Next Article in Journal
Antibodies against Anthrax: Mechanisms of Action and Clinical Applications
Previous Article in Journal
Llama-Derived Single Domain Antibodies Specific for Abrus Agglutinin
Previous Article in Special Issue
Molecular Conversion of Muscarinic Acetylcholine Receptor M5 to Muscarinic Toxin 7 (MT7)-Binding Protein
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Pharmacological Aspects of Vipera xantina palestinae Venom

by
Tatjana Momic
1,
Franziska T. Arlinghaus
2,
Hadar Arien-Zakay
1,
Jeoshua Katzhendler
1,
Johannes A. Eble
2,
Cezary Marcinkiewicz
3 and
Philip Lazarovici
1,*
1
School of Pharmacy Institute for Drug Research, Faculty of Medicine, The Hebrew University of Jerusalem, Jerusalem 91120, Israel
2
Center for Molecular Medicine, Department of Vascular Matrix Biology, Frankfurt University Hospital, Excellence Cluster Cardio-Pulmonary System, 60590 Frankfurt, Germany
3
Department of Biology, Temple University College of Science and Technology, Philadelphia, PA 19122, USA
*
Author to whom correspondence should be addressed.
Toxins 2011, 3(11), 1420-1432; https://doi.org/10.3390/toxins3111420
Submission received: 14 September 2011 / Revised: 3 October 2011 / Accepted: 1 November 2011 / Published: 14 November 2011
(This article belongs to the Special Issue Snake Venoms)

Abstract

In Israel, Vipera xantina palestinae (V.x.p.) is the most common venomous snake, accounting for several hundred cases of envenomation in humans and domestic animals every year, with a mortality rate of 0.5 to 2%. In this review we will briefly address the research developments relevant to our present understanding of the structure and function of V.x.p. venom with emphasis on venom disintegrins. Venom proteomics indicated the presence of four families of pharmacologically active compounds: (i) neurotoxins; (ii) hemorrhagins; (iii) angioneurin growth factors; and (iv) different types of integrin inhibitors. Viperistatin, a α1β1selective KTS disintegrin and VP12, a α2β1 selective C-type lectin were discovered. These snake venom proteins represent promising tools for research and development of novel collagen receptor selective drugs. These discoveries are also relevant for future improvement of antivenom therapy towards V.x.p. envenomation.

1. Introduction

Snake bite is a serious medical problem, particularly in Asia, Africa and in the Middle East, including Israel. In Israel, Vipera xantina palestinae (V.x.p.) is the most common venomous snake accounting for 100-300 reported cases of envenomation in adults, children and domestic animals every year [1] with a mortality rate of 0.5 to 2% [2,3]. The main symptoms following envenomation include hemorrhagic activity manifested in edema, alteration in the coagulation system, myotoxicity resulting in massive muscle fiber collagen desheeting and myonecrosis, cardiotoxicity and neurotoxicity often leading to strong hypotension, arrythmic pathologies, flaccid paralysis, disregulation of central autonomic vasoregulatory mechanism and respiratory paralysis [4]. The V.x.p. venom contains enzymes such as hyaluronidases, esterases, phosphodiesterases and L-amino acid oxidases [5] as well as neurotoxic phospholipase A2, and hemorrhagins. The above clinical local and systemic symptoms of V.x.p. envenomation are the consequence of the pharmacological activity of these enzymatic and non-enzymatic venom proteins. They cause increased capillary permeability, endothelial damage, platelet aggregation and dysfunction, thromboplastin and thrombin inhibition, neutrophilia, leucocytosis, thrombocytopenia, increase fibrinolysis and hypofibrinogenemia, release of histamines, kinins, and different presynaptic neurotoxic effects [6,7]. These pathological syndromes are induced by the large variety of proteins found in V.x.p. venom and by additive and synergistic interactions between them.
In this review we will briefly address the research developments relevant to our present understanding on the structure and function of venom components of V.x.p. with emphasis on integrin inhibitors. These considerations are also relevant for future improvement of antivenom therapy towards V.x.p. envenomation.

2. V.x.p. Venom Active Components

2.1. Neurotoxins

Isolation of neurotoxic and hemorragic factors from V.x.p. venom started in the 50s and 60s using chromatographic methods available at that time. Several toxic fractions were isolated and characterized from the venom of V.x.p. [8]. One of them was further isolated by Moroz-Perlmutter et al., who demonstrated its lethality to mice and synergistically induced neurotoxicity with the venom protease fraction [9]. Later, Ovadia et al. [10] found that the neurotoxic fraction is composed of two proteins: an acidic protein (pI 4) endowed with phospholipase A2 (PLA2) (EC3.1.1.4) activity and a basic protein (pI 9.5) lacking any known enzymatic activity. Each of these proteins when injected into mice were not lethal but when injected together intravenously induced neurotoxicity with LD50 between 50 and 100 µg/kg in mice [10]. These studies were continued by Bdolah and coworkers who demostrated that the acidic phospholipase is toxic and that substitution of this phospholipase with other phospholipases from different snakes can cause lethality in mice upon intavenous coinjection with the non-enzymatic basic component [11]. In the mid-90s, Krizaj et al. cloned the acidic PLA2 from V.x.p. (VpaPLA2) which has an apparent MW of 15 kDa, consisting of 122 amino acids and belonging to the subgroup IIA of PLA2s[12]. The neurotoxic mechanism of the two component system of the V.x.p. venom is not clear and the structure of the basic protein is yet unknown. Future studies are required to characterize the interaction between VpaPLA2 and its basic counterpart including their unusual synergistic toxicity.

