Antimicrobial Peptides: A Promising Solution to the Rising Threat of Antibiotic Resistance
Abstract
:1. Introduction
2. Sources of Antimicrobial Peptides (AMPs)
2.1. Natural Sources of AMPs
2.2. Synthetic AMPs
3. Classification of Antimicrobial Peptides (AMPs) Based on Antimicrobial Activity
3.1. Antibacterial AMPs
3.2. Antifungal Peptides (AFPs)
3.3. Antiviral Peptides
3.4. Antiparasitic Peptides
4. Mechanisms of Action of Antimicrobial Peptides (AMPs)
5. Importance of Peptide Antibiotics
5.1. Significance of Peptide Antibiotics in Microbial Host
5.2. Clinical Importance
6. Complications of Using Antimicrobial Peptides (AMPs) in Therapeutic Uses
7. Designed Antimicrobial Peptides (AMPs) for Enhanced Efficacy
7.1. Structural Modification for Enhanced Performance
7.2. AMPs with Lipid Nanomaterials
7.3. Combination of AMPs
7.4. Combination of AMPs with Antibiotics or Chemicals
7.5. Genetic Modification
7.6. Computational Approach
8. Conclusions
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Debnath, T.; Bhowmik, S.; Islam, T.; Chowdhury, M.M.H. Presence of Multidrug-Resistant Bacteria on Mobile Phones of Healthcare Workers Accelerates the Spread of Nosocomial Infection and Regarded as a Threat to Public Health in Bangladesh. J. Microsc. Ultrastruct. 2018, 6, 165. [Google Scholar] [CrossRef]
- Islam, T.; Kubra, K.; Chowdhury, M.M.H. Prevalence of Methicillin-Resistant Staphylococcus aureus in Hospitals in Chittagong, Bangladesh: A Threat of Nosocomial Infection. J. Microsc. Ultrastruct. 2018, 6, 188. [Google Scholar] [CrossRef]
- Sagor, M.S.; Hossain, M.S.; Islam, T.; Mahmud, M.A.; Miah, M.S.; Karim, M.R.; Giasuddin, M.; Samad, M.A. Phenotypic and Genotypic Antibiotic Resistance and Virulence Profiling of Enterococcus faecalis Isolated from Poultry at Two Major Districts in Bangladesh. Pak. Vet. J. 2022, 42, 153–160. [Google Scholar]
- Sultana, A.; Saha, O.; Rahman Sid, A.; Saha, A.; Hussain, M.S.; Islam, T. Molecular Detection of Multidrug Resistance Pathogenic Bacteria from Protective Materials Used By Healthcare Workers (HCW); Bangladesh Scenario. J. Appl. Sci. 2018, 18, 48–55. [Google Scholar] [CrossRef]
- Islam, T.; Saha, O.; Sultana, S.; Hridoy, M.; Hasan, M.; Marzan, S.; Musfiqur Rahman, M. Comparison between Reduced Susceptibility to Disinfectants and Multidrug Resistance among Hospital Isolates of Pseudomonas aeruginosa and Staphylococcus aureus in Bangladesh. Bagcilar Med. Bull. 2017, 2, 88–97. [Google Scholar] [CrossRef]
- Islam, T.; Haque, M.A.; Barai, H.R.; Istiaq, A.; Kim, J.-J. Antibiotic Resistance in Plant Pathogenic Bacteria: Recent Data and Environmental Impact of Unchecked Use and the Potential of Biocontrol Agents as an Eco-Friendly Alternative. Plants 2024, 13, 1135. [Google Scholar] [CrossRef]
- Chinemerem Nwobodo, D.; Ugwu, M.C.; Oliseloke Anie, C.; Al-Ouqaili, M.T.S.; Chinedu Ikem, J.; Victor Chigozie, U.; Saki, M. Antibiotic Resistance: The Challenges and Some Emerging Strategies for Tackling a Global Menace. J. Clin. Lab. Anal. 2022, 36, e24655. [Google Scholar] [CrossRef]
- Yue, L.; Song, L.; Zhu, S.; Fu, X.; Li, X.; He, C.; Li, J. Machine Learning Assisted Rational Design of Antimicrobial Peptides Based on Human Endogenous Proteins and Their Applications for Cosmetic Preservative System Optimization. Sci. Rep. 2024, 14, 947. [Google Scholar] [CrossRef]
- Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef]
- Chen, N.; Jiang, C. Antimicrobial Peptides: Structure, Mechanism, and Modification. Eur. J. Med. Chem. 2023, 255, 115377. [Google Scholar] [CrossRef]
- Benfield, A.H.; Henriques, S.T. Mode-of-Action of Antimicrobial Peptides: Membrane Disruption vs. Intracellular Mechanisms. Front. Med. Technol. 2020, 2, 610997. [Google Scholar] [CrossRef]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility in Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef]
- Zharkova, M.S.; Orlov, D.S.; Golubeva, O.Y.; Chakchir, O.B.; Eliseev, I.E.; Grinchuk, T.M.; Shamova, O.V. Application of Antimicrobial Peptides of the Innate Immune System in Combination with Conventional Antibiotics-a Novel Way to Combat Antibiotic Resistance? Front. Cell. Infect. Microbiol. 2019, 9, 128. [Google Scholar] [CrossRef]
- Haney, E.F.; Mansour, S.C.; Hancock, R.E.W. Antimicrobial Peptides: An Introduction. Methods Mol. Biol. 2017, 1548, 3–22. [Google Scholar] [CrossRef]
- Knappe, D.; Kabankov, N.; Herth, N.; Hoffmann, R. Insect-Derived Short Proline-Rich and Murine Cathelicidin-Related Antimicrobial Peptides Act Synergistically on Gram-Negative Bacteria in Vitro. Future Med. Chem. 2016, 8, 1035–1045. [Google Scholar] [CrossRef]
- Chou, T.C. Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies. Pharmacol. Rev. 2006, 58, 621–681. [Google Scholar] [CrossRef]
- Lee, Y.C.J.; Shirkey, J.D.; Park, J.; Bisht, K.; Cowan, A.J. An Overview of Antiviral Peptides and Rational Biodesign Considerations. Biodesign Res. 2022, 2022, 98982. [Google Scholar] [CrossRef]
- Cheng, Q.; Zeng, P. Hydrophobic-Hydrophilic Alternation: An Effective Pattern to de Novo Designed Antimicrobial Peptides. Curr. Pharm. Des. 2022, 28, 3527–3537. [Google Scholar] [CrossRef]
- Mwangi, J.; Kamau, P.M.; Thuku, R.C.; Lai, R. Design Methods for Antimicrobial Peptides with Improved Performance. Zool. Res. 2023, 44, 1095. [Google Scholar] [CrossRef]
- Diamond, G.; Beckloff, N.; Weinberg, A.; Kisich, K.O. The Roles of Antimicrobial Peptides in Innate Host Defense. Curr. Pharm. Des. 2009, 15, 2377. [Google Scholar] [CrossRef]
- Havlíček, V.; Spížek, J. Natural Products Analysis. In Natural Products Analysis: Instrumentation, Methods, and Applications; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2014; Volume 9781118466612, pp. 1–8. [Google Scholar] [CrossRef]
- Rahman, M.; Wadud, M.; Islam, T.; Hussain, M.; Bristy, E.; Tuhin, A. Evaluation of Antibacterial Activity of Piper Betel Leaves and Nigella sativa Seeds against Multidrug Resistant Food and Water Borne Pathogenic Bacteria: An in Vitro Study Model. Microbiol. Res. J. Int. 2018, 22, 1–11. [Google Scholar] [CrossRef]
- Shalahuddin Millat, M.; Islam, S.; Hussain, M.S.; Rahman Moghal, M.M.; Islam, T. Anti-Bacterial Profiling of Launaea sarmentosa (Willd.) and Bruguiera cylindrical (L.): Two Distinct Ethno Medicinal Plants of Bangladesh. Eur. J. Exp. Biol. 2017, 7, 6. [Google Scholar] [CrossRef]
- Uddin, S.J.; Shilpi, J.A.; Nahar, L.; Sarker, S.D.; Göransson, U. Editorial: Natural Antimicrobial Peptides: Hope for New Antibiotic Lead Molecules. Front. Pharmacol. 2021, 12, 640938. [Google Scholar] [CrossRef]
- Kalsy, M.; Tonk, M.; Hardt, M.; Dobrindt, U.; Zdybicka-Barabas, A.; Cytrynska, M.; Vilcinskas, A.; Mukherjee, K. The Insect Antimicrobial Peptide Cecropin A Disrupts Uropathogenic Escherichia coli Biofilms. npj Biofilms Microbiomes 2020, 6, 6. [Google Scholar] [CrossRef]
- Ye, J.S.; Zheng, X.J.; Leung, K.W.; Chen, H.M.; Sheu, F.S. Induction of Transient Ion Channel-like Pores in a Cancer Cell by Antibiotic Peptide. J. Biochem. 2004, 136, 255–259. [Google Scholar] [CrossRef]
