Abstract
The potential emergence of zoonotic diseases has raised significant concerns, particularly in light of the recent pandemic, emphasizing the urgent need for scientific preparedness. The bioprospection and characterization of new molecules are strategically relevant to the research and development of innovative drugs for viral and bacterial treatment and disease management. Amphibian species possess a diverse array of compounds, including antimicrobial peptides. This study identified the first bioactive peptide from Salamandra salamandra in a transcriptome analysis. The synthetic peptide sequence, which belongs to the defensin family, was characterized through MALDI TOF/TOF mass spectrometry. Molecular docking assays hypothesized the interaction between the identified peptide and the active binding site of the spike WT RBD/hACE2 complex. Although additional studies are required, the preliminary evaluation of the antiviral potential of synthetic SS-I was conducted through an in vitro cell-based SARS-CoV-2 infection assay. Additionally, the cytotoxic and hemolytic effects of the synthesized peptide were assessed. These preliminary findings highlighted the potential of SS-I as a chemical scaffold for drug development against COVID-19, hindering viral infection. The peptide demonstrated hemolytic activity while not exhibiting cytotoxicity at the antiviral concentration.
1. Introduction
The indiscriminate utilization of antimicrobial agents and, as a consequence, antimicrobial-resistant pathogens pose a significant threat to the effectiveness of treating prevalent infectious diseases [1]. In addition, the recent rise of zoonotic diseases, including severe acute respiratory syndrome coronavirus (SARS-CoV) and Middle East respiratory syndrome coronavirus (MERS-CoV) [2], has exacerbated the situation due to the absence of appropriate resources for the rapid and effective development of new drugs.
Resistance to conventional antibiotics is a major global public health concern, leading to prolonged hospitalization times and a high mortality rate with consequent economic impacts.
Similar to other coronaviruses, SARS-CoV-2 relies on the surface spike glycoprotein to access the host cells, mainly through the interaction between its receptor-binding domain (RBD) and the host cell receptor angiotensin-converting enzyme 2 (ACE2) [3,4,5]. SARS-CoV-2 infection triggers a deep downstream pro-inflammatory cytokine storm. Elevated levels of pro-inflammatory cytokines can result in detrimental tissue damage, including lung tissue damage, respiratory failure, and, ultimately, multi-organ failure in COVID-19 patients. Therefore, molecular entities that can interfere with the binding of the SARS-CoV-2 spike protein to ACE2 have the potential to inhibit viral entry, thus reducing viral infectivity.
One promising approach to blocking viral activity is the application of natural peptide molecules due to their general advantages, such as high specificity and effectiveness. They are also characterized by easy and rapid production (despite high costs), low toxicity (minimal side effects and easy metabolism), and a particular mechanism of action that delays the emergence of resistant mutants. Moreover, natural peptides can be used synergistically with other drugs [6]. Natural peptides can serve as models for the development of modified synthetic antimicrobial peptides (AMPs). Peptides are highly versatile and amenable to improvement through design, which allows limitations to be addressed, such as a short half-life or poor oral absorption [7,8]. As a result, numerous peptide-based drugs are currently commercially available for treating numerous ailments, such as hepatitis C, myeloma, skin infections, and diabetes [9], with several hundred more in either the preclinical or clinical stage of development [10,11].
AMPs have been isolated from most life forms and are categorized into different peptide families according to their particular sequences and structures. The defensin AMP family is identified as abundant cysteine-rich AMPs divided into three groups, including α-, β-, and θ-defensins, based on the differential connections of their three disulfide bridges. Defensins and defensin-like peptides have been identified in fungi [12], plants [13], and numerous animals [14], including humans [15]. These peptides have demonstrated antimicrobial activity against multiple microorganisms [14,16,17,18,19].
Amphibians are an important source of AMPs that possess the ability to neutralize or kill microorganisms [20]. They present granular glands in their skin that synthesize and secrete a diverse array of peptides as part of their innate immune defense system. These AMPs, which vary in structure and size, exhibit a diversity of bioactivities, including antiviral, antifungal, anticancer, antioxidant, immune modulation, and inflammation responses. Moreover, they employ various mechanisms of action [21]. Each anuran species thus far exhibits a specific composition of peptides, although many of these peptides display similarities among closely related species, highlighting their common origin [22]. The widespread European fire salamander, Salamandra salamandra [23], is characterized by its conspicuously yellow and black skin and possesses specific glands that produce a defensive poison. The secretion of salamanders has been found to contain a variety of compounds [24], including peptides and alkaloids [25] with toxic, antimicrobial [14,26], and antioxidant properties [27]. The bioprospection and characterization of new molecules from amphibian species are of utmost strategic relevance to provide essential tools for immediate use in the research and development of drugs for viral and bacterial treatment and management. It is crucial to encourage academic endeavors in this direction, considering that, between 2015 and 2019, several of the new peptide-based drugs accepted by the FDA came about from the efforts of academic groups [10].
Here, we report the description and characterization of a new β-defensin-bioactive peptide identified from the transcriptome analysis of S. salamandra. We describe the 3D molecular docking in silico assay of its interaction with the complex spike WT RBD/hACE2. Moreover, we assess the SS-I synthetic peptide antiviral action through a Vero-CCL-81 cell-based SARS-CoV-2 infection test and its cytotoxic and hemolytic effects.
2. Materials and Methods
2.1. Transcriptome Assembly and Identification of Transcript Sequence by Homology
An RNA-seq dataset of S. salamandra was obtained from the Sequence Read Archive (SRA) under accession number SRR11118085. This database was derived from the collection, processing of biological material, and gene identification obtained from the tail-tip of the S. salamandra salamander [28]. The transcriptome data in this dataset were generated using paired-end total RNA sequencing (Illumina HiSeq2000, San Diego, CA, USA), and microarrays utilized for gene expression analysis were designed by Czypionka et al. [29].
Raw-read quality control and adapter trimming were carried out, respectively, in FastQC (v0.11.4) [30] and Trim Galore (v0.4.1) [31] using the option to execute Cutadapt (v1.8.3) [32] with default values. The reads were assembled using rnaSPAdes (v3.14.0) [33] without the read error correction mode (only the assembler parameter). Finally, a database was created from the assembled transcripts using makeblastdb (v2.6.0) [34], followed by a local tblastn search using the CFBD-1 defensin sequence from C. fudingensis as the query [14]. The best hit transcript obtained from the search was selected for further analysis. The Expasy translation tool was used to confirm the findings (https://web.expasy.org/translate/ (accessed on 23 April 2023)). Multiple sequence alignment was performed between the identified ORFs and amino acid sequences with the C. fundingensis sequence to assess identity and homology.
2.2. Sequence Alignment and Phylogenetic Analysis
A protein-BLAST (BLASTp) search [35] was conducted using the CFBD-1 amino acid sequence as the query against the non-redundant protein sequence database at the NCBI (National Center for Biotechnology Information). The search utilized default parameters. From the BLAST results, the 12 sequences with the lowest E values were selected for further analysis. The selected sequences were then subjected to the multiple sequence alignment program Clustal Omega [36] from the European Molecular Biology Laboratory—European Bioinformatics Institute (EMBL-EBI), employing default settings. For the phylogenetic tree, the results were visualized using EvolView [37,38,39]. To facilitate alignment visualization, Jalview 2.11.2.6 [40] was employed. In the alignment, the conserved amino acids, meaning those with more than 50% identity at a specific position, were highlighted using the Clustal coloring method. The sequences were organized into four groups, each sorted by similarity to SS-I. The first group comprises the sequences of SS-I and CFBD-1. The second group includes all the β-defensin peptides. The third group consists of the identified hypothetical proteins, while the fourth group comprises β-defensin-unrelated peptides.
2.3. In Silico Studies
2.3.1. Docking
The structural model of SS-I was generated using homology modeling with the assistance of the MPI Bioinformatics Toolkit [41,42], and subsequent refinement was performed using the PyMOL software, version 2.5 [43]. The protonation states of the residues were evaluated at neutral pH using the PDB2PQR server [44].
