset and reduced tumor growth progression after immunization with a Her-2/neu multi-peptide vaccine and IL-12 in c-neu transgenic mice. Breast Cancer Res. Treat. 2007, 106, 29–38. [Google Scholar] [CrossRef]
  118. Maglakelidze, M.; Ryspayeva, D.; Bulat, I.; Andric, Z.; Nikolic, I.; Chawla, T.; Nagarkar, R.; Chourdhary, V.; Venkata, G.; Singh, R.K.; et al. A Phase 1b/2 Open-Label Study with Randomization in Phase 2 of Imu-131 Her2/Neu Peptide Vaccine Plus Standard of Care Chemotherapy in Patients with Her2/Neu Overexpressing Metastatic or Advanced Adenocarcinoma of the Stomach or Gastroesophageal Junction. Cancer Res. 2021, 81, CT107. [Google Scholar] [CrossRef]
  119. Wiedermann, U.; Wiltschke, C.; Jasinska, J.; Kundi, M.; Zurbriggen, R.; Garner-Spitzer, E.; Bartsch, R.; Steger, G.; Pehamberger, H.; Scheiner, O.; et al. A virosomal formulated Her-2/neu multi-peptide vaccine induces Her-2/neu-specific immune responses in patients with metastatic breast cancer: A phase I study. Breast Cancer Res. Treat. 2010, 119, 673–683. [Google Scholar] [CrossRef] [Green Version]
  120. Wiedermann, U.; Garner-Spitzer, E.; Chao, Y.; Maglakelidze, M.; Bulat, I.; Dechaphunkul, A.; Arpornwirat, W.; Charoentum, C.; Yen, C.J.; Yau, T.C.; et al. Clinical and Immunologic Responses to a B-Cell Epitope Vaccine in Patients with HER2/neu-Overexpressing Advanced Gastric Cancer-Results from Phase Ib Trial IMU.ACS.001. Clin. Cancer Res. 2021, 27, 3649–3660. [Google Scholar] [CrossRef]
  121. Liu, K.; Tan, S.; Chai, Y.; Chen, D.; Song, H.; Zhang, C.W.; Shi, Y.; Liu, J.; Tan, W.; Lyu, J.; et al. Structural basis of anti-PD-L1 monoclonal antibody avelumab for tumor therapy. Cell Res. 2017, 27, 151–153. [Google Scholar] [CrossRef] [PubMed]
  122. Jutz, S.; Hennig, A.; Paster, W.; Asrak, O.; Dijanovic, D.; Kellner, F.; Pickl, W.F.; Huppa, J.B.; Leitner, J.; Steinberger, P. A cellular platform for the evaluation of immune checkpoint molecules. Oncotarget 2017, 8, 64892–64906. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  123. Kaumaya, P.T.P.; Guo, L.; Overholser, J.; Penichet, M.L.; Bekaii-Saab, T. Immunogenicity and antitumor efficacy of a novel human PD-1 B-cell vaccine (PD1-Vaxx) and combination immunotherapy with dual trastuzumab/pertuzumab-like HER-2 B-cell epitope vaccines (B-Vaxx) in a syngeneic mouse model. Oncoimmunology 2020, 9, 1818437. [Google Scholar] [CrossRef] [PubMed]
  124. Guo, L.; Kaumaya, P.T.P. First prototype checkpoint inhibitor B-cell epitope vaccine (PD1-Vaxx) en route to human Phase 1 clinical trial in Australia and USA: Exploiting future novel synergistic vaccine combinations. Br. J. Cancer 2021, 125, 152–154. [Google Scholar] [CrossRef] [PubMed]
  125. Chen, T.W.; Razak, A.R.; Bedard, P.L.; Siu, L.L.; Hansen, A.R. A systematic review of immune-related adverse event reporting in clinical trials of immune checkpoint inhibitors. Ann. Oncol. 2015, 26, 1824–1829. [Google Scholar] [CrossRef] [Green Version]
  126. Ellithi, M.; Elnair, R.; Chang, G.V.; Abdallah, M.A. Toxicities of Immune Checkpoint Inhibitors: Itis-Ending Adverse Reactions and More. Cureus 2020, 12, e6935. [Google Scholar] [CrossRef] [Green Version]
  127. Laubli, H.; Balmelli, C.; Kaufmann, L.; Stanczak, M.; Syedbasha, M.; Vogt, D.; Hertig, A.; Muller, B.; Gautschi, O.; Stenner, F.; et al. Influenza vaccination of cancer patients during PD-1 blockade induces serological protection but may raise the risk for immune-related adverse events. J. Immunother. Cancer 2018, 6, 40. [Google Scholar] [CrossRef] [Green Version]