2.2. Hemorrhagins

In the early 60s, the group of De Vrise and Moroz isolated a hemorrhagic fraction from V.x.p. which is an acidic protein with an estimated MW of 44 kDa [13,14]. Later, Ovadia isolated three hemorrhagic factors from the V.x.p. venom, two of them with strong proteolytic activity on gelatin and casein as well as a capillary permeability-increasing albeit non-proteolytic activity, all of them in the range of 60 kDa MW [15]. In continuation to these studies Nakar and associates separated a proteolytic enzyme from one of the hemorrhagins. The two other hemorrhagins were endowed with proteolytic activity which could not be chromatographically separated from the hemorrhagic activity [16]. This strongly supported the concept that certain capillary permeability factor(s), devoid of proteolytic activity as well as several metalloproteases represent the hemorrhagins originally identified by Grotto et al. [14]. There has been a 25-year gap between these former chemical and pharmacological studies and nowadays, when more modern and advanced proteomic and pharmacological characterizations have approached to re-evaluate V.x.p. venom.

2.3. Proteomics

A preliminary proteomic analysis of V.x.p. venom is presented in Figure 1. The V.x.p. snakes, kept in a serpentarium in compliance with animal welfare regulation, were gently milked under good laboratory practice conditions (Figure 1A). The liquid venom was lyophilised and 200 mg dried venom was separated by C18 reverse phase HPLC into 17 fractions (Figure 1B). The fractions showing a single electrophoretic band (with or without additional separation by HPLC), were submitted for molecular mass, and N-terminal sequence determination, and mass spectrometry analysis as presented for VP12A (Figure 1C). The partial sequences of the proteins were assigned by BLAST analysis to known families of snake venom proteins. Although only few toxins from any particular reptile species are annotated in the databases, representative members of most toxin families of other snake species are available in the UniProtKB/Swiss-Prot v56.5 database [17] allowing the identification of the searched V.x.p. sequences. The analysis of V.x.p. venom HPLC fractions performed by MALDI-TOF indicated the presence of complex mixture of pharmacologically active molecules representing different percentage of whole venom according to the following distribution: (i) neurotoxins: 2% neurotoxic PLA2; 2% myotoxic PLA2; (ii) hemorrhagins: 65% zinc metalloproteinase, 9% different serine proteinases; (iii) angioneurin growth factors: about 2% of the venom is composed of snake homologues of vascular endothelial growth factor (VEGF) [18] and nerve growth factor (NGF) known to induce angiogenesis in blood capillaries, neurite outgrowth, as well as vascular permeability [19,20] and functionally also assigned to the hemorrhagin family; (iv) integrin inhibitors: 10% C-type lectin-related proteins (CLRPs), 6% dimeric disintegrin, 1% cystein rich disintegrin, <1% short disintegrins (hypothesized to represent additional hemorrhagins) [21]; (Figure 1D). This V.x.p. venom proteomics is in-line with snake venomics of other Vipera venoms, indicating a very similar composition [22]. It is evident that Vipera snakes produce a complex mixture of a large number of distinct proteins that pathologically modulate the cardiovascular and nervous system. In spite of the fact that viperid venoms may contain over 100 protein compounds, these proteins can be sorted into enzymes (serine proteinases, zinc-metalloproteases, L-amino acid oxidase, group II PLA2) and proteins without enzymatic activity, such as disintegrins, C-type lectin-related proteins (CLRPs), natriuretic peptides, myotoxins, cysteine-rich secretory protein (CRISP) toxins, nerve and vascular endothelium growth factors, cystatin, and Kunitz-type protease inhibitors [22]. This situation may reflect the fact that these proteins evolved from a restricted set of gene protein families with normal, physiological functions that were modulated to serve a variety of novel pathologically offensive functions such as to induce neurotoxicity, hemorrhages, and muscle damage, thereby immobilizing and digesting the prey. This proteomic information requires further proof by biochemical and pharmacological studies of all HPLC isolated proteins both in vitro and in animal models.
Figure 1. Scheme of the steps followed in the venomic investigation of Vipera xantina palestinae (V.x.p.). (A) Photograph of V.x.p. snake and manual milking of snake venom (Insert); (B) representative separation of venom components viperistatin and VP12 on C18 reverse phase high-performance liquid chromatography (HPLC); (C) typical mass spectroscopy fragmentation spectra of isolated HPLC VP12A; (D) Scheme of the major groups of pharmacologically active protein in V.x.p. venom.
Figure 1. Scheme of the steps followed in the venomic investigation of Vipera xantina palestinae (V.x.p.). (A) Photograph of V.x.p. snake and manual milking of snake venom (Insert); (B) representative separation of venom components viperistatin and VP12 on C18 reverse phase high-performance liquid chromatography (HPLC); (C) typical mass spectroscopy fragmentation spectra of isolated HPLC VP12A; (D) Scheme of the major groups of pharmacologically active protein in V.x.p. venom.