The protein–peptide interactions between hACE2 and SS-I (ACE2-PEP), as well as the binding structure of SS-I and SARS-CoV-2 spike RBD (SPIKE-PEP), were evaluated through protein–peptide flexible docking using the HADDOCK2.4 server [45,46]. The ACE2 and spike structures were obtained from Protein Data Bank files (6LZG) [47] and isolated via the PyMOL software. Active interfacial residues at the ACE2/SPIKE were selected for docking analysis.
2.3.2. Molecular Dynamics Simulations
Molecular dynamics (MD) simulations were performed using the conformational structure complexes obtained in the previous step of molecular docking, henceforth referred to as ACE2-PEP-S1 and ACE2-PEP-S2 (representing the two best solutions from the docking between the ACE2 protein and the peptide of interest) and SPIKE-PEP-S1 and SPIKE-PEP-S2 (representing the two best solutions from the docking between the spike protein and the peptide of interest). All MD simulations were conducted using the GROMACS v.2018 software [48]. The protonation states of the amino acid residues at pH 7.0 were evaluated using the PDB2PQR server [44]. The structures of the ACE2-PEP-S1, ACE2-PEP-S2, SPIKE-PEP-S1, and SPIKE-PEP-S2 complexes were energetically optimized using a combination of steepest descent (SD) and adopted basis Newton–Raphson (ABNR)-based energy minimization (500 steps). Subsequently, the complexes were subjected to a 100 ps MD simulation for temperature equilibration at 300 K, using the Charmm force field [49] with explicit solvent (TIP3P). Then, 100 ns MD simulations were performed under a constant temperature (T = 300 K) and pressure (1.0 bar), also employing the Charmm force field. The stability of the complexes during the MD simulations was evaluated by analyzing parameters between the molecules’ interfacing residues, such as residues making hydrogen/disulfide bonds, salt bridges, and covalent links. These analyses were performed using the tools of the PDBePISA web service [50] and the VMD software, version 1.9.3 [51]. Hydrogen bonds were considered present if the donor–acceptor distance was approximately 3.5 Å, the angle was around 30°, and the salt-bridge cutoff was <4.0 Å [52]. Two-dimensional ligand–protein interaction diagrams were made using the LigPlot+ web service [53].
2.3.3. Electronic Structure Calculations
The initial (pre-optimized) structures employed in the MD of ACE2-PEP-S1, ACE2-PEP-S2, SPIKE-PEP-S1, and SPIKE-PEP-S2 were employed as inputs for the calculation of local chemical reactivity descriptors. Four structures with slightly different conformations were evaluated using the density functional theory (DFT) framework. The B3LYP exchange–correlation functional [54,55,56] and the 6-31G(d,p) basis set were applied to all atoms. The calculations were performed in water, utilizing the polarizable continuum model (PCM) [57].
Chemical reactivity was assessed using condensed-to-atoms Fukui indexes (CAFIs) [58]. These indexes provide valuable information about the reactivity of peptide sites towards nucleophilic (f+) or electrophilic (f−) agents and have been widely used in peptide studies [27,59,60]. The CAFIs were calculated based on finite differences in the atomic populations obtained through Hirshfeld’s partition method, following a procedure described elsewhere [61,62].
2.4. Synthesis and Characterization of Peptide
The peptide SS-I was synthesized manually, with a standard Fmoc (N-(9-fluorenyl)methoxycarbonyl) chemistry. The synthesis was initiated with 215 mg of resin (0.70 mmol/g, Peptides International). Fmoc-protected amino acids (Peptides International) were used in a four-fold to six-fold molar excess relative to the nominal synthesis scale (1.2 mmol). Couplings were performed with 1,3-diisopropyl carbodiimide/ethyl 2-cyano-2-(hydroxyimino) acetate (DIC/Oxyma®️) in N,N-dimethylformamide (DMF) for 2–3 h. Amino group deprotections were carried out using a mixture of 4-methyl piperidine/DMF (1:4, v:v) for 20–30 min. Each deprotection and coupling were confirmed through a Kaiser test. The cleavage of the peptide from the resin and the removal of side-chain protecting groups were performed using 10.0 mL of a cleavage cocktail (Reagent K), shaken at room temperature for 90 min [63,64]. After solvent evaporation under nitrogen, the peptide was precipitated by adding cold diisopropyl ether, collected through filtration, and washed four times with the same solvent. Extraction was performed using a mixture of 200 mL of water and acetonitrile (1:1, v:v), and the crude peptide was lyophilized. The synthesized products were purified using reverse-phase HPLC with a C18 column (250 × 20 mm i.d., 15 μm, Shim-Pack PREP-ODS). To confirm the presence of the purified molecules, MALDI-TOF/TOF mass spectrometry (Ultraflex III Extreme Bruker Daltonics) was used in the positive, reflector mode [65].
2.5. In Vitro Synthetic SS-I Viability Evaluation
C20 cells were cultured in a DMEM-F12 medium supplemented with L-glutamine, 10% FBS, and 1% Pen/Strep at 37 °C and 5% CO2. For the experiments, 5 × 104 cells were seeded in each well. After four hours, the cells were treated with different concentrations of the SS-I synthetic peptide (5, 10, 50, and 100 μM). The cells were then incubated for 24 h.
For the MTT assay, 100 μL of 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) at 0.5 mg/mL was added to the cells. After four hours of incubation with MTT, DMSO was added to the wells to solubilize the formazan crystals, and the plate was measured at 570 nm. Cells treated with 30% DMSO were used as the positive control. The viability percentage was calculated through normalization to the basal value. Statistical analyses of five independent experiments were performed using GraphPad Prism version 9.5 (GraphPad Software, San Diego, CA, USA), including Brown–Forsythe and Welch ANOVA tests associated with Dunnett’s T3 multiple comparisons test.
2.6. In Vitro Vero-CCL-81 Cell-Based SARS-CoV-2 Infection Assay
The purified SS-I synthetic peptide was initially diluted to a concentration of 2 mM in DMSO and subsequently diluted in PBS to achieve a concentration of 60 μM. From this prepared working solution, 10 μL was added to the assay plates. The initial concentration for the dose–response assay was set at 10 μM. DMSO-treated infected cells and DMSO-treated non-infected cells were used as positive and negative controls, respectively.
Vero CCL-81 cells were plated in a 384-well plate and, after 24 h, the compounds were added to the cells previously described. Following that, the SARS-CoV-2 virus (SP02/human/2020/BR; GenBank Accession No. MT126808.1) was added at a multiplicity of infection of 0.1 viral particles per cell. The final DMSO concentration in the assay was 0.5% (v/v). After 33 h, the cells were fixed in 4% paraformaldehyde (in PBS pH 7.4) and immunofluorescence was performed using serum from a convalescent COVID-19 patient diluted at 1:1000 in 5% bovine serum albumin (BSA) in PBS, which served as the primary antibody. After 30 min, the wells were washed. A solution of Alexa488-conjugated goat anti-human IgG (Thermo Fisher Scientific, Waltham, MA, USA), and 5 µg/mL of DAPI (4′,6 diamidino-2-phenylindole; Sigma-Aldrich, St. Louis, MO, USA) diluted at 1:1000 in 5% BSA (v/v) was added to each well and incubated for 30 min. All wells were washed twice with PBS, and images were acquired using the HCS Operetta (PerkinElmer, Waltham, MA, EUA) and subsequently analyzed with the Harmony software (Perkin Elmer, Waltham, MA, USA), version 3.5.2. The measured parameters in each well were the total cell number and the total number of infected cells. The ratio between the number of infected cells and the total cell number was defined as the infection rate (IR). The antiviral activity was calculated based on the IR normalization to the negative control (DMSO-treated infected cells). The cell survival ratio was calculated by normalizing the total cell number in each well to the average number of cells in the positive control wells. A nonlinear regression analysis and sigmoidal dose–response (variable slope) were performed using GraphPad Prism version 7.0, considering three independent experiments.
