Heterologous Expression of an Insecticidal Peptide Obtained from the Transcriptome of the Colombian Spider Phoneutria depilate
Abstract
:1. Introduction
2. Results
2.1. Design and Gene Amplification
2.2. Cloning in pQE-30 Expression Vector
2.3. Expression of Recombinant Ctx-4
2.4. Transcriptome Validation: Searching the rCtx-4 Sequence in a Spider Venom Gland
2.5. Acute Toxicity of Recombinant Peptide Ctx-4 in Mice
2.6. Toxicity of the rCtx-4 Peptide in Crickets
2.7. Mean Paralyzing Dose (PD50) of the Recombinant Peptide Ctx-4 in Crickets
3. Discussion
4. Conclusions
5. Materials and Methods
5.1. Gene Design and Construction
5.2. Cloning in pQE30 Expression Vector
5.3. Expression of the Recombinant Toxin Ctx-4
5.4. Transcriptome Validation
5.5. In Vivo Biological Activities
5.5.1. Acute Toxicity in Mice
5.5.2. Toxicity and Mean Paralyzing Dose (PD50) of the Recombinant Peptide Ctx-4 in Crickets
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Ikonomopoulou, M.; King, G. Natural Born Insect Killers: Spider-venom Peptides and Their Potential for Managing Arthropod Pests. Outlooks Pest Manag. 2013, 24, 16–19. [Google Scholar] [CrossRef]
- Bánki, O.; Roskov, Y.; Döring, M.; Ower, G.; Vandepitte, L.; Hobern, D.; Remsen, D.; Schalk, P.; DeWalt, R.E.; Keping, M.; et al. World Spider Catalog, Version 23.0; Catalogue of Life Checklist: South Holland, The Netherlands, 2022. [Google Scholar] [CrossRef]
- Herzig, V.; Wood, D.L.; Newell, F.; Chaumeil, P.A.; Kaas, Q.; Binford, G.J.; Nicholson, G.M.; Gorse, D.; King, G.F. ArachnoServer 2.0, an updated online resource for spider toxin sequences and structures. Nucleic Acids Res. 2011, 39, D653–D657. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- UniprotKB. Available online: https://www.uniprot.org/ (accessed on 21 April 2023).
- King, G.F.; McFarland, B.S.; Nicholson, G.M.; Gunning, S.J. Insecticidal Polypeptides and Methods of Use Thereof. U.S. Patent 2011/0237502 A1, 29 September 2011. [Google Scholar]
- King, G.F.; Gentz, M.C.; Escoubas, P.; Nicholson, G.M. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon 2008, 52, 264–276. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Estrada, G.; Villegas, E.; Corzo, G. Spider venoms: A rich source of acylpolyamines and peptides as new leads for CNS drugs. Nat. Prod. Rep. 2007, 24, 145–161. [Google Scholar] [CrossRef] [PubMed]
- Saez, N.J.; Senff, S.; Jensen, J.E.; Er, S.Y.; Herzig, V.; Rash, L.D.; King, G.F. Spider-venom peptides as therapeutics. Toxins 2010, 2, 2851–2871. [Google Scholar] [CrossRef] [Green Version]
- Hazzi, N.A. Natural history of Phoneutria boliviensis (Araneae: Ctenidae): Habitats, reproductive behavior, postembryonic development and prey-wrapping. J. Arachnol. 2014, 42, 303–310. [Google Scholar] [CrossRef]
- Rash, L.D.; Hodgson, W.C. Pharmacology and biochemistry of spider venoms. Toxicon 2002, 40, 225–254. [Google Scholar] [CrossRef]
- Hazzi, N.A.; Hormiga, G. Morphological and molecular evidence support the taxonomic separation of the medically important Neotropical spiders Phoneutria depilata (Strand, 1909) and P. boliviensis (F.O. Pickard-Cambridge, 1897) (Araneae, Ctenidae). Zookeys 2021, 1022, 13–50. [Google Scholar] [CrossRef]
- Richardson, M.; Pimenta, A.M.C.; Bemquerer, M.P.; Santoro, M.M.; Beirao, P.S.L.; Lima, M.E.; Figueiredo, S.G.; Bloch, C.; Vasconcelos, E.A.R.; Campos, F.A.P.; et al. Comparison of the partial proteomes of the venoms of Brazilian spiders of the genus Phoneutria. Comp. Biochem. Physiol. Part C 2006, 142, 173–187. [Google Scholar] [CrossRef]
- Vásquez-Escobar, J.; Romero-Gutiérrez, T.; Morales, J.A.; Clement, H.C.; Corzo, G.A.; Benjumea, D.M.; Corrales-García, L.L. Transcriptomic Analysis of the Venom Gland and Enzymatic Characterization of the Venom of Phoneutria depilata (Ctenidae) from Colombia. Toxins 2022, 14, 295. [Google Scholar] [CrossRef]