3. V.x.p. Growth Factors: Vascular Endothelial Growth Factors (VEGF) and Nerve Growth Factor (NGF)

Vascular endothelial growth factors (VEGF) are a family of proteins divided into seven subtypes: mammalian VEGF-A, B, C, D, placenta growth factor (PlGF), viral VEGF (VEGF-E), and snake venom VEGF (VEGF-F) [18]. The most characteristic structural feature of these VEGF ligands is the cysteine knot motif comprising three intertwined disulfide bridges. To date, only five receptors have been identified for the growing number of ligands [23]. Three belong to the receptor tyrosine kinase (RTK) family and are called fms-like tyrosine kinase-1 (Flt-1, also known as VEGFR-1) [24,25], kinase insert domain- containing receptor (KDR, VEGFR-2) [26,27], and Flt-4 (VEGFR-3) [28,29,30]. The others are non-tyrosine kinase-type receptors neuropilin-1 (NP-1) and neuropilin-2 (NP-2), which are believed to function as co-receptors for some VEGF subtypes and their isoforms [31,32]. Over ten different VEGF-F proteins have been identified. Snake venom VEGFs also show different degrees of selectivity in their interactions with different receptors and therefore have been divided into three groups [18]. VEGF-F1 is very selective for VEGFR-2, VEGF-F2 predominantly binds to VEGFR-1 and weakly to VEGFR-2, and VEGF-F3 binds to both VEGFR-1 and VEGFR-2, as well as to NP-1. Snake venom VEGFs display potent endothelial cell proliferation, hypotensive activities, and vascular permeability induction when compared with VEGF-A165, the most physiologically abundant and investigated isoform of the VEGF-A family [33].
We have recently isolated and characterized VEGF-like angioneurin compounds from V.x.p. venom using two steps of reverse phase HPLC followed by protein sequencing yielding the following primary structure:
ZVRPFLDVYQRSACQARETLVSILQEYPDEISDIFRPSCVAVLRCSGCCTDESLKC
TPVGKHTVDMQIMRVNPRTQSSKMEVMKFTEHTACECRPRRKQGEPDGPKEKPR
As expected, this growth factor [18] was able to induce in vivo plasma extravasation by causing microvessel leakage and in vitro increased permeability (reduction in electrical resistance) of brain capillary endothelial monolayer (Lecht, S.; Cohen, G.; Marcinkiewicz, C.; Lazarovici, P. 2008, unpublished data). These properties strongly suggest that this growth factor is another member of the hemorrhagin group of proteins in V.x.p. venom. The vipera VEGFs, like the natural human ligand VEGF-A165 exert their specific activity by binding to a VEGFR-2 but do not bind to the Flt or neuropilin receptor families [33]. For the first time unique pharmacological tools are available to study VEGF receptor type 2 function and for development of novel agonists and antagonists.
Nerve growth factor (NGF) is a polypeptide which belongs to the neurotrophin family. The neurotrophin family includes four members: NGF, brain-derived neurotrophic factor (BDNF), neurotrophin3 (NT-3) and neurotrphin4/5 (NT-4/5) [34]. NGF plays the crucial role in the sympathetic and sensory nervous systems [35]. The biological functions of NGFs are mediated by two classes of cell surface receptors: the p75 neurotrophin receptor (p75NTR), which recognizes all members of the neurotrophin family, and the tropomyosine kinase related receptor (trkA), belonging to the tyrosine kinase-neurotrophin receptor family [36]. Many NGFs have been isolated and characterized from all three families of snakes: Elapidae, Viperidae, Crotalidae [37,38,39]. We have initiated isolation and purification of NGF from V.x.p. venom. This factor also induced weak vascular permeability suggesting its involvement in the hemorrhagic activity of V.x.p. venom (data not shown).
Similar to snake venom VEGF-induced angiogenic effects, venom-derived NGFs promoted migration [40], capillary sprouting and other angiogenic functions [41] and may serve as unique pharmacological tools to study NGF actions.