2.7. Hemolysis Assay
To assess the hemolytic activity of synthetic SS-I, 4 mL of whole blood was collected in EDTA (1.8 mg/mL) tubes and then centrifuged at 1500 rpm for 10 min. Red blood cells (RBCs) were washed three times with PBS (pH 7.2) at 37 °C, replacing the removed plasma volume. A two-fold serial dilution of synthetic SS-I was prepared in a round-bottom plate starting at 100 μM. Then, 75 μL of 10% RBCs in PBS was added to each well containing 75 μL of the sample, PBS (negative control), or 0.1% Triton-X (positive control), and mixed carefully. All concentrations and controls were tested in triplicate. The plate was incubated for 1 h at 37 °C under gentle agitation. After the incubation, the plate was centrifuged at 4500 rpm for 5 min, 100 μL was transferred to a new flat-bottom plate, and finally measured at 550 nm. Hemolytic activity (%) = (Abs sample − Abs PBS)/(Abs Triton-X − Abs PBS) × 100.
3. Results and Discussion
3.1. Identification and Characterization of the Defensin SS-I
The identification of CFBD-1 as the first defensin with antimicrobial properties from Cynops fudingensis [14] and the subsequent discovery of Salamandrin-I from S. salamandra [27], where a sequence similarity between these two peptides was described by Plácido et al., was the starting point for this work. C. fudingensis, commonly known as the Fuding fire-bellied newt, has been described to live predominantly in an aquatic environment. Contrarily, fire salamanders are known to live in hilly forest areas (Figure 1). When compared to its aquatic counterpart, the terrestrial environment is associated with higher UV radiation levels and more significant variations in temperature and humidity. Besides the selection pressure on the animal species to adapt better to their settings, microbial pathogens undergo thorough adaptative evolution [66]. The conditions where fire salamanders live have been proven to provide these amphibians with antioxidant peptides (AOPs) and AMPs with much richer diversity and greater potency [67]. Considering this, the strategy was to use the CFBD-1 sequence to identify a similar peptide in the S. salamandra RNA-seq dataset through bioinformatic prospection.
Figure 1.
(A) Peneda-Gerês National Park, Portugal. (B) Specimens of fire salamanders (S. salamandra). Photo credit: Peter Eaton.
A novel β-defensin antimicrobial peptide, named SS-I, was identified from the tail-tip of S. salamandra larvae by combining RNA sequencing and bioinformatics. A BLAST search revealed a significant sequence similarity between SS-I and several β-defensin AMPs from other animals (Figure 2A). The multiple alignment was sorted by similarity to SS-I, with the aligned sequences from Zhangixalus puerensis to Plecoglossus altivelis representing β-defensin peptides. The displayed sequences from Xenopus laevis, Megalops atlanticus, and Alosa alosa correspond to hypothetical proteins. During genome sequencing, it is common to identify open reading frames (ORFs) that encode proteins that have not yet been proven to be expressed in the organism or whose function remains unknown.

Figure 2.
Results of BLASTp analysis. (A) Multiple alignment was performed using the Clustal Omega tool. The sequences were categorized into four groups, each sorted by similarity to SS-I. The CFDB-1 peptide, highlighted in bold, was used to identify SS-I. The first group comprises the sequences of SS-I and CFBD-1 (gray-lined box). In this group, conserved amino acids are colored. The second group consists of β-defensin peptides spanning from Zhangixalus puerensis to Plecoglossus altivelis. The third group includes hypothetical proteins of Xenopus laevis, Megalops atlanticus, and Alosa alosa. The fourth group encompasses species whose peptides do not belong to the β-defensin family. For all sequences, the conserved amino acids, meaning those present in more than 50% of the sequences at a specific position, were colored. The numbers following the species name indicate the aligned sequence limits. (B) Phylogenetic tree generated from the Clustal Omega alignment results.
Since these identified hypothetical proteins exhibit high similarity to other β-defensin peptides, it is plausible that they may share a similar function. However, it should be noted that similarity and the presence of multiple conserved residues do not directly imply a functional association. For instance, the peptide sequences of Alligator mississipiensis and Chelonia mydas represent an ADAM9-like (disintegrin and metalloproteinase domain-containing protein 9-like) protein and POLD3 (DNA polymerase delta subunit 3), respectively. Despite exhibiting highly conserved amino acids, such as glycine and cysteine, which play an important role in determining peptide structure, their functional connection remains unclear. Figure 2B shows a clear separation between exclusively aquatic species and those capable of exploiting both aquatic and terrestrial habitats. Moreover, it is apparent that S. salamandra exhibits a closer phylogenetic relationship with frogs and toads, followed by turtles and, lastly, alligators.
Figure 3 illustrates the homology-predicted 3D structure of the identified mature peptide consisting of 44 residues. The complete sequence of the peptide is NH2-FVVWGCADYRGSCRTACFAYEYSLGAKGCADGYICCVPNTFRLM-COOH, which contains six cysteines, four basic, and three acidic residues. The theoretical mass of the peptide is [M + H]+ (average mass) 4870.684 and [M + H]+ (monoisotopic) 4867.1515 [68]. The predicted peptide identified in the transcriptome analysis was synthesized, purified, and characterized via mass spectrometry for subsequent use in biological assays, as per the section on the materials and methods. The predicted structure presents disulfide bonds that define its global conformation. However, after the peptide synthesis, the cysteine oxidation was unsuccessful; thus, the correct folding was not attained, as the disulfide bonds were not formed.
Figure 3.
Hypothesized representations of SS-I peptide. (A) Ball-and-stick representation. (B) Ribbon representation. (C) Overlap of ball-and-stick and ribbon diagrams.
3.2. Interactions between SS-I with ACE2 and SARS-CoV-2 Spike Protein (S1)
The spike protein of SARS-CoV-2 comprises two subunits, S1 and S2, which play a two-step process: (i) receptor recognition and (ii) cell membrane fusion. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor, ACE2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain [69,70]. S1 can be divided into an N-terminal domain (NTD) and a C-terminal domain (CTD), and SARS-CoV-2 utilizes the S1 CTD to recognize the receptor (also called the receptor-binding domain (RBD)) [71]. In this way, the RBD region is a critical target for neutralizing SARS-CoV-2. For all explained here, we use a 2.5 Å crystal structure of SARS-CoV-2-CTD in complex with ACE2 (S1 subunit), reported in a previous study [71], to perform our analysis. In this study, we are also interested in identifying possible interactions between the proposed peptide (PEP) and the ACE2 cell receptor. Thus, as explained in more detail in the methodology, the docking solutions were identified as two different complexes: (i) the peptide complexed with the cell receptor (ACE2-PEP) and (ii) the peptide complexed with the SARS-CoV-2-CTD (SPIKE-PEP). The molecular complexes obtained through the docking and used for MD simulations (ACE2-PEP-S1, ACE2-PEP-S2, SPIKE-PEP-S1, and SPIKE-PEP-S2) are presented in the supplementary material (Figure S1). Here, S1 and S2 represent the two best docking solutions, respectively, for each complex.
Protein–protein interactions are essentially stabilized by hydrogen bonds (H-bonds), disulfide bonds, salt bridges, and, in rare cases, covalent links [72]. In the case of the molecular complexes under study, only hydrogen bonds and salt bridges were identified between the interface residues. Therefore, the analysis presented in Figure 4A shows significant differences in the number of H-bonds observed during the MD simulations of the complexes. The interactions between the proteins on the complexes ACE2-PEP-S1 and SPIKE-PEP-S1 presented a low frequency of H-bonds between zero and three, which makes the interaction between the proteins of the complex quite unstable. Conversely, the ACE2-PEP-S2 and SPIKE-PEP-S2 complexes showed a higher frequency of H-bonds, predominantly ranging between four and ten, despite the peptide consisting of only 44 amino acids. Similar behavior was observed for the frequency of salt bridges monitored throughout the simulation. Figure 4A shows that the ACE2-PEP-S2 complex has a predominant frequency of salt bridges equal to three, while the ACE2-PEP-S1 complex has a predominant frequency equal to one. In the case of the complexes containing the SPIKE protein, it was observed that both the SPIKE-PEP-S1 and SPIKE-PEP-S2 complexes have a predominant frequency of one. However, the SPIKE-PEP-S1 complex also showed a significant frequency of 0; that is, this complex remains for a considerable time during simulation without making salt bridge interactions. Although these docking solutions are energetically viable, these results suggest that the formation of the complexes ACE2-PEP-S1 and SPIKE-PEP-S1 may not be promising. On the other hand, these results suggest that the ACE2-PEP-S2 and SPIKE-PEP-S2 complexes are more stable, evidencing that the peptide can interact effectively with both the spike and the ACE2 proteins.