- Estrada, G.; Silva, A.O.; Villegas, E.; Ortiz, E.; Beirão, P.S.; Corzo, G. Heterologous expression of five disulfide-bonded insecticidal spider peptides. Toxicon 2016, 119, 152–158. [Google Scholar] [CrossRef]
- Baneyx, F.; Mujacic, M. Recombinant protein folding and misfolding in Escherichia coli. Nat. Biotechnol. 2004, 22, 1399–1408. [Google Scholar] [CrossRef]
- Hernández, M.S. Clonación, Sobre-Expresión y Purificación de las Proteínas NSP5 y NSP6 de Rotavirus en Escherichia coli; Instituto Potosino de Investigación Científica y Tecnológica: San Luis Potosí, Mexico, 2007. [Google Scholar]
- Araujo, S.C.; Castanheira, P.; Alvarenga, L.M.; Mangili, O.C.; Kalapothakis, E.; Chávez-Olórtegui, C. Protection against dermonecrotic and lethal activities of Loxosceles intermedia spider venom by immunization with a fused recombinant protein. Toxicon 2003, 41, 261–267. [Google Scholar] [CrossRef]
- da Silveira, R.B.; Pigozzo, R.B.; Chaim, O.M.; Appel, M.H.; Dreyfuss, J.L.; Toma, L.; Mangili, O.C.; Gremski, W.; Dietrich, C.P.; Nader, H.B.; et al. Molecular cloning and functional characterization of two isoforms of dermonecrotic toxin from Loxosceles intermedia (brown spider) venom gland. Biochimie 2006, 88, 1241–1253. [Google Scholar] [CrossRef]
- Souza, A.H.; Ferreira, J.; Cordeiro, M.D.N.; Vieira, L.B.; De Castro, C.J.; Trevisan, G.; Reis, H.; Souza, I.A.; Richardson, M.; Prado, M.A.M.; et al. Analgesic effect in rodents of native and recombinant Ph alpha 1beta toxin, a high-voltage-activated calcium channel blocker isolated from armed spider venom. Pain 2008, 140, 115–126. [Google Scholar] [CrossRef]
- Zhang, H.; Huang, P.-F.; Meng, E.; Li, W.-Y.; Zhou, L.; Zhu, L.-Y.; Wu, L.; Li, M.-J.; Liang, S.-P.; Zhang, D.-Y. An Efficient Strategy for Heterologous Expression and Purification of Active Peptide Hainantoxin-IV. PLoS ONE 2015, 10, e0117099. [Google Scholar] [CrossRef] [Green Version]
- Quintero-Hernández, V.; Ortiz, E.; Rendón-Anaya, M.; Schwartz, E.F.; Becerril, B.; Corzo, G.; Possani, L.D. Scorpion and spider venom peptides: Gene cloning and peptide expression. Toxicon 2011, 58, 644–663. [Google Scholar] [CrossRef]
- Clement, H.; Flores, V.; Diego-Garcia, E.; Corrales-Garcia, L.L.; Villegas, E.; Corzo, G. A comparison between the recombinant expression and chemical synthesis of a short cysteine-rich insecticidal spider peptide. J. Venom. Anim. Toxins Incl. Trop. Dis. 2015, 21, 19. [Google Scholar] [CrossRef] [Green Version]
- Li, M.; Li, L.Y.; Wu, X.; Liang, S.P. Cloning and functional expression of a synthetic gene encoding huwentoxin-I, a neurotoxin from the Chinese bird spider (Selenocosmia huwena). Toxicon 2000, 38, 153–162. [Google Scholar] [CrossRef]
- Estrada, G.; Garcia, B.I.; Schiavon, E.; Ortiz, E.; Cestele, S.; Wanke, E.; Possani, L.D.; Corzo, G. Four disulfide-bridged scorpion beta neurotoxin CssII: Heterologous expression and proper folding in vitro. Biochim. Biophys. Acta 2007, 1770, 1161–1168. [Google Scholar] [CrossRef] [Green Version]
- Zhou, T.; Ko, E.A.; Gu, W.; Lim, I.; Bang, H.; Ko, J.H. Non-silent story on synonymous sites in voltage-gated ion channel genes. PLoS ONE 2012, 7, e48541. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tan, C.H.; Tan, K.Y.; Fung, S.Y.; Tan, N.H. Venom-gland transcriptome and venom proteome of the Malaysian king cobra (Ophiophagus hannah). BMC Genom. 2015, 16, 687. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Figueiredo, S.G.; Garcia, M.E.; Valentim, A.C.; Cordeiro, M.N.; Diniz, C.R.; Richardson, M. Purification and amino acid sequence of the insecticidal neurotoxin Tx4(6-1) from the venom of the ‘armed’ spider Phoneutria nigriventer (Keys). Toxicon 1995, 33, 83–93. [Google Scholar] [CrossRef] [PubMed]
