You are currently viewing a new version of our website. To view the old version click .
Toxins
  • Feature Paper
  • Article
  • Open Access

5 May 2017

Insect-Active Toxins with Promiscuous Pharmacology from the African Theraphosid Spider Monocentropus balfouri

,
,
,
,
,
and
1
Institute for Molecular Bioscience, The University of Queensland, Brisbane, QLD 4072, Australia
2
School of Life Sciences, University of Technology Sydney, NSW, Sydney 2007, Australia
3
Department of Physiology & Solomon H. Snyder Department of Neuroscience, Johns Hopkins University, School of Medicine, Baltimore, MD 21205, USA
*
Author to whom correspondence should be addressed.
This article belongs to the Section Animal Venoms

Abstract

Many chemical insecticides are becoming less efficacious due to rising resistance in pest species, which has created much interest in the development of new, eco-friendly bioinsecticides. Since insects are the primary prey of most spiders, their venoms are a rich source of insect-active peptides that can be used as leads for new bioinsecticides or as tools to study molecular receptors that are insecticidal targets. In the present study, we isolated two insecticidal peptides, µ/ω-TRTX-Mb1a and -Mb1b, from venom of the African tarantula Monocentropus balfouri. Recombinant µ/ω-TRTX-Mb1a and -Mb1b paralyzed both Lucilia cuprina (Australian sheep blowfly) and Musca domestica (housefly), but neither peptide affected larvae of Helicoverpa armigera (cotton bollworms). Both peptides inhibited currents mediated by voltage-gated sodium (NaV) and calcium channels in Periplaneta americana (American cockroach) dorsal unpaired median neurons, and they also inhibited the cloned Blattella germanica (German cockroach) NaV channel (BgNaV1). An additional effect seen only with Mb1a on BgNaV1 was a delay in fast inactivation. Comparison of the NaV channel sequences of the tested insect species revealed that variations in the S1–S2 loops in the voltage sensor domains might underlie the differences in activity between different phyla.

1. Introduction

Spider venoms contain a plethora of bioactive peptides that target a diverse range of vertebrate and invertebrate voltage-gated ion channels [,]. Spider venoms evolved for two main purposes: defense against predators [] and as a chemical weapon for prey capture [,]. Since insects are the predominant prey of most spiders, these arachnids have developed a range of toxins that are highly effective at incapacitating insects []. There are over 46,600 extant spider species [], with the venoms of some spiders containing >1000 different peptides []. Thus, spider venoms are an ideal source of toxins that can be used to study insect ion channels, or as potential candidates for the development of insecticides [,]. The two major pharmacological targets of spider-venom peptides are voltage-gated calcium (CaV) channels and voltage-gated sodium (NaV) channels [,]. Both channels consist of four homologous domains (DI–DIV), each of which contains six transmembrane helices (S1–S6). The four sets of S5–S6 helices come together to form the pore of the channel, while each S1–S4 region serves as an independent voltage sensor [,]. Many chemical insecticides target insect NaV channels and bind to the S5–S6 pore region, but these insecticides are becoming less useful due to increasing resistance in pest species [,,,]. However, spider venoms represent a source of novel toxins that act on insect NaV channels via a different mode of action to extant chemical insecticides. The majority of spider toxins are gating modifiers that interact with the voltage-sensing domains and not the pore region, and therefore pests resistant to current NaV channel insecticides would likely be sensitive to spider toxins []. In addition to NaV channels, insect CaV channels are an emergent insecticidal target, and they are another major target of spider toxins [,]. Indeed, a spider toxin that inhibits insect CaV channels has been developed into a bioinsecticide called SPEARTM that will become commercially available early 2017 [].
This study describes the isolation, recombinant production, and characterization of the disulfide-rich peptides µ/ω-TRTX-Mb1a and µ/ω-TRTX-Mb1b (hereafter Mb1a and Mb1b) from venom of the African tarantula Monocentropus balfouri. Both peptides inhibited NaV and CaV channel currents in cockroach neurons as well as the cloned NaV channel from the German cockroach Blatella germanica. Mb1a and Mb1b are paralytic to the dipterans L. cuprina and M. domestica, but do not affect the lepidopteran H. armigera. We propose that variations between taxa in the S1–S2 loops of the NaV channel voltage-sensor domains underlie the differences in activity between phyla and mode of action of Mb1a and Mb1b. Ultimately, understanding how spider toxins bind to insect NaV and CaV channels will facilitate the rational design of bioinsecticides with better toxicity and selectivity profiles than the current arsenal of chemical insecticides.

2. Results

2.1. Isolation and Sequencing of µ/ω-TRTX-Mb1a and -Mb1b

A screen of insecticidal activity by injection into sheep blowflies of fractions resulting from reversed-phase (RP) HPLC separation of M. balfouri venom revealed that the fraction eluting at ~35% solvent B concentration (Figure 1) induced paralysis that was reversible within 24 h. Mass spectrometry revealed that this fraction consists of a single peptide with monoisotopic (M + H+) mass 4147.00 Da (Figure 1, inset). N-terminal sequencing of this peptide revealed the first 36 residues as GVDKPGCRYMFGGCVQDDDCCPHLGCKRKGLYCAWD(A)(T), with residues 37 and 38 shown in parentheses due to sequencing ambiguities. The two C-terminal residues cannot be both A and T as this would yield a sequence whose mass does not correspond to that of the observed peptide. Therefore, two peptide sequences were derived that matched the observed mass, one with ′GT-NH2′ as the C-terminus and another with ′AS-NH2′. In an attempt to ascertain the two terminal residues, LC-MS/MS was performed on a nine-residue C-terminal fragment of reduced and alkylated native peptide liberated by tryptic digestion. Analysis of the b- and y-ion series revealed three matches for ′GT-NH2′ while only one match corresponded to ′AS-NH2′ therefore ′GT-NH2′ is the most likely C-terminal sequence of the native peptide. Nevertheless, both peptide sequences were expressed for further characterization as the native sequence was not conclusively determined. Based on their activity (see below) and the species of origin, the two peptides were named in accordance with published nomenclature guidelines [] as µ/ω-TRTX-Mb1a (sequence GVDKPGCRYMFGGCVQDDDCCPHLGCKRKGLYCAWDGT) and µ/ω-TRTX-Mb1b (sequence GVDKPGCRYMFGGCVQDDDCCPHLGCKRKGLYCAWDAS).
Figure 1. (a) Photo of a female M. balfouri; (b) Chromatogram resulting from RP-HPLC fractionation of M. balfouri venom. The peak highlighted in red contains the µ/ω-TRTX-Mb1a/b peptide. The dotted line indicates the gradient of solvent B (90% acetonitrile/0.1% formic acid). Inset is a MALDI-TOF mass spectrum of the isolated µ/ω-TRTX-Mb1a/b peptide.