Figure 4.
(A) Frequency of H-bonds and salt bridges during MD simulations in the ACE2-PEP-S1, ACE2-PEP-S2, SPIKE-PEP-S1, and SPIKE-PEP-S2 complexes. (B) Root-mean-square deviation (RMSD) from MD simulations of the two best docking solutions: ACE2-PEP-S2 and SPIKE-PEP-S2. RMSD values are presented for each protein: ACE2, PEP(ACE2) (peptide complexed with ACE2 protein), SPIKE, and PEP(SPIKE) (peptide complexed with spike. (C) Two-dimensional ligand–protein interaction diagrams for the complexes ACE2-PEP-S2 and SPIKE-PEP-S2.
H-bonds and salt bridges with an occupancy higher than 10% during the MD between residues of the ACE2-PEP-S2 and SPIKE-PEP-S2 complexes are presented in Table 1. These residues play a critical role in maintaining the stability of the complexes. Figure 4B shows the root-mean-square deviation (RMSD) of atomic positions obtained from the MD simulations. The RMSD values are presented independently for each protein: ACE2, the peptide complexed with the ACE2 protein (PEP(ACE2)), SPIKE, and the peptide complexed with the spike protein (PEP(SPIKE)). The RMSD results demonstrate that ACE2 and spike proteins exhibit minimal conformational changes, indicating their stability throughout the 100 ns of simulation. In contrast, despite its smaller size, the peptide displayed higher RMSD values in both simulations, indicating more remarkable conformational changes during the MD. This is attributed to the outstanding flexibility of the peptide, as it recursively rearranged itself to maintain the H-bonds and salt bridges. Finally, Figure 4C presents a 2D representation of the frames with the highest number of H-bonds and salt bridges during MD for the ACE2-PEP-S2 and SPIKE-PEP-S2 complexes, where the amino acids involved in chemical contacts are highlighted.
Table 1.
Residues in ACE2-PEP-S2 and SPIKE-PEP-S2 complexes with H-bonds and salt bridges of >10% occupancy throughout MD simulation.
Figure 5 illustrates the estimated condensed-to-atoms Fukui index (CAFI) values for the peptide sequence, where high values indicate regions with higher reactivity towards nucleophiles (f+) and electrophiles (f−). Aiming to investigate the influence of complex formation on the local reactivity of the resulting structures, the CAFIs were evaluated considering the geometries coming from molecular docking, without subsequent DFT-based geometry optimization, aiming to keep specific structural features of the adsorbed systems. It is worth noting the absence of negative CAFI values, suggesting the existence of plausible structures. Such analyses were conducted to investigate possible charge transfer processes that can take part during complex formation; in this sense, high CAFI values close to interaction centers suggest that the peptide adsorption can be with soft–soft interactions (via frontier molecular orbitals).
Figure 5.
CAFI descriptors estimated for distinct conformation of peptide sequences. Peptide sites with reactivity towards (A) nucleophilic and (B) electrophilic agents.
The dissimilarities observed between the structures can be associated with conformational variations. In general, it is evident that sites with high f+ values are close to donor residues (e.g., Phe1, Phe18, Val37, and Phe41), while sites with high f− values are close to acceptor residues (e.g., Trp4, Asp8, Asp31, and Met44) identified in MD simulations. These findings further support the potential for effective interaction between the peptide and ACE2/spike structures.
All of these results revealed that stable complexes formed between the SS-I and ACE2/Spike protein. The stability of the complexes was explored through molecular dynamics simulations. Some studies demonstrated that the efficacy of ligands correlates with their residence time, which is also associated with their binding affinity [73]. Additionally, 100 ns (the simulation time used in this study) is commonly used to evaluate the complexes’ stability using a molecular dynamics approach [74]. In this way, our results indicated a high affinity between ligand and receptor and, consequently, the stability of the complexes (SS-I and ACE2/Spike) throughout the molecular dynamics simulations. However, despite all this evidence, it is not possible to state that these interactions occur in vitro, but it can be a good indication of potential ligands for experimental studies.
3.3. In Vitro Cytotoxic and Hemolytic Activity of Synthetic SS-I and SARS-CoV-2 Infection Assay
The initial step in determining the appropriate range of concentrations for an infection assay involves assessing the cytotoxicity of the SS-I synthetic peptide. Figure 6 demonstrates that a concentration of 5 μM, despite exhibiting an average viability of 85%, does not exhibit a significant difference compared to the basal condition.
Figure 6.
Viability measurement of C-20 microglial cells treated with synthetic SS-I at different concentrations using the MTT assay. The presented data represent the results of five independent experiments, with significant differences from the basal control group indicated and marked with asterisks (* p < 0.0332, ** p < 0.0021, *** p < 0.0002).
The peptide at 10 μM showed a slight decrease in viability, with a significant difference from the basal control; however, 79% viability is not considered to indicate a cytotoxic effect [75]. Higher SS-I concentrations of 50 and 100 μM resulted in a decline in viability compared to that of cells treated with 30% dimethyl sulfoxide (DMSO).
The hemolysis activity was assessed by measuring the release of hemoglobin at different peptide concentrations. Figure 7 illustrates that all concentrations between 100 and 0.78125 μM have a hemolytic effect. This peptide has a GRAVY index value of 0.339, which reveals it to have hydrophobic properties. The hydrophobicity in peptides has been linked to hemolytic effects due to the formation of pores in the cellular membrane [76,77,78]. The eukaryotic cell membrane, having a zwitterionic quality, is very susceptible to hydrophobic interactions [79]. Although the synthetic SS-I presents high hemolytic activity, it is not linked to high cytotoxicity in microglial cells, which can be explained by the high fragility of red blood cells [78,80]. The mechanisms through which the AMPs affect the cell membranes are still not fully understood and many have been proposed [81]. Nonetheless, the consensus is that the phospholipid composition of cell membranes determines how these peptides interact with cells [82,83,84]. A lower phosphocholine-to-sphingomyelin ratio, linked to low membrane fluidity, is associated with higher tolerance to membrane-disrupting activity [85]. The outer leaflet of the erythrocyte membrane comprises around 45% of phosphatidylcholine [86]. The observation of a high percentage may provide a potential explanation for the heightened hemolytic activity exhibited by SS-I in contrast to cytotoxicity.
Figure 7.
Hemolysis activity of SS-I synthetic peptide. Each concentration (0.78125 to 100 μM) was tested in triplicate. The red dotted line represents 100% hemolysis.
The inhibitory capacity of synthetic SS-I against the SARS-CoV-2 infection in Vero CCL-81 cells was assessed. As shown in Figure 8, the peptide demonstrated the ability to inhibit viral infection with an EC50 of 2.7 μM. The same assay showed a 50% cytotoxic concentration (CC50) of 10 μM in Vero CCL-81 cells. It is possible that, if higher concentrations of synthetic SS-I were tested, the CC50 could be higher as well. However, it should be noted that the higher tested concentrations have a greater associated error, which could have biased the CC50 determination. These results are consistent with the MTT assay, where a concentration of 10 μM was the highest at which the synthetic peptide did not exhibit a cytotoxic effect. Nevertheless, since the EC50 is lower than the calculated CC50, SS-I holds therapeutical relevance, and it is also viable to use concentrations that might have a more significant effect without jeopardizing cellular viability.
Figure 8.
SARS-CoV-2 antiviral concentration–response and cell survival curves for synthetic SS-I. The fitted EC50 and CC50 values are the average of three independent experiments. The dotted line represents 100% antiviral activity and cell survival.
Considering that the linearized form of SS-I was demonstrated to have antiviral activity, we can infer that a fragment of SS-I can maintain the activity. The antimicrobial effect is associated with the peptide’s positive charge, while the cytotoxic and hemolytic activity, as already mentioned, is linked to hydrophobicity [76,77]. Besides the synthesis of smaller fragments being simpler and more cost-effective, it would enable the design and acquisition of a peptide with higher antimicrobial activity while reducing cytotoxic and hemolytic effects. Reynolds et al. demonstrated that defensin N-terminal fragments are potent AMPs [87], making this a promising next step for future works.