  128. Wijn, D.H.; Groeneveld, G.H.; Vollaard, A.M.; Muller, M.; Wallinga, J.; Gelderblom, H.; Smit, E.F. Influenza vaccination in patients with lung cancer receiving anti-programmed death receptor 1 immunotherapy does not induce immune-related adverse events. Eur. J. Cancer 2018, 104, 182–187. [Google Scholar] [CrossRef]
  129. Chong, C.R.; Park, V.J.; Cohen, B.; Postow, M.A.; Wolchok, J.D.; Kamboj, M. Safety of Inactivated Influenza Vaccine in Cancer Patients Receiving Immune Checkpoint Inhibitors. Clin. Infect. Dis. 2020, 70, 193–199. [Google Scholar] [CrossRef]
  130. Failing, J.J.; Ho, T.P.; Yadav, S.; Majithia, N.; Riaz, I.B.; Shin, J.Y.; Schenk, E.L.; Xie, H. Safety of Influenza Vaccine in Patients With Cancer Receiving Pembrolizumab. JCO Oncol. Pract. 2020, 16, e573–e580. [Google Scholar] [CrossRef]
  131. Gwynn, M.E.; DeRemer, D.L.; Saunders, K.M.; Parikh, J.; Bollag, R.J.; Clemmons, A.B. Immune-mediated adverse events following influenza vaccine in cancer patients receiving immune checkpoint inhibitors. J. Oncol. Pharm. Pract. 2020, 26, 647–654. [Google Scholar] [CrossRef]
  132. Ohkuma, R.; Ieguchi, K.; Watanabe, M.; Takayanagi, D.; Goshima, T.; Onoue, R.; Hamada, K.; Kubota, Y.; Horiike, A.; Ishiguro, T.; et al. Increased Plasma Soluble PD-1 Concentration Correlates with Disease Progression in Patients with Cancer Treated with Anti-PD-1 Antibodies. Biomedicines 2021, 9, 1929. [Google Scholar] [CrossRef]
  133. Musolino, A.; Naldi, N.; Dieci, M.V.; Zanoni, D.; Rimanti, A.; Boggiani, D.; Sgargi, P.; Generali, D.G.; Piacentini, F.; Ambroggi, M.; et al. Immunoglobulin G fragment C receptor polymorphisms and efficacy of preoperative chemotherapy plus trastuzumab and lapatinib in HER2-positive breast cancer. Pharmacogenom. J. 2016, 16, 472–477. [Google Scholar] [CrossRef]
  134. Nordstrom, J.L.; Gorlatov, S.; Zhang, W.; Yang, Y.; Huang, L.; Burke, S.; Li, H.; Ciccarone, V.; Zhang, T.; Stavenhagen, J.; et al. Anti-tumor activity and toxicokinetics analysis of MGAH22, an anti-HER2 monoclonal antibody with enhanced Fcgamma receptor binding properties. Breast Cancer Res. 2011, 13, R123. [Google Scholar] [CrossRef] [Green Version]
  135. Bang, Y.J.; Giaccone, G.; Im, S.A.; Oh, D.Y.; Bauer, T.M.; Nordstrom, J.L.; Li, H.; Chichili, G.R.; Moore, P.A.; Hong, S.; et al. First-in-human phase 1 study of margetuximab (MGAH22), an Fc-modified chimeric monoclonal antibody, in patients with HER2-positive advanced solid tumors. Ann. Oncol. 2017, 28, 855–861. [Google Scholar] [CrossRef]
  136. Rugo, H.S.; Im, S.A.; Wright, G.L.S.; Escriva-de-Romani, S.; DeLaurentiis, M.; Cortes, J.; Bahadur, S.W.; Haley, B.B.; Oyola, R.H.; Riseberg, D.A.; et al. SOPHIA primary analysis: A phase 3 (P3) study of margetuximab (M) plus chemotherapy (C) versus trastuzumab (T) plus C in patients (pts) with HER2+metastatic (met) breast cancer (MBC) after prior anti-HER2 therapies (Tx). J. Clin. Oncol. 2019, 37, 1000. [Google Scholar] [CrossRef]
  137. Verma, S.; Miles, D.; Gianni, L.; Krop, I.E.; Welslau, M.; Baselga, J.; Pegram, M.; Oh, D.Y.; Dieras, V.; Guardino, E.; et al. Trastuzumab emtansine for HER2-positive advanced breast cancer. N. Engl. J. Med. 2012, 367, 1783–1791. [Google Scholar] [CrossRef] [Green Version]