2.2. Recombinant Production of Mb1a and Mb1b

Recombinant Mb1a and Mb1b were produced by overexpression in the periplasm of Escherichia coli using the system we previously optimized for expression of disulfide-rich venom peptides []. The fusion protein was the major soluble protein expressed after induction, and cleavage of the fusion protein with tobacco etch virus (TEV) protease liberated free recombinant Mb1a (Figure 2, top inset) and Mb1b (not shown). RP-HPLC purification of the cleaved peptides resulted in elution profiles consisting of two peaks (Figure 2) with the correct mass (m/z calculated: 4147.8 Da, observed: 4147.9 Da) (Figure 2, bottom inset). Re-injection of each peak separately resulted in the reappearance of two peaks (data not shown), suggesting possible cis-trans isomerization of the proline residue at position 5 or 22. The final yield for both peptides was ~100 μg per litre of bacterial culture. The recombinant peptides were used for all in vitro and in vivo assays.
Figure 2. Recombinant production of Mb1a. Semi-preparative RP-HPLC chromatogram of recombinant Mb1a released by TEV protease cleavage of the MBP-Mb1a fusion protein (see Materials and Methods for more details). The dotted line indicates the gradient of solvent B (90% acetonitrile/0.043% TFA). Top inset: SDS-PAGE gel showing pre-cleaved MBP-Mb1a fusion protein (lane 1) and remaining MBP after cleavage (lane 2). Lane M contains molecular markers (masses in kDa). Bottom inset: MALDI-TOF mass spectrum of pure recombinant Mb1a.

2.3. Insecticidal Activity of µ/ω-TRTX-Mb1a and -Mb1b

Both Mb1a and Mb1b caused fast, but fully reversible, paralysis of sheep blowflies (L. cuprina) with median paralytic dose (PD50) values in the range of 5600–5800 pmoL/g at 30 min post-injection (Figure 3). No lethal effects were observed, and paralysis was fully reversed after 24 h. Complete paralysis was also seen for both Mb1a and Mb1b at 60 min post-injection into house flies (M. domestica), with partial recovery observed after 24 h (Mb1a: 3/5 recovered; Mb1a: 4/5 recovered). In contrast, injection of up to 73.4 nmoL/g of Mb1b into cotton bollworms (H. armigera larvae) did not induce any paralytic effects. No lethality or significant changes in the weight gain of the larvae occurred within the 72-h observation period.
Figure 3. Insecticidal effects of recombinant (a) Mb1a and (b) Mb1b. Toxins were injected intra-thoracically into L. cuprina blowflies and paralytic effects measured at 0.5, 1, 2 and 24 h post injection. PD50 values for each time-intervals (±S.E.M.) are indicated. Hill slopes for Mb1a were 2.01 (0.5 h), 2.24 (1.0 h), 2.53 (2.0 h), and for Mb1b: 2.23 (0.5 h), 2.74 (1.0 h), 2.98 (2.0 h). No lethality was observed, and the paralytic effects caused by both toxins were fully reversible within 24 h.

2.4. Activity of Mb1a and Mb1b on Insect NaV Channel Currents

At a concentration of 1 μM, both Mb1a (Figure 4a) and Mb1b (Figure 4b) reversibly inhibited endogenous sodium channel currents (INa) in dorsal unpaired median (DUM) neurons isolated from the American cockroach Periplaneta americana. Mb1a rapidly inhibited 91.5 ± 3.0% of the current (n = 5; τon = 16.1 s; Figure 4b,d), while Mb1b was slightly less potent, inhibiting current by 84.3 ± 3.7% (n = 3; τon = 18.7 s; Figure 4c,e). Tail currents were unaffected by Mb1a and Mb1b (Figure 4b,c).
Figure 4. Effects of 1 μM Mb1a and Mb1b on P. americana DUM neuron INa. (a) The depolarizing voltage test protocol (Vtest) used to elicit INa at 0.1 Hz. (b,c) Representative superimposed current traces elicited by Vtest prior to (black lines), and 3 min following, exposure to 1 μM Mb1a ((b), red line) and Mb1b (c, red line). Solid gray lines represent INa recorded 3 min after perfusion with toxin-free solution, while dashed gray lines represent zero current. (d,e) Timecourse of the block of INa by 1 µM Mb1a (d) and Mb1b (e). Average normalized peak INa before (open circles), during (red circles), and after (blue circles) perfusion with 1 μM toxin. Values represent the mean ± S.E.M of 5 (d) or 3 (e) experiments. The rate constant for association of the toxin to the channel (τon) was calculated using Equation (1) defined in the Materials and Methods. There was no significant difference in current inhibition by Mb1a and Mb1b (p = 0.169).
To investigate if current inhibition was caused by a toxin-induced shift in the voltage- dependence of NaV channel activation, INa/V curves were generated before (Figure 5b) and after (Figure 5c) addition of 100 nM Mb1a. No shift in INa/V curves was observed following perfusion with toxin (Figure 5d). To determine if toxin-induced block was voltage-dependent, the peak current in the presence of 100 nM Mb1a was plotted as a percentage of the control current (Figure 5e). There was no significant change in the extent of inhibition for INa depolarizations ranging from −40 mV to 0 mV, indicating that toxin-induced block is voltage-independent over this range.
Figure 5. Effect of 100 nM Mb1a on the voltage-dependence of activation of P. americana DUM neuron NaV channels. (a) Families of NaV channel currents were elicited by depolarizing test pulses to +40 mV from a holding potential of −90 mV in 10-mV steps. Representative superimposed families of INa are shown prior to (b), and 5 min after (c), application of 100 nM Mb1a. Currents were generated using the test pulse protocol shown in panel a. (d) Normalised INa-V relationships before (open circles), and after (red circles and shaded), application of 100 nM Mb1a. Data were fitted using Equation (1) (see Materials and Methods). Currents recorded in the presence of toxin were normalised against maximum peak INa in controls (red solid curve) and maximum peak INa in the presence of toxin (red dashed curve). (e) Linear regression analysis of the data using Equation (2) (see Materials and Methods) revealed that inhibition of INa was voltage-independent over the range −40 to 0 mV in the presence of 100 nM Mb1a. Data points are the mean ± S.E.M of 3 experiments.
Mb1a and Mb1b were also tested on the cloned BgNaV1 channel from the German cockroach (Blattella germanica), heterologously expressed in Xenopus oocytes. (Note that the orthologous P. americana NaV channel has never been functionally expressed in oocytes.) Similar to their activity on American cockroach NaV channels, application of Mb1a or Mb1b to BgNaV1 caused a reduction in peak BgNaV1 currents with no shift in the GNa-V curve (Figure 6a). However, application of Mb1a caused inhibition of fast inactivation, which was not seen with Mb1b (Figure 6b). Therefore, the C-terminal residues ′GT′ are responsible for the inhibition of fast inactivation seen with Mb1a, likely mediated by an additional interaction with the domain IV voltage-sensor [].
Figure 6. (a) Effect of 200 nM Mb1a (left) or Mb1b (right) on BgNaV1. Normalized conductance- voltage (G-V) relationships (G/Gmax) are shown by closed circles and steady-state inactivation (SSI) relationships (I/Imax) by open circles, before (black) and after (red) toxin addition. Normalization was performed relative to the peak current before toxin addition. Solid and dashed lines depict, respectively, the G-V and SSI curves fit using the standard Boltzmann equation. Oocytes were depolarized in 5-mV steps from a holding potential of –90 mV up to 5 mV for 50 ms, followed by a depolarizing pulse to −15 mV for 50 ms. Peak current from the initial step series was converted to conductance and normalized to create the G-V relationship while peak current from the following –15 mV voltage depolarization step was normalized to yield the SSI relationship. Mb1a caused a decrease in peak current and increase in persistent current, while Mb1b reduced peak current without affecting persistent current (n = 4; error bars represent S.E.M) (b) Representative examples of the effects of Mb1a (left) and Mb1b (right) on BgNaV1 current when depolarized to –15 mV, with black and red traces corresponding to the current before and after toxin application, respectively. Each set of traces is taken from an individual oocyte used to generate the data shown in panel (a). Note that the persistent current seen in the traces in panel (b) does not result from inhibition of fast inactivation by Mb1a and Mb1b since BgNav1 inherently possesses these characteristics at mildly depolarizing voltages [,,].