4. Conclusions
Alongside the development and implementation of vaccinations, it is crucial to invest in the study of novel front-line therapeutic strategies to fight viral diseases and reduce their associated morbidity and mortality. The research and characterization of new peptides, either as standalone treatments or as adjuncts to existing antiviral and antibacterial drugs, hold significant strategic importance in equipping us with tools for the prompt therapeutic development and management of viral and bacterial infections.
The field of antimicrobial resistance is dynamic and rapidly evolving, posing ongoing challenges for clinicians in the treatment of resistant infections.
In this study, we identified a novel defensin, SS-I, identified from the tail-tip of the salamander S. salamandra. A BLAST search revealed that SS-I exhibited the highest similarity to CFBD-1, a salamander defensin previously identified in C. fudingensis.
All simulations and interaction studies were implemented using the predicted tridimensional peptide structure. The performed in vitro assays, on the other hand, most likely used the peptide in its linear form. Even though the synthesized peptide exhibited antiviral activity, we cannot assert that the predicted interactions between the peptide and ACE2 and spike proteins are responsible for the observed infection inhibition. For that, additional studies, such as nuclear magnetic resonance (NMR) and X-ray crystallography, are needed to fully characterize the peptide structure and its interaction with ACE2 and spike proteins. Moreover, we can conduct regio-specific disulfide bond formation in order to perform structure–activity studies. Such studies can provide a deeper understanding of the antiviral activity of the peptide and its potential use in the development of new therapeutic agents against viral infections.
The synthesized peptide proved to be highly hemolytic at every tested concentration but not cytotoxic in the antiviral concentration range. As prospects, the research of SS-I-derived fragments could overcome the hemolytic effects and further improve their antimicrobial activity while being a more accessible synthesis.
There is currently extensive nonclinical and clinical research underway to evaluate the potential of AMPs as next-generation antibiotics. Advancements in areas such as smart formulation strategies, advanced chemical synthesis protocols, and a deeper understanding of their mechanism of action are expected to accelerate the translation of AMP-based research findings into viable pharmaceutical product candidates. This peptide could be used as a tool to study the interaction between the virus and host cells, which could contribute to the understanding of the pathogenesis of COVID-19 and the development of new therapeutic strategies. Further investment in research and development is necessary to fully assess the potential of these novel and effective tools.
In conclusion, besides the development of vaccinations, it is essential to focus on exploring new therapeutic strategies and antimicrobial peptides to combat viral and bacterial infections effectively. These efforts will contribute to the advancement of therapeutic options and help address the challenges posed by antimicrobial resistance.
Supplementary Materials
The following supporting information can be downloaded at https://www.mdpi.com/article/10.3390/pharmaceutics16020190/s1, Figure S1: ACE2-PEP-S1, ACE2-PEP-S2, SPIKE-PEP-S1, and SPIKE-PEP-S2 molecular complexes obtained through docking analysis and used for MD simulations. Figure S2: MS/MS Spectrum of the triply charged ion [M + 3H]3+ of SS-I.
Author Contributions
Conceptualization, A.L.A.N.B., V.C.S., M.G.C., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; methodology, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., S.R.C., C.B.M., C.G.B., A.P.C., R.P.S., W.F.C., R.M.F., A.G.V. and J.R.S.A.L.; formal analysis, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., S.R.C., C.B.M., C.G.B., A.P.C., R.P.S., W.F.C., R.M.F., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; investigation, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., S.R.C., C.B.M., C.G.B., A.P.C., R.P.S., W.F.C., R.M.F., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; writing—original draft preparation, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; writing—review and editing, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; visualization, A.L.A.N.B., V.C.S., A.F.R.-J., M.G.C., A.G.V., J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; supervision, J.A.R., D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; project administration, J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L.; funding acquisition, D.D.R.A., A.B.-N., T.K.S.B., J.G., G.D.B., L.H.G.F.-J., P.E., M.M., M.J.K., A.P. and J.R.S.A.L. All authors have read and agreed to the published version of the manuscript.
Funding
This work was financed by national funds through the FCT—Fundação para a Ciência e a Tecnologia, I.P., within the project no. PTDC/BII_BIO/31158/2017; FEDER-Fundo Europeu de Desenvolvimento Regional funds through the COMPETE 2020-Operacional Programme for Competitiveness and Internationalization (POCI), by Portuguese funds through FCT-Fundação para a Ciência e a Tecnologia—grant number: POCI-01-0145-FEDER-031158–PTDC/BII-BIO/31158/2017; and CAPES/Ministry of Education, Brazil—grant no. 88887.505029/2020-00. CGB received a fellowship from CAPES (no. 88887.513215/2020-00).
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
The data presented in this study are available within the article and Supplementary Material.
Acknowledgments
A.P. was a recipient of a post-doctoral grant from the project VIDA-FROG-Valorisation of molecules isolated from aquatic portuguese amphibians. The authors would like to thank Bioprospectum Lda for their logistical and financial support of this project.
Conflicts of Interest
The authors declare no conflicts of interest.
References
- Tamma, P.D.; Miller, M.A.; Dullabh, P.; Ahn, R.; Speck, K.; Gao, Y.; Scherpf, E.; Cosgrove, S.E. Association of a Safety Program for Improving Antibiotic Use with Antibiotic Use and Hospital-Onset Clostridioides Difficile Infection Rates among US Hospitals. JAMA Netw. Open 2021, 4, e210235. [Google Scholar] [CrossRef]
- Chafekar, A.; Fielding, B.C. MERS-CoV: Understanding the Latest Human Coronavirus Threat. Viruses 2018, 10, 93. [Google Scholar] [CrossRef]
- Hoffmann, M.; Kleine-Weber, H.; Schroeder, S.; Krüger, N.; Herrler, T.; Erichsen, S.; Schiergens, T.S.; Herrler, G.; Wu, N.H.; Nitsche, A.; et al. SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 2020, 181, 271–280.e8. [Google Scholar] [CrossRef] [PubMed]
- Walls, A.C.; Park, Y.J.; Tortorici, M.A.; Wall, A.; McGuire, A.T.; Veesler, D. Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein. Cell 2020, 181, 281–292.e6. [Google Scholar] [CrossRef]
- Lan, J.; Ge, J.; Yu, J.; Shan, S.; Zhou, H.; Fan, S.; Zhang, Q.; Shi, X.; Wang, Q.; Zhang, L.; et al. Structure of the SARS-CoV-2 Spike Receptor-Binding Domain Bound to the ACE2 Receptor. Nature 2020, 581, 215–220. [Google Scholar] [CrossRef] [PubMed]
- Boto, A.; Pérez de la Lastra, J.; González, C.C.; De La Lastra, J.M.P.; González, C.C. The Road from Host-Defense Peptides to a New Generation of Antimicrobial Drugs. Molecules 2018, 23, 311. [Google Scholar] [CrossRef] [PubMed]
- Di, L. Strategic Approaches to Optimizing Peptide ADME Properties. AAPS J. 2015, 17, 134–143. [Google Scholar] [CrossRef] [PubMed]
- Bak, A.; Dai, W. Peptide Developability at the Discovery-to-Development Interface—Current State and Future Opportunities. AAPS J. 2015, 17, 777–779. [Google Scholar] [CrossRef][Green Version]