- Moore, A.J.; Devine, D.A.; Bibby, M.C. Preliminary Experimental Anticancer Activity of Cecropins. Pept. Res. 1994, 7, 265–269. [Google Scholar]
- Ocampo-Ibáñez, I.D.; Liscano, Y.; Rivera-Sánchez, S.P.; Oñate-Garzón, J.; Lugo-Guevara, A.D.; Flórez-Elvira, L.J.; Lesmes, M.C. A Novel Cecropin D-Derived Short Cationic Antimicrobial Peptide Exhibits Antibacterial Activity Against Wild-Type and Multidrug-Resistant Strains of Klebsiella pneumoniae and Pseudomonas aeruginosa. Evol. Bioinforma. 2020, 16, 1176934320936266. [Google Scholar] [CrossRef]
- Kim, J.K.; Lee, E.; Shin, S.; Jeong, K.W.; Lee, J.Y.; Bae, S.Y.; Kim, S.H.; Lee, J.; Kim, S.R.; Lee, D.G.; et al. Structure and Function of Papiliocin with Antimicrobial and Anti-Inflammatory Activities Isolated from the Swallowtail Butterfly, Papilio xuthus. J. Biol. Chem. 2011, 286, 41296–41311. [Google Scholar] [CrossRef]
- Lee, E.; Kim, J.K.; Jeon, D.; Jeong, K.W.; Shin, A.; Kim, Y. Functional Roles of Aromatic Residues and Helices of Papiliocin in Its Antimicrobial and Anti-Inflammatory Activities. Sci. Rep. 2015, 5, 12048. [Google Scholar] [CrossRef]
- Achanta, M.; Sunkara, L.T.; Dai, G.; Bommineni, Y.R.; Jiang, W.; Zhang, G. Tissue Expression and Developmental Regulation of Chicken Cathelicidin Antimicrobial Peptides. J. Anim. Sci. Biotechnol. 2012, 3, 15. [Google Scholar] [CrossRef]
- Zanetti, M. Cathelicidins, Multifunctional Peptides of the Innate Immunity. J. Leukoc. Biol. 2004, 75, 39–48. [Google Scholar] [CrossRef] [PubMed]
- Hao, X.; Yang, H.; Wei, L.; Yang, S.; Zhu, W.; Ma, D.; Yu, H.; Lai, R. Amphibian Cathelicidin Fills the Evolutionary Gap of Cathelicidin in Vertebrate. Amino Acids 2012, 43, 677–685. [Google Scholar] [CrossRef] [PubMed]
- Mani, R.; Tang, M.; Wu, X.; Buffy, J.J.; Waring, A.J.; Sherman, M.A.; Hong, M. Membrane-Bound Dimer Structure of a β-Hairpin Antimicrobial Peptide from Rotational-Echo Double-Resonance Solid-State NMR. Biochemistry 2006, 45, 8341–8349. [Google Scholar] [CrossRef] [PubMed]
- Shafee, T.; Anderson, M.A. A Quantitative Map of Protein Sequence Space for the Cis-Defensin Superfamily. Bioinformatics 2019, 35, 743–752. [Google Scholar] [CrossRef]
- Varkey, J.; Nagaraj, R. Antibacterial Activity of Human Neutrophil Defensin HNP-1 Analogs without Cysteines. Antimicrob. Agents Chemother. 2005, 49, 4561–4566. [Google Scholar] [CrossRef]
- Jenssen, H.; Hamill, P.; Hancock, R.E.W. Peptide Antimicrobial Agents. Clin. Microbiol. Rev. 2006, 19, 491–511. [Google Scholar] [CrossRef]
- Amerikova, M.; Pencheva El-Tibi, I.; Maslarska, V.; Bozhanov, S.; Tachkov, K. Antimicrobial Activity, Mechanism of Action, and Methods for Stabilisation of Defensins as New Therapeutic Agents. Biotechnol. Biotechnol. Equip. 2019, 33, 671–682. [Google Scholar] [CrossRef]
- Michael Conlon, J.; Mechkarska, M.; King, J.D. Host-Defense Peptides in Skin Secretions of African Clawed Frogs (Xenopodinae, Pipidae). Gen. Comp. Endocrinol. 2012, 176, 513–518. [Google Scholar] [CrossRef]
- Tong, Z.; Ni, L.; Ling, J. Antibacterial Peptide Nisin: A Potential Role in the Inhibition of Oral Pathogenic Bacteria. Peptides 2014, 60, 32–40. [Google Scholar] [CrossRef]
- Mishra, A.K.; Choi, J.; Moon, E.; Baek, K.H. Tryptophan-Rich and Proline-Rich Antimicrobial Peptides. Molecules 2018, 23, 815. [Google Scholar] [CrossRef]
- Higgins, D.L.; Chang, R.; Debabov, D.V.; Leung, J.; Wu, T.; Krause, K.M.; Sandvik, E.; Hubbard, J.M.; Kaniga, K.; Schmidt, D.E.; et al. Telavancin, a Multifunctional Lipoglycopeptide, Disrupts Both Cell Wall Synthesis and Cell Membrane Integrity in Methicillin-Resistant Staphylococcus aureus. Antimicrob. Agents Chemother. 2005, 49, 1127–1134. [Google Scholar] [CrossRef] [PubMed]
- Berditsch, M.; Trapp, M.; Afonin, S.; Weber, C.; Misiewicz, J.; Turkson, J.; Ulrich, A.S. Antimicrobial Peptide Gramicidin S Is Accumulated in Granules of Producer Cells for Storage of Bacterial Phosphagens. Sci. Rep. 2017, 7, 44324. [Google Scholar] [CrossRef] [PubMed]
- O’Donnell, J.A.; Gelone, S.P.; Safdar, A. Topical Antibacterials. In Mandell, Douglas, and Bennett’s Principles and Practice of Infectious Diseases; Elsevier Inc.: Amsterdam, The Netherlands, 2014; Volume 1, pp. 452–462. ISBN 9996096742. [Google Scholar]
- Wenzel, M.; Rautenbach, M.; Vosloo, J.A.; Siersma, T.; Aisenbrey, C.H.M.; Zaitseva, E.; Laubscher, W.E.; van Rensburg, W.; Behrends, J.C.; Bechinger, B.; et al. The Multifaceted Antibacterial Mechanisms of the Pioneering Peptide Antibiotics Tyrocidine and Gramicidin S. MBio 2018, 9, 10–1128. [Google Scholar] [CrossRef] [PubMed]
- Khondker, A.; Dhaliwal, A.K.; Saem, S.; Mahmood, A.; Fradin, C.; Moran-Mirabal, J.; Rheinstädter, M.C. Membrane Charge and Lipid Packing Determine Polymyxin-Induced Membrane Damage. Commun. Biol. 2019, 2, 67. [Google Scholar] [CrossRef] [PubMed]
- Fazle Rabbee, M.; Baek, K.H. Antimicrobial Activities of Lipopeptides and Polyketides of Bacillus velezensis for Agricultural Applications. Molecules 2020, 25, 4973. [Google Scholar] [CrossRef]
- Kenig, M.; Vandamme, E.; Abraham, E.P. The Mode of Action of Bacilysin and Anticapsin and Biochemical Properties of Bacilysin Resistant Mutants. J. Gen. Microbiol. 1976, 94, 46–54. [Google Scholar] [CrossRef]
- Neelabh; Singh, K.; Rani, J. Sequential and Structural Aspects of Antifungal Peptides from Animals, Bacteria and Fungi Based on Bioinformatics Tools. Probiotics Antimicrob. Proteins 2016, 8, 85–101. [Google Scholar] [CrossRef]
- Zhang, L.; Takemoto, J.Y. Syringomycin Stimulation of Potassium Efflux by Yeast Cells. Biochim. Et Biophys. Acta (BBA)-Biomembr. 1989, 987, 171–175. [Google Scholar] [CrossRef]
- Christina, A.; Christapher, V.; Bhore, S. Endophytic Bacteria as a Source of Novel Antibiotics: An Overview. Pharmacogn. Rev. 2013, 7, 11–16. [Google Scholar]
- Pogliano, J.; Pogliano, N.; Silverman, J.A. Daptomycin-Mediated Reorganization of Membrane Architecture Causes Mislocalization of Essential Cell Division Proteins. J. Bacteriol. 2012, 194, 4494–4504. [Google Scholar] [CrossRef]
- Lautru, S.; Gondry, M.; Genet, R.; Pernodet, J.L. The Albonoursin Gene Cluster of S. Noursei: Biosynthesis of Diketopiperazine Metabolites Independent of Nonribosomal Peptide Synthetases. Chem. Biol. 2002, 9, 1355–1364. [Google Scholar] [CrossRef] [PubMed]
- Taylor, S.D.; Palmer, M. The Action Mechanism of Daptomycin. Bioorganic Med. Chem. 2016, 24, 6253–6268. [Google Scholar] [CrossRef] [PubMed]
- Castillo, U.; Harper, J.K.; Strobel, G.A.; Sears, J.; Alesi, K.; Ford, E.; Lin, J.; Hunter, M.; Maranta, M.; Ge, H.; et al. Kakadumycins, Novel Antibiotics from Streptomyces sp. NRRL 30566, an Endophyte of Grevillea pteridifolia. FEMS Microbiol. Lett. 2003, 224, 183–190. [Google Scholar] [CrossRef] [PubMed]
- Pfaffenbach, M.; Bakanas, I.; O’Connor, N.R.; Herrick, J.L.; Sarpong, R. Total Syntheses of Xiamycins A, C, F, H and Oridamycin A and Preliminary Evaluation of Their Anti-Fungal Properties. Angew. Chemie 2019, 131, 15448–15452. [Google Scholar] [CrossRef]