4. V.x.p. Integrin Inhibitors

Disintegrins are the best known naturally occurring antagonists of integrins. Integrins are cell surface receptors, heterodimers of α and β subunits. Their main function is to shape and maintain the proper structure of tissue by mediating cell-cell and cell-extracellular matrix interactions. Besides their structural function, integrins have been identified as signaling molecules [42], resulting in cytoskeleton reorganization (shape change, adhesion, migration) [43,44,45], regulation of cell proliferation and cell survival and apoptosis [45,46,47].
Currently, classification of snake venom disintegrins can be performed based on their structure and function. The structural classification proposed by Marcinkiewicz presents two groups of disintegrins: monomeric and dimeric. Monomeric disintegrins can be divided into three subclasses regarding the number of cysteins in their structure: short, medium and long [48].
Functionally, disintegrins can be divided into three groups according to their integrin selectivity and presence of specific, recognition motifs. This classification includes RGD-disintegrins (binding to αIIbβ3, αvβ3, α5β1 integrins which recognize fibrinogen, vitronectin and fibronectin), MLD-disintegrins (binding to α4β1, α4β7 integrins which binds to fibronectin, VCAM-1, MadCAM-1, and binding to α9β1 integrin which preferentially interacts with tenascin-C, osteopontin, VCAM-1, fibronectin, trombospondin-1, ADAM family members, and growth factors such as VEGF and NGF), and KTS-disintegrins (binding to the α1β1 integrin, a collagen receptor with particularly good affinity for collagen IV) [48,49].
Viperistatin, a KTS-disintegrin protein was isolated from V.x.p. venom by Kisiel et al. [21] using two-step reverse-phase high-performance liquid chromatography (HPLC) [50]. Viperistatin is a peptide of 4454.5 Da, containing eight cysteines residues engaged in the formation of four disulfide bonds. The complete primary structure of viperistatin determined by N-terminal sequencing showed high homology of this peptide to obtustatin, another KTS-containing disintegrin (Figure 2) [51], differing from it in just three residues at positons 24, 38 and 40. Viperistatin contains the same KTS motif in its active site as obtustatin and shows α1β1 integrin-blocking activity as well. However, it appeared to be a much more potent inhibitor of α1β1 integrin then obtustatin. In adhesion assay, viperistatin was 25 fold more active in inhibition of integrin α1 transfected K562 cell adhesion to both collagen IV and collagen I. The same trend was observed when inhibitory activity of viperistatin and obtustatin was compared in ELISA, where binding of purified α1β1 integrin to immobilized collagen type IV was investigated [21]. Structure-function analysis using synthetic, linear peptides that corresponded to the amino acid sequence of the entire integrin-binding loop for both obtustatin (CWKTSLTSHYC) and viperistatin (CWKTSRTSHYC), in adhesion and ELISA assay, indicated that replacement of a leucine (obtustatin) for an arginine (viperistatin) increased the inhibitory activity towards α1β1 integrin by 6 to 10 fold [21] or even 25 fold [52] (Figure 2). The partial relative enhancement of the inhibitory activity of the KTSR-peptide suggested that the L38/V and P40/Q substitution of viperistatin may also contribute to the biological activity of this disintegrin [21,52,53].
Figure 2. Comparison of the amino acid sequences of disintegrins: viperistatin (V.x.p. [21]) and obtustatin (V. lebetina obtusa [51]). Cysteines are in red and the active motifs are in italic. Amino acid residues that are different in obtustatin and viperistatin are in blue.
Figure 2. Comparison of the amino acid sequences of disintegrins: viperistatin (V.x.p. [21]) and obtustatin (V. lebetina obtusa [51]). Cysteines are in red and the active motifs are in italic. Amino acid residues that are different in obtustatin and viperistatin are in blue.
A C-type lectin-related protein (CLRP), called VP12 was also isolated from V.x.p. venom by Staniszewska et al., using two-step reverse-phase HPLC [54]. The amino acid sequence of VP12 subunits were established by a combination of mass spectrometry and N-terminal sequencing of their proteolytic fragments. While VP12A subunit sequence is completed, the VP12B subunit sequence is partial and needs to be completed and confirmed by DNA sequencing. MALDI-TOF MS analysis of unmodified VP12 yielded a single molecular ion of 30.387 Da, whereas VP12A and VP12B subunits showed 15.981 Da and 15.893 Da, respectively. Based on calculations and by comparison with the structure of another C-lectin type protein EMS-16 and rhodocetin [55,56] which have similar activity to VP12, it was predicted that each subunit of VP12 contains seven cysteines [54]. Although a large number of CLRP family proteins were reported, only few of them exhibit integrin binding properties [57]. In adhesion assay, VP12 showed a potent inhibitory effect on the adhesion of integrin α2β1 overexpressing K562 cells to collagen I (IC50 0.5 nM), but not on K562 cells transfected with α1 integrin subunit to collagen IV. Also, the direct interaction of VP12 with α2β1 integrin was confirmed in adhesion assay. Cells transfected with the α2 integrin subunit showed a potent, dose-dependent adhesion to immobilized VP12, whereas non-transfected control cells did not interact with this CLRP [54]. This feature of VP12 was used for establishing of a technique for VP12 isolation from V.x.p. venom, based on affinity chromatography targeting the A-domain of the α2β1 integrin [58].
By virtue of selective inhibiton of α1β1 or α2β1 integrins, respectively, viperistatin and VP12 are also active in blocking experimental metastasis of melanoma cell clones expressing these individual collagen receptors. This was shown in in vitro and in vivo experiments of inhibitory effects of both disintegrins on: adhesion of melanoma cells to collagen I and IV [58], transmigration of human melanoma cells through primary endothelial dermal human microvascular endothelial cells (dHMVEC) monolayers, as well as melanoma metastasis in a B16F10 mouse model [54,59]. Viperistatin and VP12 demonstrated antimetastatic activity after injection into the tail vein of the mice at a dose lower than 5 mg/kg, a concentration which is not toxic to the animals.
All these studies provide KTS-peptides as lead compounds for the development of selective α1β1 integrin antagonist drugs. Establishment of the full sequence of VP12 and elucidation of the binding motif of VP12 to α2β1 integrin would also offer the possibility to develop and synthesize cyclic peptides with α2β1 integrin-inhibiting potential. Such collagen receptor inhibitors would enable the design of a variety of drugs towards therapy of different cardiovascular diseases and cancer.