- da Costa, J.P.; Cova, M.; Ferreira, R.; Vitorino, R. Antimicrobial Peptides: An Alternative for Innovative Medicines? Appl. Microbiol. Biotechnol. 2015, 99, 2023–2040. [Google Scholar] [CrossRef]
- de la Torre, B.G.; Albericio, F. Peptide Therapeutics 2.0. Molecules 2020, 25, 2293. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Björn, C.; Ekblom, J. Antimicrobial Peptides as Therapeutic Agents: Opportunities and Challenges. Crit. Rev. Biotechnol. 2020, 40, 978–992. [Google Scholar] [CrossRef]
- Zhu, S. Discovery of Six Families of Fungal Defensin-like Peptides Provides Insights into Origin and Evolution of the CSalphabeta Defensins. Mol. Immunol. 2008, 45, 828–838. [Google Scholar] [CrossRef] [PubMed]
- Silverstein, K.A.T.; Graham, M.A.; Paape, T.D.; Vandenbosch, K.A. Genome Organization of More Than 300 Defensin-Like Genes in Arabidopsis. Plant Physiol. 2005, 138, 600–610. [Google Scholar] [CrossRef] [PubMed]
- Meng, P.; Yang, S.; Shen, C.; Jiang, K.; Rong, M.; Lai, R. The First Salamander Defensin Antimicrobial Peptide. PLoS ONE 2013, 8, e83044. [Google Scholar] [CrossRef] [PubMed]
- Jarczak, J.; Kościuczuk, E.M.; Lisowski, P.; Strzałkowska, N.; Jóźwik, A.; Horbańczuk, J.; Krzyzewski, J.; Zwierzchowski, L.; Bagnicka, E. Defensins: Natural Component of Human Innate Immunity. Hum. Immunol. 2013, 74, 1069–1079. [Google Scholar] [CrossRef] [PubMed]
- Thevissen, K.; Kristensen, H.-H.; Thomma, B.P.H.J.; Cammue, B.P.A.; François, I.E.J.A. Therapeutic Potential of Antifungal Plant and Insect Defensins. Drug Discov. Today 2007, 12, 966–971. [Google Scholar] [CrossRef] [PubMed]
- Sang, Y.; Blecha, F. Antimicrobial Peptides and Bacteriocins: Alternatives to Traditional Antibiotics. Anim. Health Res. Rev. 2008, 9, 227–235. [Google Scholar] [CrossRef] [PubMed]
- Zhao, H.; Kong, Y.; Wang, H.; Yan, T.; Feng, F.; Bian, J.; Yang, Y.; Yu, H. A Defensin-like Antimicrobial Peptide from the Venoms of Spider, Ornithoctonus hainana. J. Pept. Sci. 2011, 17, 540–544. [Google Scholar] [CrossRef]
- Rodriguez, A.; Pedersen, M.; Villegas, E.; Rivas-Santiago, B.; Villegas-Moreno, J.; Amero, C.; Norton, R.S.; Corzo, G. Antimicrobial Activity and Structure of a Consensus Human β-Defensin and Its Comparison to a Novel Putative HBD10. Proteins Struct. Funct. Bioinform. 2020, 88, 175–186. [Google Scholar] [CrossRef]
- Patocka, J.; Nepovimova, E.; Klimova, B.; Wu, Q.; Kuca, K. Antimicrobial Peptides: Amphibian Host Defense Peptides. Curr. Med. Chem. 2019, 26, 5924–5946. [Google Scholar] [CrossRef]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef]
- Marani, M.M.; Aguilar, S.; Cuzziol Boccioni, A.P.; Cancelarich, N.L.; Basso, N.G.; Albericio, F. Identification of New Ocellatin Antimicrobial Peptides by CDNA Precursor Cloning in the Frame of This Family of Intriguing Peptides. Antibiotics 2020, 9, 751. [Google Scholar] [CrossRef]
- Linnæus, C. Systema Naturae per Regna Tria Naturae, Secundum Classes, Ordines, Genera, Species, Cum Characteribus, Differentiis, Synonymis, Locis, 10th ed.; Salvii, L., Ed.; Stockholm, Sweden, 1758. [Google Scholar]
- Lüddecke, T.; Schulz, S.; Steinfartz, S.; Vences, M. A Salamander’s Toxic Arsenal: Review of Skin Poison Diversity and Function in True Salamanders, Genus Salamandra. Sci. Nat. 2018, 105, 56. [Google Scholar] [CrossRef] [PubMed]
- Mebs, D.; Pogoda, W. Variability of Alkaloids in the Skin Secretion of the European Fire Salamander (Salamandra Salamadra terrestris). Toxicon 2005, 45, 603–606. [Google Scholar] [CrossRef] [PubMed]
- Knepper, J.; Lüddecke, T.; Preißler, K.; Vences, M.; Schulz, S. Isolation and Identification of Alkaloids from Poisons of Fire Salamanders (Salamandra salamandra). J. Nat. Prod. 2019, 82, 1319–1324. [Google Scholar] [CrossRef]
- Plácido, A.; Bueno, J.; Barbosa, E.A.; Moreira, D.C.; Dias, J.D.N.; Cabral, W.F.; Albuquerque, P.; Bessa, L.J.; Freitas, J.; Kuckelhaus, S.A.S.; et al. The Antioxidant Peptide Salamandrin-I: First Bioactive Peptide Identified from Skin Secretion of Salamandra Genus (Salamandra salamandra). Biomolecules 2020, 10, 512. [Google Scholar] [CrossRef] [PubMed]
- Goedbloed, D.J.; Czypionka, T.; Altmüller, J.; Rodriguez, A.; Küpfer, E.; Segev, O.; Blaustein, L.; Templeton, A.R.; Nolte, A.W.; Steinfartz, S. Parallel Habitat Acclimatization Is Realized by the Expression of Different Genes in Two Closely Related Salamander Species (Genus Salamandra). Heredity 2017, 119, 429–437. [Google Scholar] [CrossRef]
- Czypionka, T.; Krugman, T.; Altmüller, J.; Blaustein, L.; Steinfartz, S.; Templeton, A.R.; Nolte, A.W. Ecological Transcriptomics—A Non-Lethal Sampling Approach for Endangered Fire Salamanders. Methods Ecol. Evol. 2015, 6, 1417–1425. [Google Scholar] [CrossRef]
- Andrews, S. FastQC: A Quality Control Tool for High Throughput Sequence Data. 2015. Available online: http://www.bioinformatics.babraham.ac.uk/projects/fastqc/ (accessed on 29 June 2022).
- Krueger, F.; James, F.; Ewels, P.; Afyounian, E.; Weinstein, M.; Schuster-Boeckler, B.; Hulselmans, G.; Sclamons. FelixKrueger/TrimGalore: V0.6.10-Add Default Decompression Path. Zenodo. 2023. Available online: https://zenodo.org/records/7598955 (accessed on 9 May 2023).
- Martin, M. Cutadapt Removes Adapter Sequences from High-Throughput Sequencing Reads. EMBnet J. 2011, 17, 10–12. [Google Scholar] [CrossRef]
- Bushmanova, E.; Antipov, D.; Lapidus, A.; Prjibelski, A.D. RnaSPAdes: A de Novo Transcriptome Assembler and Its Application to RNA-Seq Data. Gigascience 2019, 8, giz100. [Google Scholar] [CrossRef]
- Camacho, C.; Coulouris, G.; Avagyan, V.; Ma, N.; Papadopoulos, J.; Bealer, K.; Madden, T.L. BLAST+: Architecture and Applications. BMC Bioinform. 2009, 10, 421. [Google Scholar] [CrossRef]
- Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic Local Alignment Search Tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
- Madeira, F.; Pearce, M.; Tivey, A.R.N.; Basutkar, P.; Lee, J.; Edbali, O.; Madhusoodanan, N.; Kolesnikov, A.; Lopez, R. Search and Sequence Analysis Tools Services from EMBL-EBI in 2022. Nucleic Acids Res. 2022, 50, W276–W279. [Google Scholar] [CrossRef] [PubMed]
- Subramanian, B.; Gao, S.; Lercher, M.J.; Hu, S.; Chen, W.H. Evolview v3: A Webserver for Visualization, Annotation, and Management of Phylogenetic Trees. Nucleic Acids Res. 2019, 47, W270–W275. [Google Scholar] [CrossRef]
- He, Z.; Zhang, H.; Gao, S.; Lercher, M.J.; Chen, W.H.; Hu, S. Evolview v2: An Online Visualization and Management Tool for Customized and Annotated Phylogenetic Trees. Nucleic Acids Res. 2016, 44, W236–W241. [Google Scholar] [CrossRef]
- Zhang, H.; Gao, S.; Lercher, M.J.; Hu, S.; Chen, W.H. EvolView, an Online Tool for Visualizing, Annotating and Managing Phylogenetic Trees. Nucleic Acids Res. 2012, 40, W569–W572. [Google Scholar] [CrossRef]
- Waterhouse, A.M.; Procter, J.B.; Martin, D.M.A.; Clamp, M.; Barton, G.J. Jalview Version 2—A Multiple Sequence Alignment Editor and Analysis Workbench. Bioinformatics 2009, 25, 1189–1191. [Google Scholar] [CrossRef] [PubMed]
- Zimmermann, L.; Stephens, A.; Nam, S.-Z.; Rau, D.; Kübler, J.; Lozajic, M.; Gabler, F.; Söding, J.; Lupas, A.N.; Alva, V. A Completely Reimplemented MPI Bioinformatics Toolkit with a New HHpred Server at Its Core. J. Mol. Biol. 2018, 430, 2237–2243. [Google Scholar] [CrossRef]
- Gabler, F.; Nam, S.; Till, S.; Mirdita, M.; Steinegger, M.; Söding, J.; Lupas, A.N.; Alva, V. Protein Sequence Analysis Using the MPI Bioinformatics Toolkit. Curr. Protoc. Bioinform. 2020, 72, e108. [Google Scholar] [CrossRef] [PubMed]
- Schrödinger, L.; DeLano, W. PyMOL 2020. Available online: http://www.pymol.org/pymol (accessed on 30 June 2022).