2.5. Effect of Mb1a and Mb1b on Insect CaV Channel Currents

At a concentration of 1 μM, Mb1a and Mb1b rapidly and irreversibly inhibited both mid-/low-voltage-activated (M-LVA) and high-voltage-activated (HVA) CaV channel currents endogenously present in P. americana DUM neurons (Figure 7 and Figure 8). Mb1a was slightly more potent than Mb1b on both types of CaV channel currents, with 45% of M-LVA CaV channel currents and 48% of HVA CaV channel currents inhibited by Mb1a (Figure 7b and Figure 8b, respectively) compared with 27% inhibition of M-LVA currents and 34% inhibition of HVA CaV channel currents by Mb1b (Figure 7c and Figure 8c, respectively). Mb1a did not shift the IBa/V curve (Figure 9a–d), and its inhibition of CaV channel currents was voltage-independent (Figure 9e).
Figure 7. The effects of 1 μM Mb1a and Mb1b on P. americana M-LVA CaV channel currents. (a) M-LVA IBa were elicited by 100-ms depolarizing test pulses to –20 mV from a holding potential of –90 mV. (b,c) Representative superimposed M-LVA IBa showing tonic block of M-LVA CaV channel currents before (black lines) and following (red lines) a 3 min perfusion, with (b) 1 µM Mb1a and (c) 1 µM Mb1b. Dashed gray lines represent zero current. (d,e) Timecourse of inhibition of normalized peak M-LVA CaV channel currents by (d) 1 µM Mb1a and (e) 1 µM Mb1b. Data are mean ± S.E.M, n = 4. Average normalized peak IBa before (open circles), during (red circles), and after (blue circles) perfusion with 1 μM toxin. Data are mean ± S.E.M of 5 (panel d) or 3 (panel e) experiments. Inhibition of IBa by Mb1a was significantly greater than for Mb1b (p = 0.008).
Figure 8. Effect of 1 μM Mb1a and Mb1b on P. americana HVA CaV channel currents. (a) M-LVA IBa were elicited by 100-ms depolarizing test pulses to +20 mV from a holding potential of −90 mV. (b,c) Representative superimposed HVA IBa showing tonic block of HVA CaV channel currents before (black lines) and following a 3 min perfusion (red lines) with (b) 1 µM Mb1a and (c) 1 µM Mb1b. Dashed gray lines represent zero current. (d,e) Timecourse of inhibition of normalized peak HVA CaV channel currents by (d) 1 µM Mb1a and (e) 1 µM Mb1b. Data are mean ± S.E.M, n = 4. Average normalized peak IBa before (open circles), during (red circles), and after (blue circles) perfusion with 1 μM toxin. Data are mean ± S.E.M of 5 experiments (panel d) or 3 experiments (panel e). Inhibition of IBa by Mb1a was significantly greater than for Mb1b (p = 0.007).
Figure 9. Effect of 1 µM Mb1a on the voltage-dependence of activation of P. americana DUM neuron CaV channels. (a) Families of CaV channel currents were elicited by depolarizing test pulses to +40 mV from a holding potential of –90 mV in 10-mV steps. Representative superimposed families of INa are shown prior to (b), and 5 min after (c), application of 1 µM Mb1a. Currents were generated using the test pulse protocol shown in panel a. (d) Normalised IBa-V relationships before (open circles) and after (red circles and shaded) application of 1 µM Mb1a generated using the pulse protocol in panel a. Data were fitted using Equation (2) (see Materials and Methods). Currents recorded in the presence of toxin were normalised against maximum peak IBa in controls (red solid curve) and maximum peak IBa in toxin (red dashed curve). (e) Linear regression analysis of the data using Equation (2) (see Materials and Methods) revealed that inhibition of IBa by 100 nM Mb1a was voltage-independent over the range –40 to +10 mV. Data points are mean ± S.E.M, n = 4.

3. Discussion

3.1. Promiscuous Pharmacology of Mb1a/1b

The closest homologues of Mb1a and-Mb1b are the spider toxins ω-TRTX-Hg1a (71% identity) [,], β-TRTX-Cm2a (68% identity) [] and ω-TRTX-Pm1a (68% identity) [] (Figure 10), all of which are active on vertebrate voltage-gated ion channels. None of these toxins have been tested against insects. It is interesting to note that the CaV channel inhibitors ω-TRTX-Hg1a and ω-TRTX-Pm1a also modulate NaV channel currents by reducing peak current and delaying fast inactivation [,], akin to the action of Mb1a on BgNaV1 (Figure 6).
Figure 10. Sequence alignment of Mb1a and Mb1b with their closest homologues. Amino acids identical to Mb1a are in bold and differences are highlighted in gray. Cysteines are coloured blue.
The C-terminus of ω-TRTX-Pm1a was found to be critical for its activity: a C-terminally truncated analogue was almost inactive on both CaV and NaV channels []. Similarly, we found that the activity of Mb1a/1b was influenced by the C-terminal region, with the putative native toxin, Mb1a, being more potent at inhibiting CaV channels than Mb1b. Furthermore, the two C-terminal residues of Mb1a are responsible for its inhibition of fast inactivation in BgNaV1, as this was not observed with Mb1b. It is interesting that the delay in inactivation appears to be simply due to the loss and/or addition of a methyl group of the side chains of G and T, respectively, compared to those of AS. The ability of Mb1a to inhibit peak BgNaV1 currents and delay fast inactivation contrasts with that of the toxin PnTx4(5-5) from Phoneutria nigriventer, which enhances peak current in addition to causing delayed inactivation of BgNaV1 [].
Fast inactivation of NaV channels is mediated by domain IV, and spider toxins interacting with the S3–S4 extracellular loop in channel domain IV (DIV) have been found to inhibit fast inactivation [,]. The loss of inhibition of fast inactivation by Mb1b suggests that the C-terminal ′GT′ residues in Mb1a facilitate its interaction with the domain IV voltage sensor of BgNaV1. Notably, Mb1a did not delay fast inactivation of P. americana NaV channel currents, even though the DIV S3–S4 DIV loop is identical in the P. americana and B. germanica NaV channels. However, numerous recent studies have revealed that the extracellular S1–S2 loops can be important sites for toxin recognition [,,,,,,]. A comparison of the DIV S1–S2 region of the P. americana and B. germanica channels reveals only a single difference (K1634Q; Figure 11), which may be at least partly responsible for the ability of Mb1a to inhibit the fast inactivation of B. germanica NaV channels.
Figure 11. Alignment of the S1–S2 regions from each of the four domains (DI–DIV) in the NaV channels from P. americana (UniProt D0E0C1), B. germanica (UniProt O01307), and H. armigera (deduced from the published genome). The S1–S2 extracellular loops from the four domains are coloured purple (DI), red (DII), blue (DIII) and green (DIV). Differences in amino acid sequence between species are highlighted in grey. The boundaries of S1 and S2 are based on the recently determined structure of the P. americana NaVPaS channel [].
Inhibition of peak INa without a shift in the INa/V curve, as seen with Mb1a and Mb1b, may indicate a simple pore blocking mechanism of action. However, most NaV channel spider toxins are gating modifiers [,] that interact with the voltage sensor domains [], and numerous spider toxins such as μ-TRTX-Hs2a (huwentoxin IV; []) and μ-TRTX-Hd1a [] have been found to inhibit NaV channels by interacting with the DII voltage sensor without causing a shift in the voltage-dependence of channel activation. Therefore, it is likely that Mb1a and Mb1b inhibit insect NaV channels via gating modification. Compared to NaV channels, much less is known about how spider toxins interact with CaV channels []. Spider toxins that affect CaV channels are generally thought to act as gating modifiers, although some toxins such as ω-AGTX-Aa3a and ω-SGTX-Sf1a are believed to be pore blockers [,,]. Mb1a and Mb1b both inhibit peak CaV channel currents without shifting the IBa/V curve, consistent with them being pore blockers. However, further experiments will be required to determine the binding sites of these two peptides on insect CaV and NaV channels.