5. Antivenom Therapy of V.x.p. Envenomation

Serotherapy is currently the main therapy for treating snake envenomation in general and V.x.p. in particular. In Israel, V.x.p. bites are among the most common reasons for human and veterinary envenomations and fatalities [7]. The Israeli Ministry of Health is producing V.x.p. antivenom in horse based on a protocol developed by Moroz et al. The antigen consisting of 40% venom, 30% neurotoxic fraction and 30% hemorrhagic fraction together with adjuvant generating an efficient antivenom therapy [6,60,61,62]. Dose regiment of 50 mL of V.x.p. antivenom was reported to be efficacious in the treatment of systemic and progressive local manifestation caused by this snake envenomation [6].
Common side effects associated with its use and mild neutralization of all local or systemic effects of the venom are calling for modern studies to evaluate the precise proteomic composition and pathophysiological activity as well as development of more effective therapeutic strategies to deal with snake venom envenomation [63]. The Global Snakebite Initiative (GSI) is the development of multinational collaborative project to develop new regional polyvalent antivenoms in Asia and Africa using phylogenetic, proteomic and antivenomic tools to optimize immunogen selection in order to ensure broad multi snake coverage [64]. Therefore, this new approach calls for re-evaluation of proteomics and venomics of V.x.p. We hope that in the near future the second generation of poyvalent anti-V.x.p. venom under development by Kamada Ltd., Kiryat Weizmann, Rehovot, Israel will be found more efficacious and safe, and compatible with GSI polyvalent antivenom strategy.

6. Conclusions

There is a need for the development of efficient V.x.p polyvalent antivenom to treat envenomated patients in Israel. The development of this antivenom requires a modern understanding of the proteomics and pharmacological functions of the individual venom components. Re-evaluation of V.x.p. venom composition and function has been pursued in our laboratories over the last decade. Angiogenic factors, vascular endothelial like growth factors and nerve growth factors have been isolated and characterized. Viperistatin, a α1β1selective KTS disintegrin and VP12, a α2β1 selective C-type lectin were discovered. These snake venom proteins, proposed to represent novel hemorrhagins are promising tools for future research and development of novel drugs selective for integrins. In addition, the fact that new targets of antivenom therapy appear by more recent proteomic description of V.x.p. venom (such as the discovery of novel growth factors with hemorrhagic activities, of disintegrin and CLRPs), calls for re-evaluation of V.x.p. antivenom potential to neutralize these proteins. Full neutralization of all toxic components of V.x.p. venom is obligatory in order to achieve full protection of the patients.

Conflict of Interest

The authors declare no conflict of interest.

Acknowledgements

PL holds the Jacob Gitlin Chair in Physiology at Hebrew University and is affiliated and partially supported by the David R. Bloom Center for Pharmacy and the Adolf and Klara Brettler Center for Research in Molecular Pharmacology and Therapeutics at The Hebrew University of Jerusalem, Israel. The authors greatly appreciate the financial support of the German-Israeli Foundation (GIF-994-3.9/2008). We would like to acknowledge Naftali Primor, SIS Pharmaceuticals, Rehovot, Israel for the supply of V.x.p. venom prepared under stringent (GLP) conditions, according to the requirements of the Israeli Ministry of Health.