- Essig, A.; Hofmann, D.; Münch, D.; Gayathri, S.; Künzler, M.; Kallio, P.T.; Sahl, H.G.; Wider, G.; Schneider, T.; Aebi, M. Copsin, a Novel Peptide-Based Fungal Antibiotic Interfering with the Peptidoglycan Synthesis. J. Biol. Chem. 2014, 289, 34953–34964. [Google Scholar] [CrossRef]
- de la Fuente-Núñez, C.; Whitmore, L.; Wallace, B.A. Peptaibols. In Handbook of Biologically Active Peptides; Elsevier Inc.: Amsterdam, The Netherlands, 2013; pp. 150–156. ISBN 9780123850959. [Google Scholar]
- Schneider, T.; Kruse, T.; Wimmer, R.; Wiedemann, I.; Sass, V.; Pag, U.; Jansen, A.; Nielsen, A.K.; Mygind, P.H.; Raventós, D.S.; et al. Plectasin, a Fungal Defensin, Targets the Bacterial Cell Wall Precursor Lipid II. Science 2010, 328, 1168–1172. [Google Scholar] [CrossRef]
- Vardanyan, R.; Hruby, V. Antifungal Drugs. In Synthesis of Best-Seller Drugs; Elsevier: Amsterdam, The Netherlands, 2016; pp. 677–686. [Google Scholar]
- Matejuk, A.; Leng, Q.; Begum, M.D.; Woodle, M.C.; Scaria, P.; Chou, S.T.; Mixson, A.J. Peptide-Based Antifungal Therapies against Emerging Infections. Drugs Future 2010, 35, 197–217. [Google Scholar] [CrossRef]
- Notomista, E.; Falanga, A.; Fusco, S.; Pirone, L.; Zanfardino, A.; Galdiero, S.; Varcamonti, M.; Pedone, E.; Contursi, P. The Identification of a Novel Sulfolobus Islandicus CAMP-like Peptide Points to Archaeal Microorganisms as Cell Factories for the Production of Antimicrobial Molecules. Microb. Cell Fact. 2015, 14, 126. [Google Scholar] [CrossRef]
- Cândido, E.S.; Cardoso, M.H.; Chan, L.Y.; Torres, M.D.T.; Oshiro, K.G.N.; Porto, W.F.; Ribeiro, S.M.; Haney, E.F.; Hancock, R.E.W.; Lu, T.K.; et al. Short Cationic Peptide Derived from Archaea with Dual Antibacterial Properties and Anti-Infective Potential. ACS Infect. Dis. 2019, 5, 1081–1086. [Google Scholar] [CrossRef]
- Miranda, G.; Bianchi, L.; Krupova, Z.; Trossat, P.; Martin, P. An Improved LC–MS Method to Profile Molecular Diversity and Quantify the Six Main Bovine Milk Proteins, Including Genetic and Splicing Variants as Well as Post-Translationally Modified Isoforms. Food Chem. X 2020, 5, 100080. [Google Scholar] [CrossRef]
- Lin, L.; Mao, X.; Sun, Y.; Cui, H. Antibacterial Mechanism of Artemisinin / Beta-Cyclodextrins against Methicillin-Resistant Staphylococcus aureus (MRSA). Microb. Pathog. 2018, 118, 66–73. [Google Scholar] [CrossRef] [PubMed]
- Atalay, M.; Şahingil, D. Characterization of Antimicrobial Peptide Fraction Producing Lactobacillus spp. Based on LC/MS-MS and Determination of ACE-Inhibitory Activity in Kefir. J. Agric. Sci. 2022, 28, 372–384. [Google Scholar] [CrossRef]
- Minkiewicz, P.; Iwaniak, A.; Darewicz, M. BIOPEP-UWM Database of Bioactive Peptides: Current Opportunities. Int. J. Mol. Sci. 2019, 20, 5978. [Google Scholar] [CrossRef] [PubMed]
- Singh, A.; Duche, R.T.; Wandhare, A.G.; Sian, J.K.; Singh, B.P.; Sihag, M.K.; Singh, K.S.; Sangwan, V.; Talan, S.; Panwar, H. Milk-Derived Antimicrobial Peptides: Overview, Applications, and Future Perspectives. Probiotics Antimicrob. Proteins 2022, 15, 44–62. [Google Scholar] [CrossRef]
- Boto, A.; De La Lastra, J.M.P.; González, C.C. The Road from Host-Defense Peptides to a New Generation of Antimicrobial Drugs. Molecules 2018, 23, 311. [Google Scholar] [CrossRef]
- Lima, P.G.; Oliveira, J.T.A.; Amaral, J.L.; Freitas, C.D.T.; Souza, P.F.N. Synthetic Antimicrobial Peptides: Characteristics, Design, and Potential as Alternative Molecules to Overcome Microbial Resistance. Life Sci. 2021, 278, 119647. [Google Scholar] [CrossRef]
- Souza, P.F.N.; Marques, L.S.M.; Oliveira, J.T.A.; Lima, P.G.; Dias, L.P.; Neto, N.A.S.; Lopes, F.E.S.; Sousa, J.S.; Silva, A.F.B.; Caneiro, R.F.; et al. Synthetic Antimicrobial Peptides: From Choice of the Best Sequences to Action Mechanisms. Biochimie 2020, 175, 132–145. [Google Scholar] [CrossRef]
- Ong, Z.Y.; Wiradharma, N.; Yang, Y.Y. Strategies Employed in the Design and Optimization of Synthetic Antimicrobial Peptide Amphiphiles with Enhanced Therapeutic Potentials. Adv. Drug Deliv. Rev. 2014, 78, 28–45. [Google Scholar] [CrossRef]
- Cardoso, P.; Glossop, H.; Meikle, T.G.; Aburto-Medina, A.; Conn, C.E.; Sarojini, V.; Valery, C. Molecular Engineering of Antimicrobial Peptides: Microbial Targets, Peptide Motifs and Translation Opportunities. Biophys. Rev. 2021, 13, 35–69. [Google Scholar] [CrossRef]
- Almaaytah, A.; Zhou, M.; Wang, L.; Chen, T.; Walker, B.; Shaw, C. Antimicrobial/Cytolytic Peptides from the Venom of the North African Scorpion, Androctonus amoreuxi: Biochemical and Functional Characterization of Natural Peptides and a Single Site-Substituted Analog. Peptides 2012, 35, 291–299. [Google Scholar] [CrossRef]
- Almaaytah, A.; Tarazi, S.; Abu-Alhaijaa, A.; Altall, Y.; Alshar’i, N.; Bodoor, K.; Al-Balas, Q. Enhanced Antimicrobial Activity of AamAP1-Lysine, a Novel Synthetic Peptide Analog Derived from the Scorpion Venom Peptide AamAP1. Pharmaceuticals 2014, 7, 502–516. [Google Scholar] [CrossRef] [PubMed]
- Li, C.; Zhu, C.; Ren, B.; Yin, X.; Shim, S.H.; Gao, Y.; Zhu, J.; Zhao, P.; Liu, C.; Yu, R.; et al. Two Optimized Antimicrobial Peptides with Therapeutic Potential for Clinical Antibiotic-Resistant Staphylococcus aureus. Eur. J. Med. Chem. 2019, 183, 111686. [Google Scholar] [CrossRef] [PubMed]
- Islam, T.; Rabbee, M.F.; Choi, J.; Baek, K.H. Biosynthesis, Molecular Regulation, and Application of Bacilysin Produced by Bacillus Species. Metabolites 2022, 12, 397. [Google Scholar] [CrossRef] [PubMed]
- Islam, T.; Danishuddin; Tamanna, N.T.; Matin, M.N.; Barai, H.R.; Haque, M.A. Resistance Mechanisms of Plant Pathogenic Fungi to Fungicide, Environmental Impacts of Fungicides, and Sustainable Solutions. Plants 2024, 13, 2737. [Google Scholar] [CrossRef]
- Shin, M.K.; Hwang, I.W.; Jang, B.Y.; Bu, K.B.; Han, D.H.; Lee, S.H.; Oh, J.W.; Yoo, J.S.; Sung, J.S. The Identification of a Novel Spider Toxin Peptide, Lycotoxin-Pa2a, with Antibacterial and Anti-Inflammatory Activities. Antibiotics 2023, 12, 1708. [Google Scholar] [CrossRef]
- Ramata-Stunda, A.; Boroduskis, M.; Kaktina, E.; Patetko, L.; Kalnenieks, U.; Lasa, Z.; Rubina, M.; Strazdina, I.; Kalnins, G.; Rutkis, R. Comparative Evaluation of Existing and Rationally Designed Novel Antimicrobial Peptides for Treatment of Skin and Soft Tissue Infections. Antibiotics 2023, 12, 551. [Google Scholar] [CrossRef]
- Rajapaksha, D.C.; Edirisinghe, S.L.; Nikapitiya, C.; Whang, I.; De Zoysa, M. The Antimicrobial Peptide Octopromycin Suppresses Biofilm Formation and Quorum Sensing in Acinetobacter baumannii. Antibiotics 2023, 12, 623. [Google Scholar] [CrossRef]
- Rajapaksha, D.C.; Jayathilaka, E.H.T.T.; Edirisinghe, S.L.; Nikapitiya, C.; Lee, J.; Whang, I.; De Zoysa, M. Octopromycin: Antibacterial and Antibiofilm Functions of a Novel Peptide Derived from Octopus Minor against Multidrug-Resistant Acinetobacter baumannii. Fish Shellfish. Immunol. 2021, 117, 82–94. [Google Scholar] [CrossRef]