  138. Wedam, S.; Fashoyin-Aje, L.; Gao, X.; Bloomquist, E.; Tang, S.; Sridhara, R.; Goldberg, K.B.; King-Kallimanis, B.L.; Theoret, M.R.; Ibrahim, A.; et al. FDA Approval Summary: Ado-Trastuzumab Emtansine for the Adjuvant Treatment of HER2-positive Early Breast Cancer. Clin. Cancer Res. 2020, 26, 4180–4185. [Google Scholar] [CrossRef] [Green Version]
  139. Jacob, J.B.; Jacob, M.K.; Parajuli, P. Review of immune checkpoint inhibitors in immuno-oncology. Adv. Pharmacol. 2021, 91, 111–139. [Google Scholar] [CrossRef]
  140. Ribas, A.; Wolchok, J.D. Cancer immunotherapy using checkpoint blockade. Science 2018, 359, 1350–1355. [Google Scholar] [CrossRef] [Green Version]
  141. Robert, C. A decade of immune-checkpoint inhibitors in cancer therapy. Nat. Commun. 2020, 11, 3801. [Google Scholar] [CrossRef] [PubMed]
  142. Johnson, D.B.; Nebhan, C.A.; Moslehi, J.J.; Balko, J.M. Immune-checkpoint inhibitors: Long-term implications of toxicity. Nat. Rev. Clin. Oncol. 2022, 19, 254–267. [Google Scholar] [CrossRef] [PubMed]
  143. Schoenfeld, A.J.; Hellmann, M.D. Acquired Resistance to Immune Checkpoint Inhibitors. Cancer Cell 2020, 37, 443–455. [Google Scholar] [CrossRef] [PubMed]
  144. Sharma, P.; Hu-Lieskovan, S.; Wargo, J.A.; Ribas, A. Primary, Adaptive, and Acquired Resistance to Cancer Immunotherapy. Cell 2017, 168, 707–723. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  145. Lee, J.B.; Ha, S.J.; Kim, H.R. Clinical Insights Into Novel Immune Checkpoint Inhibitors. Front. Pharmacol. 2021, 12, 681320. [Google Scholar] [CrossRef]
  146. Atkinson, V.; Khattak, A.; Haydon, A.; Eastgate, M.; Roy, A.; Prithviraj, P.; Mueller, C.; Brignone, C.; Triebel, F. Eftilagimod alpha, a soluble lymphocyte activation gene-3 (LAG-3) protein plus pembrolizumab in patients with metastatic melanoma. J. Immunother. Cancer 2020, 8, e001681. [Google Scholar] [CrossRef]
  147. Kong, Y.; Zhu, L.; Schell, T.D.; Zhang, J.; Claxton, D.F.; Ehmann, W.C.; Rybka, W.B.; George, M.R.; Zeng, H.; Zheng, H. T-Cell Immunoglobulin and ITIM Domain (TIGIT) Associates with CD8+ T-Cell Exhaustion and Poor Clinical Outcome in AML Patients. Clin. Cancer Res. 2016, 22, 3057–3066. [Google Scholar] [CrossRef] [Green Version]
  148. Acharya, N.; Sabatos-Peyton, C.; Anderson, A.C. Tim-3 finds its place in the cancer immunotherapy landscape. J. Immunother. Cancer 2020, 8, e000911. [Google Scholar] [CrossRef]
  149. Tagliamento, M.; Agostinetto, E.; Borea, R.; Brandao, M.; Poggio, F.; Addeo, A.; Lambertini, M. VISTA: A Promising Target for Cancer Immunotherapy? Immunotargets Ther. 2021, 10, 185–200. [Google Scholar] [CrossRef]
  150. Yuan, L.; Tatineni, J.; Mahoney, K.M.; Freeman, G.J. VISTA: A Mediator of Quiescence and a Promising Target in Cancer Immunotherapy. Trends Immunol. 2021, 42, 209–227. [Google Scholar] [CrossRef]
  151. Yum, J.E.I.; Hong, Y.K. Terminating Cancer by Blocking VISTA as a Novel Immunotherapy: Hasta la vista, baby. Front. Oncol. 2021, 11, 658488. [Google Scholar] [CrossRef]
  152. Liu, C.; Zhang, G.; Xiang, K.; Kim, Y.; Lavoie, R.R.; Lucien, F.; Wen, T. Targeting the immune checkpoint B7-H3 for next-generation cancer immunotherapy. Cancer Immunol. Immunother. 2022, 71, 1549–1567. [Google Scholar] [CrossRef]