References

  1. Paret, G.; Ben-Abraham, R.; Ezra, D.; Shrem, D.; Eshel, G.; Vardi, A.; Winkler, E.; Barzilay, Z. Vipera palaestinae snake envenomations: Experience in children. Hum. Exp. Toxicol. 1997, 16, 683–687. [Google Scholar] [PubMed]
  2. Coppola, M.; Hogan, D.E. Venomous snakes of south-west Asia. Am. J. Emerg. Med. 1992, 10, 230–236. [Google Scholar]
  3. Mendelssohn, H. On the biology of venomous snakes of Israel. Isr. J. Zool. 1963, 12, 143–170. [Google Scholar]
  4. Thwin, M.-M.; Gopalakrishnakone, P. Snake envenomation and protective natural endogenous proteins: A mini review of the recent developments (1991-1997). Toxicon 1998, 36, 1471–1482. [Google Scholar]
  5. Winkler, E.; Chovers, M.; Almog, S.; Pri-Chen, S.; Rotenberg, M.; Tirosh, M.; Ezra, D.; Halkin, H. Decreased serum cholesterol level after snake bite (Vipera palestinae) as a marker of severity of envenomation. J. Lab. Clin. Med. 1993, 121, 774–778. [Google Scholar] [PubMed]
  6. Bentur, Y.; Raikhlin-Eisenkraft, B.; Galperin, M. Evaluation of antivenom therapy in Vipera palaestinae bites. Toxicon 2004, 44, 53–57. [Google Scholar] [CrossRef] [PubMed]
  7. Aroch, I.; Harrus, S. Retrospective study of the epidemiological, clinical, haematological and biochemical findings in 109 dogs poisoned by Vipera xanthina palestina. Vet. Rec. 1999, 144, 532–535. [Google Scholar] [CrossRef] [PubMed]
  8. Gitter, S.; de Vries, A. Symptomatology, Pathology and Treatment of Bites by Near Eastern, European and North African Snakes. In Symptomatology, Pathology and Treatment of Bites by Near Eastern, European and North African Snakes; Bucherl, W., Buckley, E.E., Deulofeu, V., Eds.; Academic Press: New York, NY, USA, 1968; pp. 359–401. [Google Scholar]
  9. Moroz-Perlmutter, C.; Goldblum, N.; de Vries, A. Biochemical and antigenic properties of a purified neurotoxin of Vipera palestinae venom. J. Immunol. 1965, 94, 164–171. [Google Scholar] [PubMed]
  10. Ovadia, M.; Kochva, E.; Moav, B. Purification and partial characterization of lethal synergistic components from the venom of Vipera palaestinae. Toxicon 1977, 15, 549–560. [Google Scholar] [PubMed]
  11. Simon, T.; Bdolah, A.; Kochva, E. The two-component toxin of Vipera palaestinae: Contribution of phospholipase A to its activity. Toxicon 1980, 18, 249–259. [Google Scholar] [PubMed]
  12. Krizaj, I.; Bdolah, A.; Gubensek, F.; Bencina, P.; Pungercar, J. Protein and cDNA structures of an acidic phospholipase A2, the enzymatic part of an unusual, two-component toxin from Vipera palaestina. Biochem. Biophys. Res. Commun. 1996, 227, 374–379. [Google Scholar] [CrossRef] [PubMed]
  13. Grotto, L.; Jerushalmy, Z.; de Vries, A. Effect of purified Vipera paletinae hemorrhagin on blood coagulation and platelet function. Thromb. Diath. Haemorrh. 1969, 22, 482–495. [Google Scholar] [PubMed]
  14. Grotto, L.; Moroz, C.; de Vries, A.; Goldblum, N. Isolation of Vipera palestinae hemorrhagin and distinction between its hemorrhagic and proteolytic activities. Biochim. Biophys. Acta 1967, 133, 356–362. [Google Scholar] [PubMed]
  15. Ovadia, M. Isolation and characterization of three hemorrhagic factors from the venom of Vipera palaestinae. Toxicon 1978, 16, 479–487. [Google Scholar] [CrossRef] [PubMed]
  16. Nakar, O.; Ovadia, M.; Kochva, E. Isolation and characterization of a proteolytic factor from the venom of Vipera palaestinae. Toxicon 1986, 24, 293–304. [Google Scholar] [CrossRef] [PubMed]
  17. UniProtKB/Swiss-Prot v56.5. Available online: http://us.expasy.org/sprot/ (accessed on 11 November 2011).
  18. Brown, M.C.; Calvete, J.J.; Staniszewska, I.; Walsh, E.M.; Georgina, P.-L.; Dell Valle, L.; Lazarovici, P.; Marcinkiewicz, C. VEGF-related protein isolated from Vipera palestinae venom, promotes angiogenesis. Growth Factors 2007, 25, 108–117. [Google Scholar] [CrossRef] [PubMed]
  19. Kostiza, T.; Dahinden, C.A.; Rihs, S.; Otten, U.; Meier, J. Nerve growth factor from the venom of the Chinese cobra Naja naja atra: Purification and description of non-neuronal activities. Toxicon 1995, 33, 1249–1261. [Google Scholar]
  20. Weis, S.M.; Cheresh, D.A. Pathophysiological consequences of VEGF-induced vascular permeability. Nature 2005, 437, 497–504. [Google Scholar]
  21. Kisiel, D.G.; Calvete, J.J.; Katzhendler, J.; Fertala, A.; Lazarovici, P.; Marcinkiewicz, C. Structural determinants of the selectivity of KTS-disintegrins for the α1β1 integrin. FEBS Lett. 2004, 577, 478–482. [Google Scholar]
  22. Calvete, J.J.; Juárez, P.; Sanz, L. Snake venomics. Strategy and applications. J. Mass Spectrom. 2007, 42, 1405–1414. [Google Scholar] [CrossRef] [PubMed]
  23. Yamazaki, Y.; Morita, T. Molecular and functional diversity of vascular endothelial growth factors. Mol. Divers. 2006, 10, 515–527. [Google Scholar]
  24. Yamane, A.; Seetharam, L.; Yamaguchi, S.; Gotoh, N.; Takahashi, T.; Neufeld, G.; Shibuya, M. A new communication system between hepatocytes and sinusoidal endothelial cells in liver through vascular endothelial growth factor and Flt tyrosine kinase receptor family (Flt-1 and KDR/Flk-1). Oncogene 1994, 9, 2683–2690. [Google Scholar]
  25. de Vries, C.; Escobedo, J.A.; Ueno, H.; Houck, K.; Ferrara, N.; Williams, L.T. The fms-like tyrosine kinase, a receptor for vascular endothelial growth factor. Science 1992, 255, 989–991. [Google Scholar]
  26. Terman, B.I.; Dougher-Vermazen, M.; Carrion, M.E.; Dimitrov, D.; Armellino, D.C.; Gospodarowicz, D.; Böhlen, P. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem. Biophys. Res. Commun. 1992, 187, 1579–1586. [Google Scholar]
  27. Quinn, T.P.; Peters, K.G.; de Vries, C.; Ferrara, N.; Williams, L.T. Fetal liver kinase 1 is a receptor for vascular endothelial growth factor and is selectively expressed in vascular endothelium. Proc. Natl. Acad. Sci. USA 1993, 90, 7533–7537. [Google Scholar]
  28. Joukov, V.; Pajusola, K.; Kaipainen, A.; Chilov, D.; Lahtinen, I.; Kukk, E.; Saksela, O.; Kalkkinen, N.; Alitalo, K. A novel vascular endothelial growth factor, VEGF-C, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinase. EMBO J. 1996, 15, 290–298. [Google Scholar]
  29. Lee, J.; Gray, A.; Yuan, J.; Luoh, S.M.; Avraham, H.; Wood, W.I. Vascular endothelial growth factor-related protein: A ligand and specific activator of the tyrosine kinase receptor Flt4. Proc. Natl. Acad. Sci. USA 1996, 93, 1988–1992. [Google Scholar]
  30. Achen, M.G.; Jeltsch, M.; Kukk, E.; Makinen, T.; Vitali, A.; Wilks, A.F.; Alitalo, K.; Stacker, S.A. Vascular endothelial growth factor D (VEGF-D) is a ligand for the tyrosine kinases VEGF receptor 2 (Flk1) and VEGF receptor 3 (Flt4). Proc. Natl. Acad. Sci. USA 1998, 95, 548–553. [Google Scholar]
  31. Soker, S.; Takashima, S.; Miao, H.Q.; Neufeld, G.; Klagsbrun, M. Neuropilin-1 is expressed by endothelial and tumor cells as an isoform-specific receptor for vascular endothelial growth factor. Cell 1998, 92, 735–745. [Google Scholar]