- García-Vela, S.; Guay, L.D.; Rahman, M.R.T.; Biron, E.; Torres, C.; Fliss, I. Antimicrobial Activity of Synthetic Enterocins A, B, P, SEK4, and L50, Alone and in Combinations, against Clostridium perfringens. Int. J. Mol. Sci. 2024, 25, 1597. [Google Scholar] [CrossRef]
- Madanchi, H.; Shoushtari, M.; Kashani, H.H.; Sardari, S. Antimicrobial Peptides of the Vaginal Innate Immunity and Their Role in the Fight against Sexually Transmitted Diseases. New Microbes New Infect. 2020, 34, 100627. [Google Scholar] [CrossRef]
- Muhialdin, B.J.; Algboory, H.L.; Kadum, H.; Mohammed, N.K.; Saari, N.; Hassan, Z.; Meor Hussin, A.S. Antifungal Activity Determination for the Peptides Generated by Lactobacillus plantarum TE10 against Aspergillus flavus in Maize Seeds. Food Control 2020, 109, 106898. [Google Scholar] [CrossRef]
- Shwaiki, L.N.; Arendt, E.K.; Lynch, K.M. Anti-Yeast Activity and Characterisation of Synthetic Radish Peptides Rs-AFP1 and Rs-AFP2 against Food Spoilage Yeast. Food Control 2020, 113, 107178. [Google Scholar] [CrossRef]
- Carvajal, S.K.; Vargas-Casanova, Y.; Pineda-Castañeda, H.M.; García-Castañeda, J.E.; Rivera-Monroy, Z.J.; Parra-Giraldo, C.M. In Vitro Antifungal Activity of Chimeric Peptides Derived from Bovine Lactoferricin and Buforin II against Cryptococcus neoformans Var. Grubii. Antibiotics 2022, 11, 1819. [Google Scholar] [CrossRef] [PubMed]
- Aguirre-Guataqui, K.; Márquez-Torres, M.; Pineda-Castañeda, H.M.; Vargas-Casanova, Y.; Ceballos-Garzon, A.; Rivera-Monroy, Z.J.; García-Castañeda, J.E.; Parra-Giraldo, C.M. Chimeric Peptides Derived from Bovine Lactoferricin and Buforin II: Antifungal Activity against Reference Strains and Clinical Isolates of Candida spp. Antibiotics 2022, 11, 1561. [Google Scholar] [CrossRef] [PubMed]
- Hernández-Martínez, M.A.; Suárez-Rodríguez, L.M.; López-Meza, J.E.; Ochoa-Zarzosa, A.; Salgado-Garciglia, R.; Fernández-Pavia, S.P.; López-Gómez, R. Antifungal Activity of Avocado Seed Recombinant GASA/Snakin PaSn. Antibiotics 2022, 11, 1558. [Google Scholar] [CrossRef]
- Ashkenazi, A.; Wexler-Cohen, Y.; Shai, Y. Multifaceted Action of Fuzeon as Virus–Cell Membrane Fusion Inhibitor. Biochim. Biophys. Acta-Biomembr. 2011, 1808, 2352–2358. [Google Scholar] [CrossRef]
- Huang, H.N.; Pan, C.Y.; Chen, J.Y. Grouper (Epinephelus coioides) Antimicrobial Peptide Epinecidin-1 Exhibits Antiviral Activity against Foot-and-Mouth Disease Virus in Vitro. Peptides 2018, 106, 91–95. [Google Scholar] [CrossRef]
- Xu, H.; Zhu, S.; Govinden, R.; Chenia, H.Y. Multiple Vaccines and Strategies for Pandemic Preparedness of Avian Influenza Virus. Viruses 2023, 15, 1694. [Google Scholar] [CrossRef]
- Jung, Y.; Kong, B.; Moon, S.; Yu, S.H.; Chung, J.; Ban, C.; Chung, W.J.; Kim, S.G.; Kweon, D.H. Envelope-Deforming Antiviral Peptide Derived from Influenza Virus M2 Protein. Biochem. Biophys. Res. Commun. 2019, 517, 507–512. [Google Scholar] [CrossRef]
- Sun, Q.; Wang, K.; She, R.; Ma, W.; Peng, F.; Jin, H. Swine Intestine Antimicrobial Peptides Inhibit Infectious Bronchitis Virus Infectivity in Chick Embryos. Poult. Sci. 2019, 89, 464. [Google Scholar] [CrossRef]
- Wohlford-Lenane, C.L.; Meyerholz, D.K.; Perlman, S.; Zhou, H.; Tran, D.; Selsted, M.E.; McCray, P.B. Rhesus Theta-Defensin Prevents Death in a Mouse Model of Severe Acute Respiratory Syndrome Coronavirus Pulmonary Disease. J. Virol. 2009, 83, 11385–11390. [Google Scholar] [CrossRef] [PubMed]
- Rhaiem, R.B.; Houimel, M. Targeting Leishmania major Parasite with Peptides Derived from a Combinatorial Phage Display Library. Acta Trop. 2016, 159, 11–19. [Google Scholar] [CrossRef] [PubMed]
- Mangoni, M.L.; Saugar, J.M.; Dellisanti, M.; Barra, D.; Simmaco, M.; Rivas, L. Temporins, Small Antimicrobial Peptides with Leishmanicidal Activity. J. Biol. Chem. 2005, 280, 984–990. [Google Scholar] [CrossRef] [PubMed]
- Abbassi, F.; Raja, Z.; Oury, B.; Gazanion, E.; Piesse, C.; Sereno, D.; Nicolas, P.; Foulon, T.; Ladram, A. Antibacterial and Leishmanicidal Activities of Temporin-SHd, a 17-Residue Long Membrane-Damaging Peptide. Biochimie 2013, 95, 388–399. [Google Scholar] [CrossRef]
- Neshani, A.; Zare, H.; Akbari Eidgahi, M.R.; Khaledi, A.; Ghazvini, K. Epinecidin-1, a Highly Potent Marine Antimicrobial Peptide with Anticancer and Immunomodulatory Activities. BMC Pharmacol. Toxicol. 2019, 20, 33. [Google Scholar] [CrossRef]
- Cao, L.; Jiang, W.; Cao, S.; Zhao, P.; Liu, J.; Dong, H.; Guo, Y.; Liu, Q.; Gong, P. In Vitro Leishmanicidal Activity of Antimicrobial Peptide KDEL against Leishmania tarentolae. Acta Biochim. Biophys. Sin. 2019, 51, 1286–1292. [Google Scholar] [CrossRef]
- Zahedifard, F.; Lee, H.; No, J.H.; Salimi, M.; Seyed, N.; Asoodeh, A.; Rafati, S. Comparative Study of Different Forms of Jellein Antimicrobial Peptide on Leishmania parasite. Exp. Parasitol. 2020, 209, 107823. [Google Scholar] [CrossRef]
- Pitale, D.M.; Kaur, G.; Baghel, M.; Kaur, K.J.; Shaha, C. Halictine-2 Antimicrobial Peptide Shows Promising Anti-Parasitic Activity against Leishmania spp. Exp. Parasitol. 2020, 218, 107987. [Google Scholar] [CrossRef]
- Fang, Y.; He, X.; Zhang, P.; Shen, C.; Mwangi, J.; Xu, C.; Mo, G.; Lai, R.; Zhang, Z. In Vitro and In Vivo Antimalarial Activity of LZ1, a Peptide Derived from Snake Cathelicidin. Toxins 2019, 11, 379. [Google Scholar] [CrossRef]
- Rivas, L.; Rojas, V. Cyanobacterial Peptides as a Tour de Force in the Chemical Space of Antiparasitic Agents. Arch. Biochem. Biophys. 2019, 664, 24–39. [Google Scholar] [CrossRef]
- Lopes, B.S.; Hanafiah, A.; Nachimuthu, R.; Muthupandian, S.; Md Nesran, Z.N.; Patil, S. The Role of Antimicrobial Peptides as Antimicrobial and Antibiofilm Agents in Tackling the Silent Pandemic of Antimicrobial Resistance. Molecules 2022, 27, 2995. [Google Scholar] [CrossRef] [PubMed]
- Yeaman, M.R.; Yount, N.Y. Mechanisms of Antimicrobial Peptide Action and Resistance. Pharmacol. Rev. 2003, 55, 27–55. [Google Scholar] [CrossRef] [PubMed]
- Ebenhan, T.; Gheysens, O.; Kruger, H.G.; Zeevaart, J.R.; Sathekge, M.M. Antimicrobial Peptides: Their Role as Infection-Selective Tracers for Molecular Imaging. Biomed Res. Int. 2014, 2014, 867381. [Google Scholar] [CrossRef] [PubMed]
- Lai, Y.; Gallo, R.L. AMPed up Immunity: How Antimicrobial Peptides Have Multiple Roles in Immune Defense. Trends Immunol. 2009, 30, 131–141. [Google Scholar] [CrossRef]
- Zasloff, M. Antimicrobial Peptides of Multicellular Organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef]
- Yeung, A.T.Y.; Gellatly, S.L.; Hancock, R.E.W. Multifunctional Cationic Host Defence Peptides and Their Clinical Applications. Cell. Mol. Life Sci. 2011, 68, 2161–2176. [Google Scholar] [CrossRef]
- Malmsten, M. Interactions of Antimicrobial Peptides with Bacterial Membranes and Membrane Components. Curr. Top. Med. Chem. 2015, 16, 16–24. [Google Scholar] [CrossRef]
- Pandidan, S.; Mechler, A. Latest Developments on the Mechanism of Action of Membrane Disrupting Peptides. Biophys. Rep. 2021, 7, 173. [Google Scholar] [CrossRef]