- Dolinsky, T.J.; Nielsen, J.E.; McCammon, J.A.; Baker, N.A. PDB2PQR: An Automated Pipeline for the Setup of Poisson-Boltzmann Electrostatics Calculations. Nucleic Acids Res. 2004, 32, W665–W667. [Google Scholar] [CrossRef]
- van Zundert, G.C.P.; Rodrigues, J.P.G.L.M.; Trellet, M.; Schmitz, C.; Kastritis, P.L.; Karaca, E.; Melquiond, A.S.J.; van Dijk, M.; de Vries, S.J.; Bonvin, A.M.J.J. The HADDOCK2.2 Web Server: User-Friendly Integrative Modeling of Biomolecular Complexes. J. Mol. Biol. 2016, 428, 720–725. [Google Scholar] [CrossRef] [PubMed]
- Honorato, R.V.; Koukos, P.I.; Jiménez-García, B.; Tsaregorodtsev, A.; Verlato, M.; Giachetti, A.; Rosato, A.; Bonvin, A.M.J.J. Structural Biology in the Clouds: The WeNMR-EOSC Ecosystem. Front. Mol. Biosci. 2021, 8, 729513. [Google Scholar] [CrossRef]
- RCSB PDB-6LZG: Structure of Novel Coronavirus Spike Receptor-Binding Domain Complexed with Its Receptor ACE2. Available online: https://www.rcsb.org/structure/6LZG (accessed on 29 June 2022).
- Van Der Spoel, D.; Lindahl, E.; Hess, B.; Groenhof, G.; Mark, A.E.; Berendsen, H.J.C. GROMACS: Fast, Flexible, and Free. J. Comput. Chem. 2005, 26, 1701–1718. [Google Scholar] [CrossRef] [PubMed]
- Vanommeslaeghe, K.; Hatcher, E.; Acharya, C.; Kundu, S.; Zhong, S.; Shim, J.; Darian, E.; Guvench, O.; Lopes, P.; Vorobyov, I.; et al. CHARMM General Force Field: A Force Field for Drug-like Molecules Compatible with the CHARMM All-Atom Additive Biological Force Fields. J. Comput. Chem. 2010, 31, 671–690. [Google Scholar] [CrossRef]
- Krissinel, E.; Henrick, K. Inference of Macromolecular Assemblies from Crystalline State. J. Mol. Biol. 2007, 372, 774–797. [Google Scholar] [CrossRef]
- Humphrey, W.; Dalke, A.; Schulten, K. VMD: Visual Molecular Dynamics. J. Mol. Graph. 1996, 14, 33–38. [Google Scholar] [CrossRef]
- Ban, X.; Lahiri, P.; Dhoble, A.S.; Li, D.; Gu, Z.; Li, C.; Cheng, L.; Hong, Y.; Li, Z.; Kaustubh, B. Evolutionary Stability of Salt Bridges Hints Its Contribution to Stability of Proteins. Comput. Struct. Biotechnol. J. 2019, 17, 895–903. [Google Scholar] [CrossRef]
- Laskowski, R.A.; Swindells, M.B. LigPlot+: Multiple Ligand–Protein Interaction Diagrams for Drug Discovery. J. Chem. Inf. Model. 2011, 51, 2778–2786. [Google Scholar] [CrossRef] [PubMed]
- Becke, A.D. Density-functional Thermochemistry. III. The Role of Exact Exchange. J. Chem. Phys. 1993, 98, 5648–5652. [Google Scholar] [CrossRef]
- Lee, C.; Yang, W.; Parr, R.G. Development of the Colle-Salvetti Correlation-Energy Formula into a Functional of the Electron Density. Phys. Rev. B 1988, 37, 785–789. [Google Scholar] [CrossRef]
- Stephens, P.J.; Devlin, F.J.; Chabalowski, C.F.; Frisch, M.J. Ab Initio Calculation of Vibrational Absorption and Circular Dichroism Spectra Using Density Functional Force Fields. J. Phys. Chem. 1994, 98, 11623–11627. [Google Scholar] [CrossRef]
- Cossi, M.; Barone, V.; Cammi, R.; Tomasi, J. Ab Initio Study of Solvated Molecules: A New Implementation of the Polarizable Continuum Model. Chem. Phys. Lett. 1996, 255, 327–335. [Google Scholar] [CrossRef]
- Yang, W.; Mortier, W.J. The Use of Global and Local Molecular Parameters for the Analysis of the Gas-Phase Basicity of Amines. J. Am. Chem. Soc. 1986, 108, 5708–5711. [Google Scholar] [CrossRef] [PubMed]
- Barbosa, E.A.; Plácido, A.; Moreira, D.C.; Albuquerque, L.; Dematei, A.; Silva-Carvalho, A.É.; Cabral, W.F.; Báo, S.N.; Saldanha-Araújo, F.; Kuckelhaus, S.A.S.; et al. The Peptide Secreted at the Water to Land Transition in a Model Amphibian Has Antioxidant Effects. Proc. R. Soc. B Biol. Sci. 2021, 288, 20211531. [Google Scholar] [CrossRef] [PubMed]
- Plácido, A.; do Pais do Amaral, C.; Teixeira, C.; Nogueira, A.; Brango-Vanegas, J.; Alves Barbosa, E.; Moreira, D.C.; Silva-Carvalho, A.É.; da Silva, M.d.G.; do Nascimento Dias, J.; et al. Neuroprotective Effects on Microglia and Insights into the Structure–Activity Relationship of an Antioxidant Peptide Isolated from Pelophylax perezi. J. Cell Mol. Med. 2022, 26, 2793–2807. [Google Scholar] [CrossRef] [PubMed]
- Alves, G.G.B.; Lavarda, F.C.; Graeff, C.F.O.; Batagin-Neto, A. Reactivity of Eumelanin Building Blocks: A DFT Study of Monomers and Dimers. J. Mol. Graph. Model. 2020, 98, 107609. [Google Scholar] [CrossRef] [PubMed]
- Maia, R.A.; Ventorim, G.; Batagin-Neto, A. Reactivity of Lignin Subunits: The Influence of Dehydrogenation and Formation of Dimeric Structures. J. Mol. Model. 2019, 25, 228. [Google Scholar] [CrossRef]
- Chan, W.C.; White, P.D. (Eds.) Fmoc Solid Phase Peptide Synthesis: A Practical Approach; Practical Approach Series; Oxford University Press: Oxford, UK, 2000; ISBN 0199637253. [Google Scholar]
- Subirós-Funosas, R.; Prohens, R.; Barbas, R.; El-Faham, A.; Albericio, F. Oxyma: An Efficient Additive for Peptide Synthesis to Replace the Benzotriazole-Based HOBt and HOAt with a Lower Risk of Explosion. Chemistry 2009, 15, 9394–9403. [Google Scholar] [CrossRef]
- Dematei, A.; Nunes, J.B.; Moreira, D.C.; Jesus, J.A.; Laurenti, M.D.; Mengarda, A.C.A.; Vieira, M.S.; Do Amaral, C.P.; Domingues, M.M.; De Moraes, J.; et al. Mechanistic Insights into the Leishmanicidal and Bactericidal Activities of Batroxicidin, a Cathelicidin-Related Peptide from a South American Viper (Bothrops atrox). J. Nat. Prod. 2021, 84, 1787–1798. [Google Scholar] [CrossRef]
- Shi, A.; Fan, F.; Broach, J.R. Microbial Adaptive Evolution. J. Ind. Microbiol. Biotechnol. 2022, 49, 76. [Google Scholar] [CrossRef] [PubMed]
- Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.H.; Zhang, Y. Rich Diversity and Potency of Skin Antioxidant Peptides Revealed a Novel Molecular Basis for High-Altitude Adaptation of Amphibians. Sci. Rep. 2016, 6, 19866. [Google Scholar] [CrossRef] [PubMed]
- ProteinProspector. Available online: https://prospector.ucsf.edu/prospector/mshome.htm (accessed on 9 May 2023).