  32. Gluzman-Poltorak, Z.; Cohen, T.; Herzog, Y.; Neufeld, G. europilin-2 and neuropilin-1 are receptors for the 165-amino acid form of vascular endothelial growth factor (VEGF) and of placenta growth actor-2, but only neuropilin-2 functions as a receptor for the 145-amino acid form of VEGF. J. Biol. Chem. 2000, 275, 18040–18045. [Google Scholar]
  33. Yamazaki, Y.; Takani, K.; Atoda, H.; Morita, T. Snake venom vascular endothelial growth factors (VEGFs) exhibit potent activity through their specific recognition of KDR (VEGF Receptor 2). J. Biol. Chem. 2003, 278, 51985–51988. [Google Scholar]
  34. Paalme, V.; Trummal, K.; Samel, M.; Tõnismägi, K.; Järvekülg, L.; Vija, H.; Subbi, J.; Siigur, J.; Siigur, E. Nerve growth factor from Vipera lebetina venom. Toxicon 2009, 54, 329–336. [Google Scholar] [PubMed]
  35. Levi-Montalcini, R. The nerve growth factor 35 years later. Science 1987, 237, 1154–1162. [Google Scholar]
  36. Kaplan, D.R.; Miller, F.D. Signal transduction by the neutrophin receptors. Curr. Opin. Cell Biol. 1997, 9, 213–221. [Google Scholar]
  37. Selby, M.J.; Edwards, R.H.; Rutter, W.J. Cobra nerve growth factor: Structure and evolutionary comparison. J. Neurosci. Res. 1987, 18, 293–298. [Google Scholar]
  38. Siigur, E.; Neuman, T.; Järve, V.; Tara, A.; Siigur, J. Isolation and characterization of nerve growth factor from Vipera lebetina (snake) venom. Comp. Biochem. Physiol. B 1985, 81, 211–215. [Google Scholar] [PubMed]
  39. Hogue-Angeletti, R.A.; Bradshaw, R.A. Nerve Growth Factors in Snake Venoms. In Snake Venoms; Lee, C.Y., Ed.; Springer: Berlin, Germany, 1979; pp. 276–294. [Google Scholar]
  40. Dolle, J.-P.; Rezvan, A.; Allen, F.D.; Lazarovici, P.; Lelkes, P.I. Nerve growth factor-induced migration of endothelial cells. J. Pharmacol. Exp. Ther. 2005, 315, 1220–1227. [Google Scholar]
  41. Lazarovici, P.; Marcinkiewicz, C.; Lelkes, P.I. Cross talk between the cardiovascular and nervous systems: Neurotrophic effects of vascular endothelial growth factor (VEGF) and angiogenic effects of nerve growth factor (NGF)-implications in drug development. Curr. Pharm. Des. 2006, 12, 2609–2622. [Google Scholar]
  42. Clark, E.; Brugge, J. Integrins and signal transduction pathways: The road taken. Science 1995, 268, 233–239. [Google Scholar]
  43. Hood, J.D.; Cheresh, D.A. Role of integrins in cell invasion and migration. Nat. Rev. Cancer 2002, 2, 91–100. [Google Scholar]
  44. Liddington, R.C.; Ginsberg, M.H. Integrin activation takes shape. J. Cell Biol. 2002, 158, 833–839. [Google Scholar]
  45. Schaller, M. Biochemical signals and biological response elicited by the focal adhesion kinase. Biochim. Biophys. Acta 2001, 1540, 1–21. [Google Scholar]
  46. Giancotti, F.G.; Ruoslahti, E. Integrin signaling. Science 1999, 285, 1028–1033. [Google Scholar]
  47. Stupack, D.G.; Cheresh, D.A. Get a ligand, get a life: Integrins, signaling and cell surviva. J. Cell Sci. 2002, 115, 3729–3738. [Google Scholar]
  48. Marcinkiewicz, C. Functional characteristic of snake venom disintegrins: Potential therapeutic implication. Curr. Pharm. Des. 2005, 11, 815–827. [Google Scholar]
  49. Plow, E.F.; Haas, T.A.; Zhang, L.; Loftus, J.; Smith, J.W. Ligand binding to integrins. J. Biol. Chem. 2000, 275, 21785–21788. [Google Scholar]
  50. Marcinkiewicz, C.; Calvete, J.J.; Marcinkiewicz, M.M.; Raida, M.; Vijay-Kumar, S.; Huang, Z.; Lobb, R.R.; Niewiarowski, S. EC3, a novel heterodimeric disintegrin from Echis carinatus venom, inhibits alpha4 and alpha5 integrins in an RGD-independent manne. J. Biol. Chem. 1999, 274, 12468–12473. [Google Scholar] [PubMed]
  51. Moreno-Murciano, M.P.; Monleón, D.; Calvete, J.J.; Celda, B.; Marcinkiewicz, C. Amino acid sequence and homology modeling of obtustatin, a novel non-RGD-containing short disintegrin isolated from the venom of Vipera lebetina obtuse. Protein Sci. 2003, 12, 366–371. [Google Scholar] [CrossRef] [PubMed]
  52. Brown, M.C.; Eble, J.A.; Calvete, J.J.; Marcinkiewicz, C. Structural requirements of KTS-disintegrins for inhibition of α1β1 integrin. Biochem. J. 2009, 417, 95–101. [Google Scholar]
  53. Kallech-Ziri, O.; Luis, J.; Faljoun, Z.; Sabatier, J.-M.; Lehmann, M.; El Ayeb, M.; Marrakchi, N.; Loret, E. Structure function relationships of KTS disintegrins and design of antiangiogenic drugs Lett. Drug Des. Discov. 2010, 7, 36–40. [Google Scholar]
  54. Staniszewska, I.; Walsh, E.M.; Rothman, V.L.; Gaathon, A.; Tuszynski, G.P.; Calvete, J.J.; Lazarovici, P.; Marcinkiewicz, C. Effect of VP12 and viperistatin on inhibition of collagen receptors: Dependent melanoma metastasis. Cancer Biol. Ther. 2009, 8, 1507–1516. [Google Scholar]
  55. Horii, K.; Okuda, D.; Morita, T.; Mizuno, H. Crystal structure of EMS16 in complex with the integrin α2-I domain. J. Mol. Biol. 2004, 341, 519–527. [Google Scholar]
  56. Eble, J.A.; Niland, S.; Bracht, T.; Mormann, M.; Peter-Katalinic, J.; Pohlentz, G.; Stetefeld, J. The α2β1integrin-specific antagonist rhodocetin is a cruciform, heterotetrameric molecule. FASEB J. 2009, 23, 2917–2927. [Google Scholar]
  57. Morita, T. Structure-function relationship of C-type lectin-related proteins. Pathophysiol. Haemost. Thromb. 2005, 34, 156–159. [Google Scholar]
  58. Arlinghaus, F.; Marcinkiewicz, C.; Lazarovici, P.; Eble, J.A. Snake Venoms Contain Important Anti-Thrombocit Antagonists Selectively Targeting Collagen α2β1. In Proceedings of the 33th World Congress of the International Society of Hematology, Jerusalem, Palestine, 10-14 October 2010.
  59. Walsh, E.M.; Marcinkiewicz, C. Non-RGD-containing snake venom disintegrins, functional and structural relations. Toxicon 2011, 58, 355–362. [Google Scholar]
  60. Moroz, C. Vipera palestinae antivenin. Public Health Rev. 1998, 26, 233–236. [Google Scholar]
  61. Moroz, C.; de Vries, A.; Goldblum, N. Preparation of an antivenin against Vipera palestinae venom with high antineurotoxic potency. Toxicon 1966, 4, 205–208. [Google Scholar] [CrossRef] [PubMed]
  62. Moroz, C.; Hahn, J.; de Vries, A. Neutralization of Vipera palestinae hemorrhagin by antibody fragments. Toxicon 1971, 9, 57–62. [Google Scholar] [CrossRef] [PubMed]
  63. Weinstein, S.A.; Dart, R.C.; Staples, A.; White, J. Envenomations: An overview of clinical toxinology for the primary care physician. Am. Fam. Physician 2009, 80, 793–802. [Google Scholar]
  64. Williams, D.J.; Gutiérrez, J.-M.; Calvete, J.J.; Wüster, W.; Ratanabanangkoon, K.; Paiva, O.; Brown, N.I.; Casewell, N.R.; Harrison, R.A.; Rowley, P.D.; O’Shea, M.; Jensen, S.D.; Winkel, K.D.; Warrell, D.A. Ending the drought: New strategies for improving the flow of affordable, effective antivenoms in Asia and Africa. J. Proteomics 2011, 74, 1735–1767. [Google Scholar]