3.2. Phyletic Selectivity of Mb1a/1b

Several spider toxins have been found to paralyze or kill the dipterans L. cuprina and M. domestica, with activities ranging from 198 pmoL/g (LD50; U1-AGTX-Ta1a) to 2229 pmoL/g (PD50; μ-SGTX-Sf1a) on L. cuprina, and 77 pmoL/g (LD50; ω-HXTX-Hv1a) to 1380 pmoL/g (LD50; μ-AGTX-Aa1b) on M. domestica [,,,]. With PD50 values of 5600–5800 pmoL/g, Mb1a and Mb1b are only moderately potent against L. cuprina compared to other spider toxins that affect dipterans.
Notably, Mb1a and Mb1b were inactive against H. armigera, suggesting they do not modulate the activity of H. armigera NaV or CaV channels. Since a BAC library of the H. armigera genome has been published [,], we used this to deduce the sequence of the H. armigera NaV channel and compared it to that of B. germanica and P. americana channels on which Mb1a and Mb1b are active (Figure 11). The S3–S4 loops are identical in all four voltage-sensor domains of the of P. americana, B. germanica and H. armigera NaV channels, indicating that these regions are not responsible for the differences in activity. However, the S1–S2 loops of all four domains of the H. armigera NaV channel contain variations in amino acid sequence compared to both cockroach species (Figure 11). Thus, Mb1a and Mb1a possibly provide additional examples of insecticidal toxins where differences in phyletic selectivity are due to taxonomic variations in the sequences of the S1–S2 loops [,].

4. Conclusions

Mb1a and Mb1b add to the expanding repertoire of spider toxins that are active against insects. Due to a high level of homology with toxins active on vertebrates, Mb1a and Mb1b may have an activity on vertebrate NaV or CaV channels that would render them unsuitable candidates for bioinsecticide development. However, the closest vertebrate-active homolog is only 71% identical with 11 differences in amino acid sequence (Figure 10), and it is well known that even small differences in venom-peptide sequences can alter their channel and species selectivity. Even if Mb1a and Mb1b turn out to be vertebrate active, differences in their mechanism of action make them useful tools for studying insect NaV channels. Moreover, Mb1a and Mb1b contribute to the growing body of evidence derived from animal toxins which suggests that phyletic selectivity can be achieved by targeting the voltage-sensor domains of insect NaV channels.

5. Materials and Methods

5.1 Venom Collection

Venom from a single female Monocentropus balfouri was extracted using mild electrical stimulation [], then the venom was lyophilized and kept frozen until reconstituted and used for the experiments.

5.2. Fractionation of Crude Venom

1 mg of dried M. balfouri venom was fractionated using a Jupiter C18 analytical RP-HPLC column (25 cm × 4 mm, 5 µm, Phenomenex Australia Pty. Ltd., Sydney, Australia) connected to a Shimadzu Prominence HPLC system. The flow rate was 1 mL/min. Varying gradients of solvent A (0.1% formic acid) and solvent B (90% acetonitrile/ 0.1% formic acid) were used. Isocratic elution with 5% solvent B was used for the first 5 min, followed by 5–20% solvent B over 5 min, 20–40% solvent B over 40 min, 40–80% solvent B over 5 min, then 80% solvent B for 2 min.

5.3. Sequencing of Active Peptide

N-terminal Edman sequencing, including the prior reduction and alkylation of Mb1a/b with TCEP/iodoethanol, was performed by the Australian Proteome Analysis Facility (APAF). The sample (30 µL) was loaded onto a precycled, biobrene-treated discs and subjected to 40 cycles of Edman N-terminal sequencing. The analysis was run using the pulsed liquid method with a modified begin cycle to include extra washes. Automated Edman degradation was carried out using an Applied Biosystems 494 Procise Protein Sequencing System. Performance of the sequencer was assessed routinely with 10 pmoL β-lactoglobulin standard.

5.4. Recombinant Production of Mb1a and Mb1b

Recombinant Mb1a and Mb1b were produced by expression in the periplasm of Escherichia coli using a previously described protocol []. Briefly, a synthetic gene encoding Mb1a and Mb1b was cloned into a variant of the pLic-MBP expression vector by GeneArt (Invitrogen, Regensburg, Germany). Codons were optimized for expression in E. coli. The modified pLic-MBP vector encodes a MalE signal sequence for periplasmic export of the fusion protein, a His6 tag for affinity purification, a maltose-binding protein (MBP) fusion tag to aid solubility, and a tobacco etch virus (TEV) protease recognition site directly preceding the toxin sequence. The plasmids encoding Mb1a and Mb1b were transformed via heat shock into E. coli strain BL21(λDE3) for production of recombinant toxin. Protein expression and purification were performed as previously described with minor modifications. In summary, a 50 mL overnight starter culture grown in Luria-Bertani broth at 37 °C with shaking (~220 rpm) was used to inoculate a 2 liter culture the following day. After the culture reached an OD600 of ~1.0, toxin gene expression was induced with 500 μM IPTG. Cells were grown at 30 °C overnight before centrifugation for 15 min at 10,500 g to obtain the cell pellet. The pellet was then reconstituted in a minimal amount of TN buffer (20 mM Tris, 250 mM NaCl, pH 8), then cells were lysed at 27 kpsi using a constant-pressure cell disruptor (TS Series Cell Disrupter, ConstantSystems Ltd., Daventry, UK).
The cell lysate was passed over a column containing Ni-NTA Superflow resin (Qiagen Pty Ltd., Chadstone, VIC, Australia) and weakly bound proteins were eluted with 15 mM imidazole in TN buffer. The MBP-toxin fusion protein was then eluted with 300 mM imidazole in TN buffer, after which the eluate was spun in a 30 kDa cut-off centrifugal filter to remove the imidazole and concentrate the protein to 5 mL. The resulting solution was diluted to 10 mL with TN buffer, then the fusion protein was cleaved overnight at room temperature using ~100 μg TEV protease in 0.6 mM and 0.4 mM reduced and oxidised glutathione, respectively []. 0.1% TFA was then added to precipitate the cleaved His6-MBP protein; the sample was then centrifuged at 17,000 g to pellet the precipitant. The supernatant was filtered with a 0.45 μm syringe filter (EMD Millipore, Billerica, MA, USA) before purification of recombinant Mb1a or Mb1b using semi-preparative RP-HPLC (Phenomenex Jupiter C4 column; 250 × 10 mm, 10 μm; flow rate 5 mL/min). Recombinant toxin was eluted using a gradient of 10–45% solvent B (0.043% TFA in 90% acetonitrile) in solvent A (0.05% TFA in water) over 30 min. Further purifications were performed using an Agilent C18 column (ZORBAX 300SB; 250 × 9.4 mm, 5 μm; flow rate 3 mL/min) with appropriate solvent gradients.