- Xiong, Q.; Cao, L.; Ma, C.; Tortorici, M.A.; Liu, C.; Si, J.; Liu, P.; Gu, M.; Walls, A.C.; Wang, C.; et al. Close Relatives of MERS-CoV in Bats Use ACE2 as Their Functional Receptors. Nature 2022, 612, 748–757. [Google Scholar] [CrossRef] [PubMed]
- Huang, Y.; Yang, C.; Xu, X.; Xu, W.; Liu, S. Structural and Functional Properties of SARS-CoV-2 Spike Protein: Potential Antivirus Drug Development for COVID-19. Acta Pharmacol. Sin. 2020, 41, 1141–1149. [Google Scholar] [CrossRef] [PubMed]
- Wang, Q.; Zhang, Y.; Wu, L.; Niu, S.; Song, C.; Zhang, Z.; Lu, G.; Qiao, C.; Hu, Y.; Yuen, K.-Y.; et al. Structural and Functional Basis of SARS-CoV-2 Entry by Using Human ACE2. Cell 2020, 181, 894–904.e9. [Google Scholar] [CrossRef] [PubMed]
- Nazario de Moraes, L.; Tommasini Grotto, R.M.; Targino Valente, G.; de Carvalho Sampaio, H.; Magro, A.J.; Fogaça, L.; Wolf, I.R.; Perahia, D.; Faria Silva, G.; Plana Simões, R. A Novel Molecular Mechanism to Explain Mutations of the HCV Protease Associated with Resistance against Covalently Bound Inhibitors. Virus Res. 2019, 274, 197778. [Google Scholar] [CrossRef] [PubMed]
- Hollingsworth, S.A.; Dror, R.O. Molecular Dynamics Simulation for All. Neuron 2018, 99, 1129–1143. [Google Scholar] [CrossRef] [PubMed]
- Liu, K.; Kokubo, H. Exploring the Stability of Ligand Binding Modes to Proteins by Molecular Dynamics Simulations: A Cross-Docking Study. J. Chem. Inf. Model. 2017, 57, 2514–2522. [Google Scholar] [CrossRef] [PubMed]
- ISO 10993-5; Biological Evaluation of Medical Devices. International Organization for Standardization: Geneva, Switzerland, 2009.
- Hwang, P.M.; Vogel, H.J. Structure-Function Relationships of Antimicrobial Peptides. Biochem. Cell Biol. 1998, 76, 235–246. [Google Scholar] [CrossRef]
- Klüver, E.; Schulz-Maronde, S.; Scheid, S.; Meyer, B.; Forssmann, W.G.; Adermann, K. Structure-Activity Relation of Human β-Defensin 3: Influence of Disulfide Bonds and Cysteine Substitution on Antimicrobial Activity and Cytotoxicity. Biochemistry 2005, 44, 9804–9816. [Google Scholar] [CrossRef]
- Greco, I.; Molchanova, N.; Holmedal, E.; Jenssen, H.; Hummel, B.D.; Watts, J.L.; Håkansson, J.; Hansen, P.R.; Svenson, J. Correlation between Hemolytic Activity, Cytotoxicity and Systemic in Vivo Toxicity of Synthetic Antimicrobial Peptides. Sci. Rep. 2020, 10, 13206. [Google Scholar] [CrossRef]
- Liu, S.; Zhou, L.; Li, J.; Suresh, A.; Verma, C.; Foo, Y.H.; Yap, E.P.H.; Tan, D.T.H.; Beuerman, R.W. Linear Analogues of Human β-Defensin 3: Concepts for Design of Antimicrobial Peptides with Reduced Cytotoxicity to Mammalian Cells. ChemBioChem 2008, 9, 964–973. [Google Scholar] [CrossRef] [PubMed]
- Ilker, M.F.; Nüsslein, K.; Tew, G.N.; Coughlin, E.B. Tuning the Hemolytic and Antibacterial Activities of Amphiphilic Polynorbornene Derivatives. J. Am. Chem. Soc. 2004, 126, 15870–15875. [Google Scholar] [CrossRef] [PubMed]
- Shai, Y. Mechanism of the Binding, Insertion and Destabilization of Phospholipid Bilayer Membranes by α-Helical Antimicrobial and Cell Non-Selective Membrane-Lytic Peptides. Biochim. Biophys. Acta (BBA) Biomembr. 1999, 1462, 55–70. [Google Scholar] [CrossRef]
- Maturana, P.; Martinez, M.; Noguera, M.E.; Santos, N.C.; Disalvo, E.A.; Semorile, L.; Maffia, P.C.; Hollmann, A. Lipid Selectivity in Novel Antimicrobial Peptides: Implication on Antimicrobial and Hemolytic Activity. Colloids Surf. B Biointerfaces 2017, 153, 152–159. [Google Scholar] [CrossRef] [PubMed]
- Manzini, M.C.; Perez, K.R.; Riske, K.A.; Bozelli, J.C.; Santos, T.L.; Da Silva, M.A.; Saraiva, G.K.V.; Politi, M.J.; Valente, A.P.; Almeida, F.C.L.; et al. Peptide:Lipid Ratio and Membrane Surface Charge Determine the Mechanism of Action of the Antimicrobial Peptide BP100. Conformational and Functional Studies. Biochim. Biophys. Acta (BBA) Biomembr. 2014, 1838, 1985–1999. [Google Scholar] [CrossRef] [PubMed]
- Malanovic, N.; Leber, R.; Schmuck, M.; Kriechbaum, M.; Cordfunke, R.A.; Drijfhout, J.W.; De Breij, A.; Nibbering, P.H.; Kolb, D.; Lohner, K. Phospholipid-Driven Differences Determine the Action of the Synthetic Antimicrobial Peptide OP-145 on Gram-Positive Bacterial and Mammalian Membrane Model Systems. Biochim. Biophys. Acta (BBA) Biomembr. 2015, 1848, 2437–2447. [Google Scholar] [CrossRef] [PubMed]
- Belokoneva, O.S.; Villegas, E.; Corzo, G.; Dai, L.; Nakajima, T. The Hemolytic Activity of Six Arachnid Cationic Peptides Is Affected by the Phosphatidylcholine-to-Sphingomyelin Ratio in Lipid Bilayers. Biochim. Biophys. Acta (BBA) Biomembr. 2003, 1617, 22–30. [Google Scholar] [CrossRef]
- Virtanen, J.A.; Cheng, K.H.; Somerharju, P. Phospholipid Composition of the Mammalian Red Cell Membrane Can Be Rationalized by a Superlattice Model. Proc. Natl. Acad. Sci. USA 1998, 95, 4964. [Google Scholar] [CrossRef]
- Reynolds, N.L.; De Cecco, M.; Taylor, K.; Stanton, C.; Kilanowski, F.; Kalapothakis, J.; Seo, E.; Uhrin, D.; Campopiano, D.; Govan, J.; et al. Peptide Fragments of a β-Defensin Derivative with Potent Bactericidal Activity. Antimicrob. Agents Chemother. 2010, 54, 1922. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).