- Andrea, A.; Molchanova, N.; Jenssen, H. Antibiofilm Peptides and Peptidomimetics with Focus on Surface Immobilization. Biomolecules 2018, 8, 27. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Håkansson, J.; Ringstad, L.; Björn, C. Antimicrobial Peptides: An Emerging Category of Therapeutic Agents. Front. Cell. Infect. Microbiol. 2016, 6, 235805. [Google Scholar] [CrossRef]
- Briers, Y.; Lavigne, R. Breaking Barriers: Expansion of the Use of Endolysins as Novel Antibacterials against Gram-Negative Bacteria. Future Microbiol. 2015, 10, 377–390. [Google Scholar] [CrossRef] [PubMed]
- Defraine, V.; Schuermans, J.; Grymonprez, B.; Govers, S.K.; Aertsen, A.; Fauvart, M.; Michiels, J.; Lavigne, R.; Briers, Y. Efficacy of Artilysin Art-175 against Resistant and Persistent Acinetobacter baumannii. Antimicrob. Agents Chemother. 2016, 60, 3480–3488. [Google Scholar] [CrossRef] [PubMed]
- Kosikowska, P.; Lesner, A. Antimicrobial Peptides (AMPs) as Drug Candidates: A Patent Review (2003–2015). Expert Opin. Ther. Pat. 2016, 26, 689–702. [Google Scholar] [CrossRef] [PubMed]
- Van Der Does, A.M.; Bogaards, S.J.P.; Ravensbergen, B.; Beekhuizen, H.; Van Dissel, J.T.; Nibbering, P.H. Antimicrobial Peptide HLF1-11 Directs Granulocyte-Macrophage Colony-Stimulating Factor-Driven Monocyte Differentiation toward Macrophages with Enhanced Recognition and Clearance of Pathogens. Antimicrob. Agents Chemother. 2010, 54, 811–816. [Google Scholar] [CrossRef] [PubMed]
- Niyonsaba, F.; Song, P.; Yue, H.; Sutthammikorn, N.; Umehara, Y.; Okumura, K.; Ogawa, H. Antimicrobial Peptide Derived from Insulin-like Growth Factor-Binding Protein 5 Activates Mast Cells via Mas-Related G Protein-Coupled Receptor X2. Allergy 2020, 75, 203–207. [Google Scholar] [CrossRef]
- Radek, K.; Gallo, R. Antimicrobial Peptides: Natural Effectors of the Innate Immune System. Semin. Immunopathol. 2007, 29, 27–43. [Google Scholar] [CrossRef]
- Lhocine, N.; Ribeiro, P.S.; Buchon, N.; Wepf, A.; Wilson, R.; Tenev, T.; Lemaitre, B.; Gstaiger, M.; Meier, P.; Leulier, F. PIMS Modulates Immune Tolerance by Negatively Regulating Drosophila Innate Immune Signaling. Cell Host Microbe 2008, 4, 147–158. [Google Scholar] [CrossRef]
- Spohn, R.; Daruka, L.; Lázár, V.; Martins, A.; Vidovics, F.; Grézal, G.; Méhi, O.; Kintses, B.; Számel, M.; Jangir, P.K.; et al. Integrated Evolutionary Analysis Reveals Antimicrobial Peptides with Limited Resistance. Nat. Commun. 2019, 10, 4538. [Google Scholar] [CrossRef]
- Hancock, R.E.W.; Haney, E.F.; Gill, E.E. The Immunology of Host Defence Peptides: Beyond Antimicrobial Activity. Nat. Rev. Immunol. 2016, 16, 321–334. [Google Scholar] [CrossRef]
- Guo, C.; Sinnott, B.; Niu, B.; Lowry, M.B.; Fantacone, M.L.; Gombart, A.F. Synergistic Induction of Human Cathelicidin Antimicrobial Peptide Gene Expression by Vitamin D and Stilbenoids. Mol. Nutr. Food Res. 2014, 58, 528–536. [Google Scholar] [CrossRef]
- Xuan, J.; Feng, W.; Wang, J.; Wang, R.; Zhang, B.; Bo, L.; Chen, Z.S.; Yang, H.; Sun, L. Antimicrobial Peptides for Combating Drug-Resistant Bacterial Infections. Drug Resist. Updat. 2023, 68, 100954. [Google Scholar] [CrossRef] [PubMed]
- Sarkar, N.; Paulus, H. Function of Peptide Antibiotics in Sporulation. Nat. New Biol. 1972, 239, 228–230. [Google Scholar] [CrossRef] [PubMed]
- Frangou-Lazaridis, M.; Seddon, B. Effect of Gramicidin S on the Transcription System of the Producer Bacillus brevis Nagano. Microbiology 1985, 131, 437–449. [Google Scholar] [CrossRef] [PubMed]
- Ristow, H.; Pschorn, W.; Hansen, J.; Winkel, U. Induction of Sporulation in Bacillus brevis by Peptide Antibiotics. Nature 1979, 280, 165–166. [Google Scholar] [CrossRef] [PubMed]
- Özcengiz, G.; Öğülür, I. Biochemistry, Genetics and Regulation of Bacilysin Biosynthesis and Its Significance More than an Antibiotic. New Biotechnol. 2015, 32, 612–619. [Google Scholar] [CrossRef]
- Hilton, M.D.; Alaeddinoglu, N.G.; Demain, A.L. Bacillus subtilis Mutant Deficient in the Ability to Produce the Dipeptide Antibiotic Bacilysin: Isolation and Mapping of the Mutation. J. Bacteriol. 1988, 170, 1018–1020. [Google Scholar] [CrossRef]
- Özcengiz, G.; Alaeddinoglu, N.G. Bacilysin Production by Bacillus subtilis: Effects of Bacilysin, PH and Temperature. Folia Microbiol. 1991, 36, 522–526. [Google Scholar] [CrossRef]
- Özcengiz, G.; Alaeddinoglu, N.G. Bacilysin Production and Sporulation in Bacillus subtilis. Curr. Microbiol. 1991, 23, 61–64. [Google Scholar] [CrossRef]
- Wu, Q.; Patočka, J.; Kuča, K. Insect Antimicrobial Peptides, a Mini Review. Toxins 2018, 10, 461. [Google Scholar] [CrossRef]
- Zou, F.; Tan, C.; Shinali, T.S.; Zhang, B.; Zhang, L.; Han, Z.; Shang, N. Plant Antimicrobial Peptides: A Comprehensive Review of Their Classification, Production, Mode of Action, Functions, Applications, and Challenges. Food Funct. 2023, 14, 5492–5515. [Google Scholar] [CrossRef]
- Raheem, N.; Straus, S.K. Mechanisms of Action for Antimicrobial Peptides with Antibacterial and Antibiofilm Functions. Front. Microbiol. 2019, 10, 2866. [Google Scholar] [CrossRef] [PubMed]
- Binda, E.; Marinelli, F.; Marcone, G. Old and New Glycopeptide Antibiotics: Action and Resistance. Antibiotics 2014, 3, 572–594. [Google Scholar] [CrossRef] [PubMed]
- Ulm, H.; Wilmes, M.; Shai, Y.; Sahl, H.G. Antimicrobial Host Defensins Specific Antibiotic Activities and Innate Defense Modulation. Front. Immunol. 2012, 3, 249. [Google Scholar] [CrossRef] [PubMed]
- Niyonsaba, F.; Iwabuchi, K.; Someya, A.; Hirata, M.; Matsuda, H.; Ogawa, H.; Nagaoka, I. A Cathelicidin Family of Human Antibacterial Peptide LL-37 Induces Mast Cell Chemotaxis. Immunology 2002, 106, 20–26. [Google Scholar] [CrossRef]
- García, J.R.C.; Jaumann, F.; Schulz, S.; Krause, A.; Rodríguez-Jiménez, J.; Forssmann, U.; Adermann, K.; Klüver, E.; Vogelmeier, C.; Becker, D.; et al. Identification of a Novel, Multifunctional β-Defensin (Human β-Defensin 3) with Specific Antimicrobial Activity: Its Interaction with Plasma Membranes of Xenopus Oocytes and the Induction of Macrophage Chemoattraction. Cell Tissue Res. 2001, 306, 257–264. [Google Scholar] [CrossRef]
- Scott, M.G.; Dullaghan, E.; Mookherjee, N.; Glavas, N.; Waldbrook, M.; Thompson, A.; Wang, A.; Lee, K.; Doria, S.; Hamill, P.; et al. An Anti-Infective Peptide That Selectively Modulates the Innate Immune Response. Nat. Biotechnol. 2007, 25, 465–472. [Google Scholar] [CrossRef]
- Nijnik, A.; Madera, L.; Ma, S.; Waldbrook, M.; Elliott, M.R.; Easton, D.M.; Mayer, M.L.; Mullaly, S.C.; Kindrachuk, J.; Jenssen, H.; et al. Synthetic Cationic Peptide IDR-1002 Provides Protection against Bacterial Infections through Chemokine Induction and Enhanced Leukocyte Recruitment. J. Immunol. 2010, 184, 2539–2550. [Google Scholar] [CrossRef]
- Nejman, D.; Livyatan, I.; Fuks, G.; Gavert, N.; Zwang, Y.; Geller, L.T.; Rotter-Maskowitz, A.; Weiser, R.; Mallel, G.; Gigi, E.; et al. The Human Tumor Microbiome Is Composed of Tumor Type-Specific Intracellular Bacteria. Science 2020, 368, 973–980. [Google Scholar] [CrossRef]