5.5. Insecticidal Assays

5.5.1. Sheep Blowflies and House Flies

Mb1a and Mb1b were dissolved in insect saline (see [] for composition) and injected into the ventro-lateral thoracic region of adult sheep blowflies (Lucilia cuprina) or house flies (Musca domestica) according to methods described previously []. Briefly, a maximum of 2 µL was injected per fly using a 1.0 mL Terumo Insulin syringe with a fixed 29-gauge needle fitted to an Arnold hand micro-applicator (Burkard Manufacturing Co. Ltd., Rickmansworth, UK). Flies were individually housed in 2 mL tubes and paralytic effects determined 0.5, 1, 2 and 24 h after injection. For L. cuprina, three replicates were performed and for each replicate six doses of Mb1a or Mb1b (n = 10 flies per dose) was used, along with appropriate controls (insect saline; n = 20 flies each). Dose-response data were fitted using the sigmoidal dose-response (variable slope) function in Prism 6. For M. domestica, a single replicate (n = 5) of one dose of Mb1a or Mb1b was injected (Mb1a: 15 nmoL/g, Mb1b: 11.7 nmoL/g). PD50 and LD50 values were calculated as previously described [].
We defined “complete paralyzed” flies as those that could move their appendages (legs and proboscis), but were unable to fly or drag their body forward when placed onto a flat bench. At earlier times post-injection, or at lower doses, we observed “incomplete paralyzed” flies that had uncoordinated movement (e.g., due to some extremities twitching or being paralyzed) but which were nevertheless able to move their body along a flat bench even though they could not fly.

5.5.2. Cotton Bollworms

Cotton bollworms (i.e., Helicoverpa armigera larvae) were obtained from AgBiTech Pty Ltd. (Glenvale, QLD, Australia). Toxins were injected into the lateral thoracic region and larvae observed for paralytic or lethal effects at 0.5, 1, 3, 24, 48, and 72 h after injection. Larvae were kept in standard 6-well plates and fed on artificial diet (AgBiTech, Clifford Gardens, Australia). Larval weight was measured 24, 48 and 72 h after injection.

5.6. Patch Clamp Electrophysiology Using P. americana Neurons

DUM neurons were isolated from unsexed adult P. americana as described previously []. Briefly, terminal abdominal ganglia were removed and placed in normal insect saline (NIS) containing (in mM): NaCl 180, KCl 3.1, 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES) 10, d-glucose 20. Ganglia were then incubated in 1 mg/mL collagenase (type IA) for 40 min at 29 °C, washed twice in NIS, resuspended in NIS supplemented with 4 mM MgCl2, 5 mM CaCl2, 5% foetal bovine serum and 1% penicillin/streptomycin (NIS+; Life Technologies, Mulgrave, VIC, Australia), then triturated through a fire-polished Pasteur pipette. The resultant cell suspension was then distributed onto 12-mm diameter glass coverslips pre-coated with 2 mg/mL concanavalin A (type IV). DUM neurons were maintained in NIS+ at 29 °C and 100% humidity.
Ionic currents were recorded from DUM neurons in voltage-clamp mode using the whole-cell patch-clamp technique employing version 10.2 of the pCLAMP data acquisition system (Molecular Devices, Sunnyvale, CA, USA). Data were filtered at 10 kHz with a low-pass Bessel filter with leakage and capacitive currents subtracted using P–P/4 procedures. Digital sampling rates were set between 15 kHz and 25 kHz depending on the length of the protocol. Single-use 0.8–1.5 MΩ electrodes were pulled from borosilicate glass and fire-polished prior to current recordings. Liquid junction potentials were calculated using JPCALC, and all data were compensated for these values. Cells were bathed in external solution through a continuous pressurized perfusion system at 1 mL/min, while toxin solutions were introduced via a wide-bore gravity-fed perfusion needle at ~80 μL/min (Automate Scientific, San Francisco, CA, USA). All experiments were performed at ambient temperature (20–23 °C). To record sodium currents (INa), the external bath solution contained (in mM): NaCl 80, CsCl 5, CaCl2 1.8, tetraethylammonium chloride 50, 4-aminopyridine 5, HEPES 10, NiCl2 0.1, CdCl2 1, adjusted to pH 7.4 with 1 M NaOH. The pipette solution contained (in mM): NaCl 34, CsF 135, MgCl2 1, HEPES 10, ethylene glycol-bis(2-aminoethylether)-N,N,N′,N′-tetraacetic acid (EGTA) 5, and ATP-Na2 3, adjusted to pH 7.4 with 1 M CsOH. Note that in these and other electrophysiology experiments, peptides were tested at concentrations that yielded 50–75% inhibition of currents.
Two subtypes of CaV channel currents have been observed in P. americana DUM neurons: high-voltage-activated (HVA) and mid/low-voltage-activated (M-LVA) CaV channel currents [,]. Notwithstanding differences in the kinetic and pharmacological properties of M-LVA and HVA CaV channels, there is no mechanism for recording one current in isolation from the other, as no peptide or small molecule inhibitors have been developed that block one type of current and not the other []. Therefore, depolarizing voltage command pulses to different levels were used to investigate the actions of Mb1a and Mb1b on M-LVA and HVA CaV channels [,]. CaV channel currents were evoked by 100-ms depolarising pulses from a membrane holding potential (Vh) of –90 mV to potentials at 7-s intervals to −20 mV for generation of predominantly M-LVA CaV channel currents and to +20 mV to evoke mainly HVA CaV channel currents [].
Previous studies revealed significant rundown of CaV currents when calcium was used as a charge carrier, but much less when barium was used instead []; thus, we replaced CaCl2 with BaCl2 in all CaV channel experiments. The external bath solution for barium current (IBa) recordings contained (in mM): sodium acetate 140, TEA-bromide 30, BaCl2 3, HEPES 10, adjusted to pH 7.4 with 1 M TEA-OH. The external solution also contained 300 nM tetrodotoxin to block NaV channels. Pipette solutions contained (in mM): sodium acetate 10, CsCl 110, TEA-bromide 50, ATP-Na2 2, CaCl2 0.5, EGTA 10, HEPES 10, adjusted to pH 7.4 with 1 M CsOH.
To eliminate any influence of differences in osmotic pressure, all internal and external solutions were adjusted to 400 ± 5 mOsmol/L with sucrose. Experiments were rejected if leak currents exceeded 1 nA or if currents showed signs of poor space clamping. Peak current amplitude was analyzed offline using AxoGraph X v1.5.3 (Molecular Devices, Sunnyvale, CA, USA). All curve-fitting was performed using Prism 6 (GraphPad Software Inc., San Diefo, CA, USA). All data are mean ± SEM of n independent experiments. On-rates (τon) were calculated using the following Equation (1):
Y = Y 0 + ( A Y 0 ) × ( 1 exp ( K × t ) )
where Y0 is the maximal peak INa, A is the minimum peak INa, K is the rate constant and t is time. The on-rate (τon) was subsequently determined from the inverse of the rate constant (K).
The data for voltage-dependence of channel activation, for all channel types, were fitted using the following current-voltage (I/V) curve formula Equation (2):
I = g m a x ( 1 ( 1 1 + exp [ ( V V 1 / 2 ) / s ] ) ) ( V V r e v )
where I is the amplitude of the current at a given test potential V, gmax is the maximal conductance, V1/2 is the voltage at half-maximal activation, s is the slope factor and Vrev is the apparent reversal potential.
Differences in current inhibition between toxins was analysed using one-way ANOVA, with a probability of p < 0.05 being considered statistically significant.