  153. Yap, T.A.; Burris, H.A.; Kummar, S.; Falchook, G.S.; Pachynski, R.K.; LoRusso, P.; Tykodi, S.S.; Gibney, G.T.; Gainor, J.F.; Rahma, O.E.; et al. ICONIC: Biologic and clinical activity of first in class ICOS agonist antibody JTX-2011±nivolumab (nivo) in patients (pts) with advanced cancers. J. Clin. Oncol. 2018, 36, 3000. [Google Scholar] [CrossRef]
  154. Ma, J.; Mo, Y.; Tang, M.; Shen, J.; Qi, Y.; Zhao, W.; Huang, Y.; Xu, Y.; Qian, C. Bispecific Antibodies: From Research to Clinical Application. Front. Immunol. 2021, 12, 626616. [Google Scholar] [CrossRef]
  155. Zhou, X.; Einsele, H.; Danhof, S. Bispecific Antibodies: A New Era of Treatment for Multiple Myeloma. J. Clin. Med. 2020, 9, 2166. [Google Scholar] [CrossRef]
  156. Kraman, M.; Faroudi, M.; Allen, N.L.; Kmiecik, K.; Gliddon, D.; Seal, C.; Koers, A.; Wydro, M.M.; Batey, S.; Winnewisser, J.; et al. FS118, a Bispecific Antibody Targeting LAG-3 and PD-L1, Enhances T-Cell Activation Resulting in Potent Antitumor Activity. Clin. Cancer Res. 2020, 26, 3333–3344. [Google Scholar] [CrossRef] [Green Version]
  157. Kroloff, M.J.; Holz, J.B.; Stern, O.; Shepherd, C.J.; Morrow, M.; Kayitalire, L.; Wong, D.J. Durable response of anaplastic thyroid carcinoma to FS118, a bispecific LAG-3/PD-L1 antibody, after checkpoint inhibitor progression: A case report. J. Immunother. Cancer 2022, 10, e005225. [Google Scholar] [CrossRef]
  158. Allen, S.D.; Garrett, J.T.; Rawale, S.V.; Jones, A.L.; Phillips, G.; Forni, G.; Morris, J.C.; Oshima, R.G.; Kaumaya, P.T. Peptide vaccines of the HER-2/neu dimerization loop are effective in inhibiting mammary tumor growth in vivo. J. Immunol. 2007, 179, 472–482. [Google Scholar] [CrossRef] [Green Version]
  159. Garrett, J.T.; Rawale, S.; Allen, S.D.; Phillips, G.; Forni, G.; Morris, J.C.; Kaumaya, P.T. Novel engineered trastuzumab conformational epitopes demonstrate in vitro and in vivo antitumor properties against HER-2/neu. J. Immunol. 2007, 178, 7120–7131. [Google Scholar] [CrossRef] [Green Version]
  160. Bekaii-Saab, T.; Wesolowski, R.; Ahn, D.H.; Wu, C.; Mortazavi, A.; Lustberg, M.; Ramaswamy, B.; Fowler, J.; Wei, L.; Overholser, J.; et al. Phase I Immunotherapy Trial with Two Chimeric HER-2 B-Cell Peptide Vaccines Emulsified in Montanide ISA 720VG and Nor-MDP Adjuvant in Patients with Advanced Solid Tumors. Clin. Cancer Res. 2019, 25, 3495–3507. [Google Scholar] [CrossRef] [Green Version]
  161. Guo, L.; Overholser, J.; Darby, H.; Ede, N.J.; Kaumaya, P.T.P. A newly discovered PD-L1 B-cell epitope peptide vaccine (PDL1-Vaxx) exhibits potent immune responses and effective anti-tumor immunity in multiple syngeneic mice models and (synergizes) in combination with a dual HER-2 B-cell vaccine (B-Vaxx). Oncoimmunology 2022, 11, 2127691. [Google Scholar] [CrossRef] [PubMed]
  162. Ryabkova, V.A.; Churilov, L.P.; Shoenfeld, Y. Influenza infection, SARS, MERS and COVID-19: Cytokine storm—The common denominator and the lessons to be learned. Clin. Immunol. 2021, 223, 108652. [Google Scholar] [CrossRef] [PubMed]
Cancers 14 05678 g001 550
Figure 1. Schematic description of passive immunotherapy with Her-2/neu-targeting therapeutic mAbs pertuzumab and trastuzumab. The mAbs bind to their respective B cell epitopes on extracellular domain II (pertuzumab) and IV (Trastuzumab) of Her-2/neu. The mAbs’ modes of action upon their binding to the receptor are shown in the respective boxes. Adapted with permission from Ref. [62]. Elsevier, 2022.