- Nguyen, L.T.; Chau, J.K.; Perry, N.A.; de Boer, L.; Zaat, S.A.J.; Vogel, H.J. Serum Stabilities of Short Tryptophan- and Arginine-Rich Antimicrobial Peptide Analogs. PLoS ONE 2010, 5, e12684. [Google Scholar] [CrossRef]
- Schweizer, F. Cationic Amphiphilic Peptides with Cancer-Selective Toxicity. Eur. J. Pharmacol. 2009, 625, 190–194. [Google Scholar] [CrossRef]
- Vlieghe, P.; Lisowski, V.; Martinez, J.; Khrestchatisky, M. Synthetic Therapeutic Peptides: Science and Market. Drug Discov. Today 2010, 15, 40–56. [Google Scholar] [CrossRef]
- Schmidtchen, A.; Pasupuleti, M.; Malmsten, M. Effect of Hydrophobic Modifications in Antimicrobial Peptides. Adv. Colloid Interface Sci. 2014, 205, 265–274. [Google Scholar] [CrossRef] [PubMed]
- Porter, S.L.; Coulter, S.M.; Pentlavalli, S.; Thompson, T.P.; Laverty, G. Self-Assembling Diphenylalanine Peptide Nanotubes Selectively Eradicate Bacterial Biofilm Infection. Acta Biomater. 2018, 77, 96–105. [Google Scholar] [CrossRef] [PubMed]
- Dijksteel, G.S.; Ulrich, M.M.W.; Middelkoop, E.; Boekema, B.K.H.L. Review: Lessons Learned from Clinical Trials Using Antimicrobial Peptides (AMPs). Front. Microbiol. 2021, 12, 616979. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.P.; Chen, E.H.L.; Yang, S.Y.; Kuo, P.S.; Jan, H.M.; Yang, T.C.; Hsieh, M.Y.; Lee, K.T.; Lin, C.H.; Chen, R.P.Y. A Systematic Study of the Stability, Safety, and Efficacy of the de Novo Designed Antimicrobial Peptide PepD2 and Its Modified Derivatives Against Acinetobacter baumannii. Front. Microbiol. 2021, 12, 678330. [Google Scholar] [CrossRef]
- Falagas, M.E.; Kasiakou, S.K.; Tsiodras, S.; Michalopoulos, A. The Use of Intravenous and Aerosolized Polymyxins for the Treatment of Infections in Critically Ill Patients: A Review of the Recent Literature. Clin. Med. Res. 2006, 4, 138. [Google Scholar] [CrossRef]
- Nawrocki, K.L.; Crispell, E.K.; McBride, S.M. Antimicrobial Peptide Resistance Mechanisms of Gram-Positive Bacteria. Antibiotics 2014, 3, 461. [Google Scholar] [CrossRef]
- El Shazely, B.; Yu, G.; Johnston, P.R.; Rolff, J. Resistance Evolution Against Antimicrobial Peptides in Staphylococcus aureus Alters Pharmacodynamics Beyond the MIC. Front. Microbiol. 2020, 11, 502315. [Google Scholar] [CrossRef]
- El Shazely, B.; Urbański, A.; Johnston, P.R.; Rolff, J. In Vivo Exposure of Insect AMP Resistant Staphylococcus aureus to an Insect Immune System. Insect Biochem. Mol. Biol. 2019, 110, 60–68. [Google Scholar] [CrossRef]
- Lazzaro, B.P.; Zasloff, M.; Rolff, J. Antimicrobial Peptides: Application Informed by Evolution. Science 2020, 368, 6490. [Google Scholar] [CrossRef]
- Grassi, L.; Maisetta, G.; Esin, S.; Batoni, G. Combination Strategies to Enhance the Efficacy of Antimicrobial Peptides against Bacterial Biofilms. Front. Microbiol. 2017, 8, 2409. [Google Scholar] [CrossRef] [PubMed]
- Almaaytah, A.; Qaoud, M.T.; Abualhaijaa, A.; Al-Balas, Q.; Alzoubi, K.H. Hybridization and Antibiotic Synergism as a Tool for Reducing the Cytotoxicity of Antimicrobial Peptides. Infect. Drug Resist. 2018, 11, 835–847. [Google Scholar] [CrossRef] [PubMed]
- Vaara, M. New Approaches in Peptide Antibiotics. Curr. Opin. Pharmacol. 2009, 9, 571–576. [Google Scholar] [CrossRef] [PubMed]
- Nordström, R.; Malmsten, M. Delivery Systems for Antimicrobial Peptides. Adv. Colloid Interface Sci. 2017, 242, 17–34. [Google Scholar] [CrossRef] [PubMed]
- Gentilucci, L.; De Marco, R.; Cerisoli, L. Chemical Modifications Designed to Improve Peptide Stability: Incorporation of Non-Natural Amino Acids, Pseudo-Peptide Bonds, and Cyclization. Curr. Pharm. Des. 2010, 16, 3185–3203. [Google Scholar] [CrossRef]
- Sen, D.; Mukhopadhyay, P. Antimicrobial Resistance (AMR) Management Using CRISPR-Cas Based Genome Editing. Gene Genome Ed. 2024, 7, 100031. [Google Scholar] [CrossRef]
- Chen, S.; Cao, H.; Xu, Z.; Huang, J.; Liu, Z.; Li, T.; Duan, C.; Wu, W.; Wen, Y.; Zhang, L.-H.; et al. A Type I-F CRISPRi System Unveils the Novel Role of CzcR in Modulating Multidrug Resistance of Pseudomonas aeruginosa. Microbiol. Spectr. 2023, 11, e0112323. [Google Scholar] [CrossRef]
- Wan, F.; Wong, F.; Collins, J.J.; de la Fuente-Nunez, C. Machine Learning for Antimicrobial Peptide Identification and Design. Nat. Rev. Bioeng. 2024, 2, 392–407. [Google Scholar] [CrossRef]
- Gunasekera, S.; Muhammad, T.; Strömstedt, A.A.; Rosengren, K.J.; Göransson, U. Backbone Cyclization and Dimerization of LL-37-Derived Peptides Enhance Antimicrobial Activity and Proteolytic Stability. Front. Microbiol. 2020, 11, 168. [Google Scholar] [CrossRef]
- Ting, D.S.J.; Beuerman, R.W.; Dua, H.S.; Lakshminarayanan, R.; Mohammed, I. Strategies in Translating the Therapeutic Potentials of Host Defense Peptides. Front. Immunol. 2020, 11, 983. [Google Scholar] [CrossRef]
- Thomsen, T.T.; Mendel, H.C.; Al-mansour, W.; Oddo, A.; Løbner-olesen, A.; Hansen, P.R. Analogues of a Cyclic Antimicrobial Peptide with a Flexible Linker Show Promising Activity against Pseudomonas aeruginosa and Staphylococcus aureus. Antibiotics 2020, 9, 366. [Google Scholar] [CrossRef] [PubMed]
- Scudiero, O.; Nigro, E.; Cantisani, M.; Colavita, I.; Leone, M.; Mercurio, F.A.; Galdiero, M.; Pessi, A.; Daniele, A.; Salvatore, F.; et al. Design and Activity of a Cyclic Mini-β-Defensin Analog: A Novel Antimicrobial Tool. Int. J. Nanomed. 2015, 10, 6523–6539. [Google Scholar] [CrossRef]
- Moiola, M.; Memeo, M.G.; Quadrelli, P. Stapled Peptides—A Useful Improvement for Peptide-Based Drugs. Molecules 2019, 24, 3654. [Google Scholar] [CrossRef] [PubMed]
- Hirano, M.; Saito, C.; Yokoo, H.; Goto, C.; Kawano, R.; Misawa, T.; Demizu, Y. Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence. Molecules 2021, 26, 444. [Google Scholar] [CrossRef] [PubMed]
- Schnaider, L.; Rosenberg, A.; Kreiser, T.; Kolusheva, S.; Gazit, E.; Berman, J. Peptide Self-Assembly Is Linked to Antibacterial, but Not Antifungal, Activity of Histatin 5 Derivatives. mSphere 2020, 5, e00021-20. [Google Scholar] [CrossRef]
- Nel, A.E.; Mädler, L.; Velegol, D.; Xia, T.; Hoek, E.M.V.; Somasundaran, P.; Klaessig, F.; Castranova, V.; Thompson, M. Understanding Biophysicochemical Interactions at the Nano-Bio Interface. Nat. Mater. 2009, 8, 543–557. [Google Scholar] [CrossRef]
- Sun, H.; Hong, Y.; Xi, Y.; Zou, Y.; Gao, J.; Du, J. Synthesis, Self-Assembly, and Biomedical Applications of Antimicrobial Peptide–Polymer Conjugates. Biomacromolecules 2018, 19, 1701–1720. [Google Scholar] [CrossRef]
- Fadaka, A.O.; Sibuyi, N.R.S.; Madiehe, A.M.; Meyer, M. Nanotechnology-Based Delivery Systems for Antimicrobial Peptides. Pharmaceutics 2021, 13, 1795. [Google Scholar] [CrossRef]
- Lepeltier, E.; Rijo, P.; Rizzolio, F.; Popovtzer, R.; Petrikaite, V.; Assaraf, Y.G.; Passirani, C. Nanomedicine to Target Multidrug Resistant Tumors. Drug Resist. Updat. 2020, 52, 100704. [Google Scholar] [CrossRef]
- Fox, M.A.; Thwaite, J.E.; Ulaeto, D.O.; Atkins, T.P.; Atkins, H.S. Design and Characterization of Novel Hybrid Antimicrobial Peptides Based on Cecropin A, LL-37 and Magainin II. Peptides 2012, 33, 197–205. [Google Scholar] [CrossRef]