5.7. Two–Electrode Voltage-Clamp Electrophysiology

BgNaV1 [] cRNA was synthesized using T7 polymerase (mMessage mMachine kit, Life Technologies, Carlsbad, CA, USA) after linearizing the fully-sequenced DNA with NotI. BgNaV1 was expressed in Xenopus oocytes together with the TipE subunit [] (1:5 molar ratio), and studied following a 1-day incubation after cRNA injection. Cells were incubated at 17 °C in ND96 consisting of (in mM) NaCl 96, KCl 2, HEPES 5, MgCl2 1, CaCl2 1.8, pH 7.6 with NaOH supplemented 50 μg/mL gentamycin, then studied using two-electrode voltage-clamp recording techniques (OC-725C, Warner Instruments, Hamden, CT, USA) with a 150-μL recording chamber. Data were filtered at 4 kHz and digitized at 20 kHz using pClamp software (Molecular Devices, Sunnyvale, CA, USA). Microelectrode resistances were 0.5–1 MΩ when filled with 3 M KCl. The external recording solution consisted of ND96. All experiments were performed at room temperature (~22 °C). Leak and background conductances, identified by blocking the channel with tetrodotoxin, were subtracted for all currents shown. Voltage-activation relationships were obtained by measuring steady-state currents and calculating conductance. Protocols for other measurements are described in the figure legends. After addition of toxin to the recording chamber, the equilibration between the toxin and the channel was monitored using weak depolarizations elicited at 5-s intervals. For all channels, voltage-activation relationships were recorded in the absence and presence of toxin. Off-line data analysis was performed using Clampfit 10 (Molecular Devices, Sunnyvale, CA, USA) and Origin 8.0 (Originlab, Northampton, MA, USA).

Acknowledgments

The authors thank the Australian Grains Research & Development Corporation (GRDC; Project UQ00048, Kingston, Australia) for financial support, Arnd Schlosser (Bremen, Germany) for venom extraction, Michael Scheller (Mainz, Germany) for providing the spider, Geoff Brown (Department of Agriculture, Fisheries and Forestry, Brisbane, Australia) for supply of blowflies, and Ke Dong (Michigan State University, East Lansing, MI, USA) for sharing the BgNaV1/TipE clones. This research was facilitated by access to the Australian Proteome Analysis Facility (Sydney, Australia), which is supported under the Australian Government’s National Collaborative Research Infrastructure Strategy. G.F.K. is supported by a Principal Research Fellowship (APP1044414) from the Australian National Health & Medical Research Council (Canberra, Australia).