- de Lima, M.E.; Stankiewicz, M.; Hamon, A.; de Figueiredo, S.G.; Cordeiro, M.N.; Diniz, C.R.; Martin-Eauclaire, M.F.; Pelhate, M. The toxin Tx4(6-1) from the spider Phoneutria nigriventer slows down Na+ current inactivation in insect CNS via binding to receptor site 3. J. Insect Physiol. 2002, 48, 53–61. [Google Scholar] [CrossRef]
- Borrego, J.; Clement, H.; Corrales-García, L.L.; Arenas, I.; Corzo, G. Key amino acid residues involved in mammalian and insecticidal activities of Magi4 and Hv1b, cysteine-rich spider peptides from the δ-atracotoxin family. Amino Acids 2020, 52, 465–475. [Google Scholar] [CrossRef]
- Alvarado, D.; Cardoso-Arenas, S.; Corrales-García, L.L.; Clement, H.; Arenas, I.; Montero-Dominguez, P.A.; Olamendi-Portugal, T.; Zamudio, F.; Csoti, A.; Borrego, J.; et al. A Novel Insecticidal Spider Peptide that Affects the Mammalian Voltage-Gated Ion Channel hKv1.5. Front. Pharmacol. 2021, 11. [Google Scholar] [CrossRef]
- Chomczynski, P.; Sacchi, N. Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction. Anal. Biochem. 1987, 162, 156–159. [Google Scholar] [CrossRef]
- OECD. Test No. 423: Acute Oral Toxicity—Acute Toxic Class Method; OECD: Paris, France, 2002. [Google Scholar]
- Dixon, W.J. The Up-and-Down Method for Small Samples. J. Am. Stat. Assoc. 1965, 60, 967–978. [Google Scholar] [CrossRef]
Name | Amino Acid Sequence | Features |
---|---|---|
Signal peptide | MKVAIFFILSLFVLAVAS | 18 amino acids |
Propeptide | ESIEEKREEFPVEESAR | 17 amino acids |
Mature toxin | GKCGDINAPCQSDCDCCGYSVTCDCYWSKDCKCRESNFAAGMALRKAFCKNKI | 53 amino acids |
Name | Sequence (5′ → 3′) | Features |
---|---|---|
Ctx_Up1 | GAGAGGATCCGAGAACCTGTACTTTCAAGGCAAATGCGGtGATATTAACGCGCCGTGTCAGAG | 63 nucleotides GGATCC: BamHI site GAGAACCTGTACTTTCAA: TEV protease site |
Ctx_Lw2 | GCTCCAGTAGCAGTCACAGGTCACCGAATAGCCGCAACAATCGCAGTCGCTCTGACACGGCGCGTTA | 67 nucleotides |
Ctx_Up3 | CCTGTGACTGCTACTGGAGCAAGGATTGTAAATGCCGCGAAAGTAATTTTGCCGCGGGTATGGCAC | 66 nucleotides |
Ctx_Lw4 | TCTCCTGCAGCTATTAAATCTTGTTTTTACAGAACGCCTTACGCAGTGCCATACCCGCGGC | 61 nucleotides CTGCAG: PstI site CTATTA: stop codons |
cDNA-Ctx-Fwr | AAATGCGGCGATATAAACG | 19 nucleotides |
cDNA-Ctx-Rev | TTATTATATTTTGTTTTTGCAGAAGGC | 27 nucleotides |
pQE-Fwd | GAGCGGATAACAATTATAA | 19 nucleotides |
pQE-Rev | GGTCATTACTGGATCTAT | 18 nucleotides |
M13-Forward | GTAAAACGACGGCCAGT | 17 nucleotides |
M13-Reverse | CAGGAAACAGCTATGAC | 17 nucleotides |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Vásquez-Escobar, J.; Benjumea-Gutiérrez, D.M.; Lopera, C.; Clement, H.C.; Bolaños, D.I.; Higuita-Castro, J.L.; Corzo, G.A.; Corrales-Garcia, L.L. Heterologous Expression of an Insecticidal Peptide Obtained from the Transcriptome of the Colombian Spider Phoneutria depilate. Toxins 2023, 15, 436. https://doi.org/10.3390/toxins15070436
Vásquez-Escobar J, Benjumea-Gutiérrez DM, Lopera C, Clement HC, Bolaños DI, Higuita-Castro JL, Corzo GA, Corrales-Garcia LL. Heterologous Expression of an Insecticidal Peptide Obtained from the Transcriptome of the Colombian Spider Phoneutria depilate. Toxins. 2023; 15(7):436. https://doi.org/10.3390/toxins15070436
Chicago/Turabian StyleVásquez-Escobar, Julieta, Dora María Benjumea-Gutiérrez, Carolina Lopera, Herlinda C. Clement, Damaris I. Bolaños, Jorge Luis Higuita-Castro, Gerardo A. Corzo, and Ligia Luz Corrales-Garcia. 2023. "Heterologous Expression of an Insecticidal Peptide Obtained from the Transcriptome of the Colombian Spider Phoneutria depilate" Toxins 15, no. 7: 436. https://doi.org/10.3390/toxins15070436
APA StyleVásquez-Escobar, J., Benjumea-Gutiérrez, D. M., Lopera, C., Clement, H. C., Bolaños, D. I., Higuita-Castro, J. L., Corzo, G. A., & Corrales-Garcia, L. L. (2023). Heterologous Expression of an Insecticidal Peptide Obtained from the Transcriptome of the Colombian Spider Phoneutria depilate. Toxins, 15(7), 436. https://doi.org/10.3390/toxins15070436