- Mathur, H.; Field, D.; Rea, M.C.; Cotter, P.D.; Hill, C.; Ross, R.P. Bacteriocin-Antimicrobial Synergy: A Medical and Food Perspective. Front. Microbiol. 2017, 8, 1205. [Google Scholar] [CrossRef] [PubMed]
- Lee, H.; Lee, D.G. Novel Approaches for Efficient Antifungal Drug Action. J. Microbiol. Biotechnol. 2018, 28, 1771–1781. [Google Scholar] [CrossRef] [PubMed]
- Mataraci, E.; Dosler, S. In Vitro Activities of Antibiotics and Antimicrobial Cationic Peptides Alone and in Combination against Methicillin-Resistant Staphylococcus aureus Biofilms. Antimicrob. Agents Chemother. 2012, 56, 6366–6371. [Google Scholar] [CrossRef] [PubMed]
- Dosler, S.; Mataraci, E. In Vitro Pharmacokinetics of Antimicrobial Cationic Peptides Alone and in Combination with Antibiotics against Methicillin Resistant Staphylococcus aureus Biofilms. Peptides 2013, 49, 53–58. [Google Scholar] [CrossRef] [PubMed]
- Li, S.; She, P.; Zhou, L.; Zeng, X.; Xu, L.; Liu, Y.; Chen, L.; Wu, Y. High-Throughput Identification of Antibacterials Against Pseudomonas aeruginosa. Front. Microbiol. 2020, 11, 591426. [Google Scholar] [CrossRef]
- Vriens, K.; Cools, T.L.; Harvey, P.J.; Craik, D.J.; Spincemaille, P.; Cassiman, D.; Braem, A.; Vleugels, J.; Nibbering, P.H.; Drijfhout, J.W.; et al. Synergistic Activity of the Plant Defensin HsAFP1 and Caspofungin against Candida albicans Biofilms and Planktonic Cultures. PLoS ONE 2015, 10, e0132701. [Google Scholar] [CrossRef]
- Zhao, X.; Zhen, Z.; Wang, X.; Guo, N. Synergy of a Combination of Nisin and Citric Acid against Staphylococcus aureus and Listeria monocytogenes. Food Addit. Contam. Part A 2017, 34, 2058–2068. [Google Scholar] [CrossRef]
- Gupta, S.K.; Shukla, P. Sophisticated Cloning, Fermentation, and Purification Technologies for an Enhanced Therapeutic Protein Production: A Review. Front. Pharmacol. 2017, 8, 419. [Google Scholar] [CrossRef]
- Parachin, N.S.; Mulder, K.C.; Viana, A.A.B.; Dias, S.C.; Franco, O.L. Expression Systems for Heterologous Production of Antimicrobial Peptides. Peptides 2012, 38, 446–456. [Google Scholar] [CrossRef]
- Li, Y. Production of Human Antimicrobial Peptide LL-37 in Escherichia Coli Using a Thioredoxin-SUMO Dual Fusion System. Protein Expr. Purif. 2013, 87, 72–78. [Google Scholar] [CrossRef]
- Luan, C.; Xie, Y.G.; Pu, Y.T.; Zhang, H.W.; Han, F.F.; Feng, J.; Wang, Y.Z. Recombinant Expression of Antimicrobial Peptides Using a Novel Self-Cleaving Aggregation Tag in Escherichia coli. Can. J. Microbiol. 2014, 60, 113–120. [Google Scholar] [CrossRef] [PubMed]
- Hoelscher, M.P.; Forner, J.; Calderone, S.; Krämer, C.; Taylor, Z.; Loiacono, F.V.; Agrawal, S.; Karcher, D.; Moratti, F.; Kroop, X.; et al. Expression Strategies for the Efficient Synthesis of Antimicrobial Peptides in Plastids. Nat. Commun. 2022, 13, 5856. [Google Scholar] [CrossRef] [PubMed]
- Agüero-Chapin, G.; Antunes, A.; Marrero-Ponce, Y. A 2022 Update on Computational Approaches to the Discovery and Design of Antimicrobial Peptides. Antibiotics 2023, 12, 1011. [Google Scholar] [CrossRef] [PubMed]
- Avila-Barrientos, L.P.; Cofas-Vargas, L.F.; Agüero-Chapin, G.; Hernández-García, E.; Ruiz-Carmona, S.; Valdez-Cruz, N.A.; Trujillo-Roldán, M.; Weber, J.; Ruiz-Blanco, Y.B.; Barril, X.; et al. Computational Design of Inhibitors Targeting the Catalytic β Subunit of Escherichia coli FOF1-ATP Synthase. Antibiotics 2022, 11, 557. [Google Scholar] [CrossRef]
- Ruiz-Blanco, Y.B.; Agüero-Chapin, G.; Romero-Molina, S.; Antunes, A.; Olari, L.R.; Spellerberg, B.; Münch, J.; Sanchez-Garcia, E. ABP-Finder: A Tool to Identify Antibacterial Peptides and the Gram-Staining Type of Targeted Bacteria. Antibiotics 2022, 11, 1708. [Google Scholar] [CrossRef]
- Shi, J.; Chen, C.; Wang, D.; Wang, Z.; Liu, Y. The Antimicrobial Peptide LI14 Combats Multidrug-Resistant Bacterial Infections. Commun. Biol. 2022, 5, 926. [Google Scholar] [CrossRef]
- Lin, D.; Sutherland, D.; Aninta, S.I.; Louie, N.; Nip, K.M.; Li, C.; Yanai, A.; Coombe, L.; Warren, R.L.; Helbing, C.C.; et al. Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with RAMPage. Antibiotics 2022, 11, 952. [Google Scholar] [CrossRef]
- Aguiar, T.K.B.; Neto, N.A.S.; Silva, R.R.S.; Freitas, C.D.T.; Mesquita, F.P.; Alencar, L.M.R.; Santos-Oliveira, R.; Goldman, G.H.; Souza, P.F.N. Behind the Curtain: In Silico and In Vitro Experiments Brought to Light New Insights into the Anticryptococcal Action of Synthetic Peptides. Antibiotics 2023, 12, 153. [Google Scholar] [CrossRef]
- Kleinkauf, H.; Von Döhren, H. Peptide Antibiotics. In Biotechnology, Second, Completely Revised Edition, Volume 7: Products of Secondary Metabolism; Wiley: Hoboken, NJ, USA, 2008; Volume 43, pp. 277–322. ISBN 9783527620890. [Google Scholar]
Class | Peptide | Amino Acid Sequence a and Length | Producer | Active Against | Mode of Action | Ref. |
---|---|---|---|---|---|---|
Cecropin | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK (37) | Ascaris suum | Gram-negative bacteria | Interactions with nucleic acids | [25] |
Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL (35) | Hyalophora cecropia | Multidrug-resistant cancer cells, and bacteria | Form pores in CM | [26,27] | |
Cecropin D | b MNFTKILFFVVACVFAMRTVSAAPWNPFKELEKVGQRVRDAVISAGPAVATVAQATALAKGK (62) | H. cecropia | Gram-negative bacteria | Disruption of CM | [28] | |
Papiliocin | RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2 (37) | Papilio xuthus | Gram-negative bacteria, anti-inflammatory | Disruption of CM | [29,30] | |
Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR (31) | Ascaris suum | Bacteria, multidrug resistant cancer cells | Disruption of CM | [27] | |
Cathelicidin | hCAP-18 | EFKRIVQRIKDFLRNLV (17) | Homo sapiens | Cell growth, migration, and antimicrobial | Disintegration of CM molecules | [31,32] |
Cathelicidin-AL | RRSRRGRGGGRRGGSGGRGGRGGGGRSGAGSSIAGVGSRGGGGGRHYA (48) | Amolops loloensis | [33] | |||
Fowlicidins 1,2,3 and cathelicidin Beta-1 | RVKRVWPLVIRTVIAGYNLYRAIKKK (26) (Fowlicidin-1, chain A) | Gallus gallus domesticus | [31] | |||
Protegrin 1 | RGGRLCYCRRRFCVCVGRX (19) | Sus sp. | [34] | |||
Defensin | cis-defensins (e.g., plant defensin 1) | RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPC (47) | Nicotiana sp. | Bacteria, fungi, enveloped and nonenveloped viruses | Damages the CM | [35] |
trans-defensins (e.g., human β-defensin) | KKCWNGGRCRKKCKENEKPIGYCRNGKKCCVN (32) | H. sapiens | Disruption of CM, inhibition of DNA and RNA synthesis | [36,37,38] | ||
Magainins | Magainin-2 | GIGKFLHSAKKFGKAFVGEIMNS (23) | Xenopus laevis | Bacteria, protozoa, fungi, virus, and cancer | Disrupts the CM | [37,39] |
Domain | Peptide | Producer | Activity Against | Mode of Action | Ref. |
---|---|---|---|---|---|
Bacteria | Nisin | Lactococcus lactis | Gram-positive bacteria | Perturbation of the PM | [40,41] |
Vancomycin | Amycolatopsis orientalis | Gram-positive bacteria | Inhibition of CW synthesis | [41] | |
Telavancin | Derivative of vancomycin | Gram-positive bacteria | Inhibition of CW synthesis | [42] | |