Author Contributions

Jennifer J. Smith, Volker Herzig, Maria P. Ikonomopoulou, Sławomir Dziemborowicz, Frank Bosmans and Glenn F. King conceived and designed the experiments; Jennifer J. Smith, Volker Herzig, Maria P. Ikonomopoulou, Sławomir Dziemborowicz and Frank Bosmans performed the experiments; Jennifer J. Smith, Volker Herzig, Sławomir Dziemborowicz, Frank Bosmans and Graham M. Nicholson analyzed the data; Frank Bosmans, Graham M. Nicholson and Glenn F. King contributed reagents/materials/analysis tools; Jennifer J. Smith, Volker Herzig, Maria P. Ikonomopoulou, Sławomir Dziemborowicz, Frank Bosmans, Graham M. Nicholson and Glenn F. King wrote the paper.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Saez, N.J.; Senff, S.; Jensen, J.E.; Er, S.Y.; Herzig, V.; Rash, L.D.; King, G.F. Spider-venom peptides as therapeutics. Toxins 2010, 2, 2851–2871. [Google Scholar] [CrossRef] [PubMed]
  2. Pineda, S.S.; Undheim, E.A.; Rupasinghe, D.B.; Ikonomopoulou, M.P.; King, G.F. Spider venomics: Implications for drug discovery. Future Med. Chem. 2014, 6, 1699–1714. [Google Scholar] [CrossRef] [PubMed]
  3. Bohlen, C.J.; Julius, D. Receptor-targeting mechanisms of pain-causing toxins: How ow? Toxicon 2012, 60, 254–264. [Google Scholar] [CrossRef] [PubMed]
  4. Escoubas, P.; Bosmans, F. Spider peptide toxins as leads for drug development. Expert Opin. Drug Discov. 2007, 2, 823–835. [Google Scholar] [CrossRef] [PubMed]
  5. Escoubas, P.; Rash, L. Tarantulas: Eight-legged pharmacists and combinatorial chemists. Toxicon 2004, 43, 555–574. [Google Scholar] [CrossRef] [PubMed]
  6. King, G.F.; Hardy, M.C. Spider-venom peptides: Structure, pharmacology, and potential for control of insect pests. Annu. Rev. Entomol. 2013, 58, 475–496. [Google Scholar] [CrossRef] [PubMed]
  7. Bern, N.H.M. World Spider Catalog. Available online: http://wsc.nmbe.ch (accessed on 3 May 2017).
  8. Escoubas, P.; Sollod, B.; King, G.F. Venom landscapes: Mining the complexity of spider venoms via a combined cDNA and mass spectrometric approach. Toxicon 2006, 47, 650–663. [Google Scholar] [CrossRef] [PubMed]
  9. Smith, J.J.; Herzig, V.; King, G.F.; Alewood, P.F. The insecticidal potential of venom peptides. Cell. Mol. Life Sci. 2013, 70, 3665–3693. [Google Scholar] [CrossRef] [PubMed]
  10. Smith, J.J.; Lau, C.H.Y.; Herzig, V.; Ikonomopoulou, M.P.; Rash, L.D.; King, G.F. Therapeutic applications of spider-venom peptides. In Venoms to Drugs: Venom as a Source for the Development of Human Therapeutics; King, G.F., Ed.; Royal Society of Chemistry: Cambridge, UK, 2015; pp. 221–244. [Google Scholar]
  11. Klint, J.K.; Senff, S.; Rupasinghe, D.B.; Er, S.Y.; Herzig, V.; Nicholson, G.M.; King, G.F. Spider-venom peptides that target voltage-gated sodium channels: Pharmacological tools and potential therapeutic leads. Toxicon 2012, 60, 478–491. [Google Scholar] [CrossRef] [PubMed]
  12. Ahern, C.A.; Payandeh, J.; Bosmans, F.; Chanda, B. The hitchhiker’s guide to the voltage-gated sodium channel galaxy. J. Gen. Physiol. 2016, 147, 1–24. [Google Scholar] [CrossRef] [PubMed]
  13. Davies, T.G.; Field, L.M.; Usherwood, P.N.; Williamson, M.S. DDT, pyrethrins, pyrethroids and insect sodium channels. IUBMB Life 2007, 59, 151–162. [Google Scholar] [CrossRef] [PubMed]
  14. Du, Y.; Nomura, Y.; Satar, G.; Hu, Z.; Nauen, R.; He, S.Y.; Zhorov, B.S.; Dong, K. Molecular evidence for dual pyrethroid-receptor sites on a mosquito sodium channel. Proc. Natl. Acad. Sci. USA 2013, 110, 11785–11790. [Google Scholar] [CrossRef] [PubMed]
  15. Du, Y.; Nomura, Y.; Zhorov, B.S.; Dong, K. Sodium channel mutations and pyrethroid resistance in Aedes aegypti. Insects 2016, 7, 60. [Google Scholar] [CrossRef] [PubMed]
  16. Zhang, Y.; Du, Y.; Jiang, D.; Behnke, C.; Nomura, Y.; Zhorov, B.S.; Dong, K. The receptor site and mechanism of action of sodium channel blocker insecticides. J. Biol. Chem. 2016, 291, 20113–20124. [Google Scholar] [CrossRef] [PubMed]
  17. Gilchrist, J.; Olivera, B.M.; Bosmans, F. Animal toxins influence voltage-gated sodium channel function. Handb. Exp. Pharmacol. 2014, 221, 203–229. [Google Scholar] [PubMed]
  18. King, G.F. Modulation of insect CaV channels by peptidic spider toxins. Toxicon 2007, 49, 513–530. [Google Scholar] [CrossRef] [PubMed]
  19. Bomgardner, M. Spider venom: An insecticide whose time has come? Chem. Eng. News 2017, 95, 30–31. [Google Scholar]
  20. King, G.F.; Gentz, M.C.; Escoubas, P.; Nicholson, G.M. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon 2008, 52, 264–276. [Google Scholar] [CrossRef] [PubMed]
  21. Klint, J.K.; Senff, S.; Saez, N.J.; Seshadri, R.; Lau, H.Y.; Bende, N.S.; Undheim, E.A.; Rash, L.D.; Mobli, M.; King, G.F. Production of recombinant disulfide-rich venom peptides for structural and functional analysis via expression in the periplasm of E. coli. PLoS ONE 2013, 8. [Google Scholar] [CrossRef] [PubMed]
  22. Liu, Z.; Song, W.; Dong, K. Persistent tetrodotoxin-sensitive sodium current resulting from U-to-C RNA editing of an insect sodium channel. Proc. Natl. Acad. Sci. USA 2004, 101, 11862–11867. [Google Scholar] [CrossRef] [PubMed]
  23. Bende, N.S.; Kang, E.; Herzig, V.; Bosmans, F.; Nicholson, G.M.; Mobli, M.; King, G.F. The insecticidal neurotoxin Aps III is an atypical knottin peptide that potently blocks insect voltage-gated sodium channels. Biochem. Pharmacol. 2013, 85, 1542–1554. [Google Scholar] [CrossRef] [PubMed]
  24. Bende, N.S.; Dziemborowicz, S.; Mobli, M.; Herzig, V.; Gilchrist, J.; Wagner, J.; Nicholson, G.M.; King, G.F.; Bosmans, F. A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat. Commun. 2014, 5, 4350. [Google Scholar] [CrossRef] [PubMed]
  25. Newcomb, R.; Szoke, B.; Palma, A.; Wang, G.; Chen, X.; Hopkins, W.; Cong, R.; Miller, J.; Urge, L.; Tarczy-Hornoch, K.; et al. Selective peptide antagonist of the class E calcium channel from the venom of the tarantula Hysterocrates gigas. Biochemistry 1998, 37, 15353–15362. [Google Scholar] [CrossRef] [PubMed]
  26. Bourinet, E.; Stotz, S.C.; Spaetgens, R.L.; Dayanithi, G.; Lemos, J.; Nargeot, J.; Zamponi, G.W. Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels. Biophys. J. 2001, 81, 79–88. [Google Scholar] [CrossRef]
  27. Bosmans, F.; Rash, L.; Zhu, S.; Diochot, S.; Lazdunski, M.; Escoubas, P.; Tytgat, J. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol. Pharmacol. 2006, 69, 419–429. [Google Scholar] [CrossRef] [PubMed]
  28. Klint, J.K.; Berecki, G.; Durek, T.; Mobli, M.; Knapp, O.; King, G.F.; Adams, D.J.; Alewood, P.F.; Rash, L.D. Isolation, synthesis and characterization of ω-TRTX-Cc1a, a novel tarantula venom peptide that selectively targets L-type Cav channels. Biochem. Pharmacol. 2014, 89, 276–286. [Google Scholar] [CrossRef] [PubMed]
  29. Arroyo, G.; Aldea, M.; Fuentealba, J.; Albillos, A.; Garcia, A.G. SNX482 selectively blocks P/Q Ca2+ channels and delays the inactivation of Na+ channels of chromaffin cells. Eur. J. Pharmacol. 2003, 475, 11–18. [Google Scholar] [CrossRef]
  30. Paiva, A.L.; Matavel, A.; Peigneur, S.; Cordeiro, M.N.; Tytgat, J.; Diniz, M.R.; de Lima, M.E. Differential effects of the recombinant toxin PnTx4(5–5) from the spider Phoneutria nigriventer on mammalian and insect sodium channels. Biochimie 2016, 121, 326–335. [Google Scholar] [CrossRef] [PubMed]