Share and Cite

MDPI and ACS Style

Momic, T.; Arlinghaus, F.T.; Arien-Zakay, H.; Katzhendler, J.; Eble, J.A.; Marcinkiewicz, C.; Lazarovici, P. Pharmacological Aspects of Vipera xantina palestinae Venom. Toxins 2011, 3, 1420-1432. https://doi.org/10.3390/toxins3111420

AMA Style

Momic T, Arlinghaus FT, Arien-Zakay H, Katzhendler J, Eble JA, Marcinkiewicz C, Lazarovici P. Pharmacological Aspects of Vipera xantina palestinae Venom. Toxins. 2011; 3(11):1420-1432. https://doi.org/10.3390/toxins3111420

Chicago/Turabian Style

Momic, Tatjana, Franziska T. Arlinghaus, Hadar Arien-Zakay, Jeoshua Katzhendler, Johannes A. Eble, Cezary Marcinkiewicz, and Philip Lazarovici. 2011. "Pharmacological Aspects of Vipera xantina palestinae Venom" Toxins 3, no. 11: 1420-1432. https://doi.org/10.3390/toxins3111420

APA Style

Momic, T., Arlinghaus, F. T., Arien-Zakay, H., Katzhendler, J., Eble, J. A., Marcinkiewicz, C., & Lazarovici, P. (2011). Pharmacological Aspects of Vipera xantina palestinae Venom. Toxins, 3(11), 1420-1432. https://doi.org/10.3390/toxins3111420

Article Metrics

Back to TopTop