Gramicidin S | Bacillus brevis | Bacteria and fungi | Membrane deformation | [43] | |
Bacitracin | B. subtilis | Gram-positive bacteria | Interfere peptidoglycan biosynthesis | [44] | |
Tyrocidine | B. brevis | Gram-positive bacteria | DNA damage, and interfere with DNA-binding proteins | [45] | |
Polymyxin B | B. polymyxa | Bacteria | Alters outer membrane permeability | [46] | |
Bacillomycin, Fengycins, Surfactines, Bacillibactin, and Difficidin | Bacillus sp. | Bacteria and fungi | Damage CW and CM, binds to genomic DNA leading to cell death | [47] | |
Bacilysin | Bacillus sp. | Bacteria, fungi, algae, and protozoa | Inhibits glucosamine 6-phospate synthase | [48] | |
Iturins | B. subtilis | Fungi | Leakage of K+ and other vital ions | [49] | |
Syringomycin | Pseudomonas syringae | Bacteria, fungi, and virus | K+ and H+ influx leads to cell death | [50,51] | |
Ecomycins | Pseudomonas viridiflava | Fungi | Unknown | [51] | |
Pseudomycins | P. syringae | Fungi | Unknown | [51] | |
Daptomycin | Streptomyces roseosporus | Gram-positive bacteria | Disrupts bacterial cell membrane | [52] | |
Albonoursin | Streptomyces noursei | Bacteria | Unknown | [53] | |
Amphomycin | Streptomyces canus | Gram-positive bacteria | Inhibit peptidoglycan biosynthesis | [54] | |
Munumbicins | Streptomyces NRRL 30562 | Bacteria, fungi, parasite, and cancer cells | Unknown | [51] | |
Kakadumycins | Streptomyces NRRL30566 | Bacteria, fungi, parasite, and cancer cells | Inhibit RNA synthesis. | [51,55] | |
Xiamycins | Streptomyces GT2002/1503 | Bacteria and fungi | Unknown | [51,56] | |
Fungi | Copsin | Coprinopsis cinereacopsin | Gram-positive bacteria | Inhibitor of CW synthesis | [57] |
Peptaibol | Trichoderma | Bacteria and fungi | Membrane leakage | [58] | |
Plectasin | Pseudoplectania nigrella | Bacteria | Acts by binding to bacterial cell wall precursor Lipid II | [59] | |
Echinocandins | Aspergillus rugulovalvus, Zalerion arboricola, Papularia sphaerosperma | Fungi | Inhibit glucan synthase | [60] | |
Aculeacins | Aspergillus aculeatus | Fungi | Inhibit CW biosynthesis | [61] | |
Aureobasidin | Aureobasidium pullulans | Fungi | Inhibition of actin and chitin assembly and synthesis of sphingolipids | [61] | |
Yeast killer toxins | Saccharomyces cerevisiae | Fungi | Form cation channels in cell membrane, enter into nucleus, and interact with other proteins | [49] | |
Archaea | VLL-28 | Sulfolobus islandicus | Bacteria and fungi | Membrane damages and nucleic acid binding | [62] |
PaDBS1R6 | Pyrobaculum aerophilum | Bacteria and cancer cell | Unknown | [63] |
Name | Description | Active Against | Company |
---|---|---|---|
Daptomycin | Synthetic cyclic lipopeptide antibiotic | S. aureus infections (bacteremia) | Cubist Pharmaceuticals LLC (Lexington, MA, USA) (Merck and Co., Rahway, NJ, USA) |
Dalbavancin | Semisynthetic lipoglycopeptide and antibacterial | Acute bacterial skin infections, osteomyelitis and septic arthritis | Allergan (Dublin, Ireland) (formerly Actavis and Durata Therapeutics) |
Telavancin (TD-6424) | Semi-synthetic derivative of vanocymycin | MRSA and other Gram-positive bacteria | Clinigen Group plc (Burton-on-Trent, UK)/Innoviva Inc. (South San Francisco, CA, USA)/Pendopharm (Montreal, Canada)/Theravance Biopharma Inc. (South San Francisco, CA, USA)/University of Illinois |
Oritavancin | Glycopeptide antibiotic used to treat Gram-positive bacteria | Acute bacterial skin infection | The Medicines Company (Parsippany-Troy Hills Township, NJ, USA) |
Bacitracin | Bacitracin A is an antibacterial homodetic cyclic peptide | Wound infections, pneumonia, empyema in infants, skin and eye infections | Unknown |
Colistin (polymyxin-E) | To treat Gram-negative bacteria | Gram-negative bacilli, particularly P. aeruginosa | Unknown |
Polymyxin B | Basic polypeptides of about eight amino acids that display cationic detergent action on cell membranes | P. aeruginosa infections | Unknown |
Tyrothricin | A polypeptide antibiotic mixture obtained from Bacillus brevis | Skin and oropharyngeal mucous membranes infections | Unknown |
Vancomycin | A glycopeptide antibiotic | S. aureus infections | Unknown |
Gramicidin S | Cyclic peptide biosynthesized from Bacillus brevis | Potent against Gram-negative and Gram-positive bacteria and fungi | Unknown |
Gramicidin D | A heterogeneous mixture of three antibiotic compounds, gramicidins A, B, and C | Skin and eye infections | Unknown |
Name | Description | Active Against | Stage of Development |
---|---|---|---|
Histatin | Antifungal | Oral candidiasis | Phase II-III |
PAC113 | Antifungal | Oral candidiasis in HIV patients | Phase IIb |
Plectasin | Fungal defensin | Pneumococcal and streptococcal infections | Phase I |
D2A21 | A 22-residue α helix peptide | Skin infections against multidrug-resistant pathogens | Phase III |
Glutoxim (NOV-002) | Antibacterial | Tuberculosis | Phase III |
PMX-30063 | Defensin structural mimetic | Staphylococcus spp. | Phase II |
Surotomycin | Antibacterial agents for the treatment of Gram-positive infections | Diarrhea and Clostridium Difficile infections | Phase III |
PL-5 | Has very strong bactericidal activity | P. aeruginosa, and MRSA and multi-drug resistant A. baumannii containing NDM-1 gene | Phase IIIb |
Murepavadin | Synthetic by amino acid substitution of protegrin I | Nosocomial and ventilator-associated bacterial pneumonia | Phase III |
Sifuvirtide | Antiviral designed peptide | HIV fusion inhibitor | Phase II |
Enfuvirtide and Fuzeon | Enfuvirtide is a 36 amino acid biomimetic peptide that is structurally similar to the HIV proteins | HIV infection | Approved by FDA (Trimeris) |
Cefilavancin | Covalently linked glycopeptide–cephalosporin (β-lactam) heterodimer antibiotic and active against Gram-positive bacteria | Gram-positive infections, skin and soft tissue infections | Phase III |
Lotilibcin | Lipodepsipeptide | MRSA | Phase I/II |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Islam, T.; Tamanna, N.T.; Sagor, M.S.; Zaki, R.M.; Rabbee, M.F.; Lackner, M. Antimicrobial Peptides: A Promising Solution to the Rising Threat of Antibiotic Resistance. Pharmaceutics 2024, 16, 1542. https://doi.org/10.3390/pharmaceutics16121542
Islam T, Tamanna NT, Sagor MS, Zaki RM, Rabbee MF, Lackner M. Antimicrobial Peptides: A Promising Solution to the Rising Threat of Antibiotic Resistance. Pharmaceutics. 2024; 16(12):1542. https://doi.org/10.3390/pharmaceutics16121542
Chicago/Turabian StyleIslam, Tarequl, Noshin Tabassum Tamanna, Md Shahjalal Sagor, Randa Mohammed Zaki, Muhammad Fazle Rabbee, and Maximilian Lackner. 2024. "Antimicrobial Peptides: A Promising Solution to the Rising Threat of Antibiotic Resistance" Pharmaceutics 16, no. 12: 1542. https://doi.org/10.3390/pharmaceutics16121542
APA StyleIslam, T., Tamanna, N. T., Sagor, M. S., Zaki, R. M., Rabbee, M. F., & Lackner, M. (2024). Antimicrobial Peptides: A Promising Solution to the Rising Threat of Antibiotic Resistance. Pharmaceutics, 16(12), 1542. https://doi.org/10.3390/pharmaceutics16121542