  31. Bosmans, F.; Martin-Eauclaire, M.F.; Swartz, K.J. Deconstructing voltage sensor function and pharmacology in sodium channels. Nature 2008, 456, 202–208. [Google Scholar] [CrossRef] [PubMed]
  32. Capes, D.L.; Goldschen-Ohm, M.P.; Arcisio-Miranda, M.; Bezanilla, F.; Chanda, B. Domain IV voltage-sensor movement is both sufficient and rate limiting for fast inactivation in sodium channels. J. Gen. Physiol. 2013, 142, 101–112. [Google Scholar] [CrossRef] [PubMed]
  33. Zhang, J.Z.; Yarov-Yarovoy, V.; Scheuer, T.; Karbat, I.; Cohen, L.; Gordon, D.; Gurevitz, M.; Catterall, W.A. Structure-function map of the receptor site for β-scorpion toxins in domain II of voltage-gated sodium channels. J. Biol. Chem. 2011, 286, 33641–33651. [Google Scholar] [CrossRef] [PubMed]
  34. Xiao, Y.; Blumenthal, K.; Jackson, J.O.; Liang, S.; Cummins, T.R. The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. Mol. Pharmacol. 2010, 78, 1124–1134. [Google Scholar] [CrossRef] [PubMed]
  35. Xiao, Y.; Jackson, J.O.; Liang, S.; Cummins, T.R. Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. J. Biol. Chem. 2011, 286, 27301–27310. [Google Scholar] [CrossRef] [PubMed]
  36. Osteen, J.D.; Herzig, V.; Gilchrist, J.; Emrick, J.J.; Zhang, C.; Wang, X.; Castro, J.; Garcia-Caraballo, S.; Grundy, L.; Rychkov, G.Y.; et al. Selective spider toxins reveal a role for the NaV1.1 channel in mechanical pain. Nature 2016, 534, 494–499. [Google Scholar] [CrossRef] [PubMed]
  37. Herzig, V.; Ikonomopoulou, M.; Smith, J.J.; Dziemborowicz, S.; Gilchrist, J.; Kuhn-Nentwig, L.; Rezende, F.O.; Moreira, L.A.; Nicholson, G.M.; Bosmans, F.; et al. Molecular basis of the remarkable species selectivity of an insecticidal sodium channel toxin from the African spider Augacephalus ezendami. Sci. Rep. 2016, 6. [Google Scholar] [CrossRef] [PubMed]
  38. Lau, C.H.; King, G.F.; Mobli, M. Molecular basis of the interaction between gating modifier spider toxins and the voltage sensor of voltage-gated ion channels. Sci. Rep. 2016, 6. [Google Scholar] [CrossRef] [PubMed]
  39. Shen, H.; Zhou, Q.; Pan, X.; Li, Z.; Wu, J.; Yan, N. Structure of a eukaryotic voltage-gated sodium channel at near-atomic resolution. Science 2017, 355. [Google Scholar] [CrossRef] [PubMed]
  40. Shon, K.J.; Olivera, B.M.; Watkins, M.; Jacobsen, R.B.; Gray, W.R.; Floresca, C.Z.; Cruz, L.J.; Hillyard, D.R.; Brink, A.; Terlau, H.; et al. μ-Conotoxin PIIIA, a new peptide for discriminating among tetrodotoxin-sensitive Na channel subtypes. J. Neurosci. 1998, 18, 4473–4481. [Google Scholar] [PubMed]
  41. Xiao, Y.; Bingham, J.P.; Zhu, W.; Moczydlowski, E.; Liang, S.; Cummins, T.R. Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain ii voltage sensor in the closed configuration. J. Biol. Chem. 2008, 283, 27300–27313. [Google Scholar] [CrossRef] [PubMed]
  42. Klint, J.K.; Smith, J.J.; Vetter, I.; Rupasinghe, D.B.; Er, S.Y.; Senff, S.; Herzig, V.; Mobli, M.; Lewis, R.J.; Bosmans, F.; et al. Seven novel modulators of the analgesic target NaV1.7 uncovered using a high-throughput venom-based discovery approach. Br. J. Pharmacol. 2015, 172, 2445–2458. [Google Scholar] [CrossRef] [PubMed]
  43. Salari, A.; Vega, B.S.; Milescu, L.S.; Milescu, M. Molecular interactions between tarantula toxins and low-voltage-activated calcium channels. Sci. Rep. 2016, 6, 23894. [Google Scholar] [CrossRef] [PubMed]
  44. Bourinet, E.; Zamponi, G.W. Block of voltage-gated calcium channels by peptide toxins. Neuropharmacology 2016, in press. [Google Scholar] [CrossRef] [PubMed]
  45. Mintz, I.M. Block of Ca channels in rat central neurons by the spider toxin ω-Aga-IIIA. J. Neurosci. 1994, 14, 2844–2853. [Google Scholar] [PubMed]
  46. Newcomb, R.; Palma, A.; Fox, J.; Gaur, S.; Lau, K.; Chung, D.; Cong, R.; Bell, J.R.; Horne, B.; Nadasdi, L.; et al. SNX-325, a novel calcium antagonist from the spider Segestria florentina. Biochemistry 1995, 34, 8341–8347. [Google Scholar] [CrossRef] [PubMed]
  47. Adams, M.E.; Herold, E.E.; Venema, V.J. Two classes of channel-specific toxins from funnel web spider venom. J. Comp. Physiol. A 1989, 164, 333–342. [Google Scholar] [CrossRef] [PubMed]
  48. Bende, N.S.; Dziemborowicz, S.; Herzig, V.; Ramanujam, V.; Brown, G.W.; Bosmans, F.; Nicholson, G.M.; King, G.F.; Mobli, M. The insecticidal spider toxin SFI1 is a knottin peptide that blocks the pore of insect voltage-gated sodium channels via a large β-hairpin loop. FEBS J. 2015, 282, 904–920. [Google Scholar] [CrossRef] [PubMed]
  49. Mukherjee, A.K.; Sollod, B.L.; Wikel, S.K.; King, G.F. Orally active acaricidal peptide toxins from spider venom. Toxicon 2006, 47, 182–187. [Google Scholar] [CrossRef] [PubMed]
  50. Undheim, E.A.; Grimm, L.L.; Low, C.F.; Morgenstern, D.; Herzig, V.; Zobel-Thropp, P.; Pineda, S.S.; Habib, R.; Dziemborowicz, S.; Fry, B.G.; et al. Weaponization of a hormone: Convergent recruitment of hyperglycemic hormone into the venom of arthropod predators. Structure 2015, 23, 1283–1292. [Google Scholar] [CrossRef] [PubMed]
  51. Sahara, K.; Yoshido, A.; Shibata, F.; Fujikawa-Kojima, N.; Okabe, T.; Tanaka-Okuyama, M.; Yasukochi, Y. FISH identification of Helicoverpa armigera and Mamestra brassicae chromosomes by BAC and fosmid probes. Insect Biochem. Mol. Biol. 2013, 43, 644–653. [Google Scholar] [CrossRef] [PubMed]
  52. BioInformatics Platform for Agro-Ecosystems Arthropods. Available online: http://bipaa.genouest.org/is/lepidodb/ (accessed on 1 March 2017).
  53. Herzig, V.; Hodgson, W.C. Intersexual variations in the pharmacological properties of Coremiocnemis tropix (Araneae, Theraphosidae) spider venom. Toxicon 2009, 53, 196–205. [Google Scholar] [CrossRef] [PubMed]
  54. Eitan, M.; Fowler, E.; Herrmann, R.; Duval, A.; Pelhate, M.; Zlotkin, E. A scorpion venom neurotoxin paralytic to insects that affects sodium current inactivation: Purification, primary structure, and mode of action. Biochemistry 1990, 29, 5941–5947. [Google Scholar] [CrossRef] [PubMed]
  55. Herzig, V.; Hodgson, W.C. Neurotoxic and insecticidal properties of venom from the Australian theraphosid spider Selenotholus foelschei. Neurotoxicology 2008, 29, 471–475. [Google Scholar] [CrossRef] [PubMed]
  56. Gunning, S.J.; Maggio, F.; Windley, M.J.; Valenzuela, S.M.; King, G.F.; Nicholson, G.M. The Janus-faced atracotoxins are specific blockers of invertebrate KCa channels. FEBS J. 2008, 275, 4045–4059. [Google Scholar] [CrossRef] [PubMed]
  57. Chong, Y.; Hayes, J.L.; Sollod, B.; Wen, S.; Wilson, D.T.; Hains, P.G.; Hodgson, W.C.; Broady, K.W.; King, G.F.; Nicholson, G.M. The ω-atracotoxins: Selective blockers of insect M-LVA and HVA calcium channels. Biochem. Pharmacol. 2007, 74, 623–638. [Google Scholar] [CrossRef] [PubMed]
  58. Wicher, D.; Penzlin, H. Ca2+ currents in central insect neurons: Electrophysiological and pharmacological properties. J. Neurophysiol. 1997, 77, 186–199. [Google Scholar] [PubMed]
  59. Dong, K. A single amino acid change in the para sodium channel protein is associated with knockdown-resistance (kdr) to pyrethroid insecticides in German cockroach. Insect Biochem. Mol. Biol. 1997, 27, 93–100. [Google Scholar] [CrossRef]
  60. Feng, G.; Deak, P.; Chopra, M.; Hall, L.M. Cloning and functional analysis of TipE, a novel membrane protein that enhances Drosophila para sodium channel function. Cell 1995, 82, 1001–1011. [Google Scholar] [CrossRef]

Article Metrics

Citations

Article Access Statistics

Multiple requests from the same IP address are counted as one view.