Figure 1. Schematic description of passive immunotherapy with Her-2/neu-targeting therapeutic mAbs pertuzumab and trastuzumab. The mAbs bind to their respective B cell epitopes on extracellular domain II (pertuzumab) and IV (Trastuzumab) of Her-2/neu. The mAbs’ modes of action upon their binding to the receptor are shown in the respective boxes. Adapted with permission from Ref. [62]. Elsevier, 2022.
Cancers 14 05678 g001
Cancers 14 05678 g003 550
Figure 3. Examination of the ‘hybrid hPDL1-mimotope’ in cellular assay. Jurkat T cells expressing hPD-L1 were used in a cellular assay to assess the binding of avelumab (30 ng/mL) alone or after pre-incubation with different concentrations of the examined peptide. The values represent the mean and standard deviation of the geometric mean of the fluorescence intensity (gMFI) of the viable population of the cells from three independent experiments. Significant differences are indicated by the respective p-values.
Figure 3. Examination of the ‘hybrid hPDL1-mimotope’ in cellular assay. Jurkat T cells expressing hPD-L1 were used in a cellular assay to assess the binding of avelumab (30 ng/mL) alone or after pre-incubation with different concentrations of the examined peptide. The values represent the mean and standard deviation of the geometric mean of the fluorescence intensity (gMFI) of the viable population of the cells from three independent experiments. Significant differences are indicated by the respective p-values.
Cancers 14 05678 g003
Cancers 14 05678 g004 550
Figure 4. On the day of the infection (day 0) and each day after the infection, the body weight of the mice was measured. Each point indicates an average of 5 mice, shown with SE. Significant differences are indicated by the respective p-values.
Figure 4. On the day of the infection (day 0) and each day after the infection, the body weight of the mice was measured. Each point indicates an average of 5 mice, shown with SE. Significant differences are indicated by the respective p-values.
Cancers 14 05678 g004
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Tobias, J.; Drinić, M.; Schmid, A.; Hladik, A.; Watzenböck, M.L.; Battin, C.; Garner-Spitzer, E.; Steinberger, P.; Kundi, M.; Knapp, S.; et al. Combined Vaccination with B Cell Peptides Targeting Her-2/neu and Immune Checkpoints as Emerging Treatment Option in Cancer. Cancers 2022, 14, 5678. https://doi.org/10.3390/cancers14225678

AMA Style

Tobias J, Drinić M, Schmid A, Hladik A, Watzenböck ML, Battin C, Garner-Spitzer E, Steinberger P, Kundi M, Knapp S, et al. Combined Vaccination with B Cell Peptides Targeting Her-2/neu and Immune Checkpoints as Emerging Treatment Option in Cancer. Cancers. 2022; 14(22):5678. https://doi.org/10.3390/cancers14225678

Chicago/Turabian Style

Tobias, Joshua, Mirjana Drinić, Anna Schmid, Anastasiya Hladik, Martin L. Watzenböck, Claire Battin, Erika Garner-Spitzer, Peter Steinberger, Michael Kundi, Sylvia Knapp, and et al. 2022. "Combined Vaccination with B Cell Peptides Targeting Her-2/neu and Immune Checkpoints as Emerging Treatment Option in Cancer" Cancers 14, no. 22: 5678. https://doi.org/10.3390/cancers14225678

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop