Next Article in Journal
Theonella: A Treasure Trove of Structurally Unique and Biologically Active Sterols
Previous Article in Journal
Anti-Leukemia Activity of Polysaccharide from Sargassum fusiforme via the PI3K/AKT/BAD Pathway In Vivo and In Vitro
Previous Article in Special Issue
Microalgae as an Efficient Vehicle for the Production and Targeted Delivery of Therapeutic Glycoproteins against SARS-CoV-2 Variants
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Marine Drugs
Volume 21
Issue 5
10.3390/md21050290
marinedrugs-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture

by
José María García-Beltrán
1,2,
Marta Arizcun
2 and
Elena Chaves-Pozo
2,*
1
Immunobiology for Aquaculture Group, Department of Cell Biology and Histology, Faculty of Biology, Campus Regional de Excelencia Internacional “Campus Mare Nostrum”, University of Murcia, 30100 Murcia, Spain
2
Physiology and Welfare of Marine Species Group (PHYSIS), Centro Oceanográfico de Murcia, Instituto Español de Oceanografía (COMU-IEO), CSIC, Puerto de Mazarrón, 30860 Murcia, Spain
*
Author to whom correspondence should be addressed.
Mar. Drugs 2023, 21(5), 290; https://doi.org/10.3390/md21050290
Submission received: 14 February 2023 / Revised: 5 May 2023 / Accepted: 6 May 2023 / Published: 8 May 2023
(This article belongs to the Special Issue Pharmaceutical Potential of Marine Microorganisms)
Versions Notes

Abstract

:
Aquaculture production is at a record level and is estimated to increase in the coming years. However, this production can be negatively affected by infectious diseases produced by viruses, bacteria, and parasites, causing fish mortality and economic losses. Antimicrobial peptides (AMPs) are small peptides that may be promising candidates to replace antibiotics because they are the first line of defense in animals against a wide variety of pathogens and have no negative effects; they also show additional activities such as antioxidant or immunoregulatory functions, which makes them powerful alternatives for use in aquaculture. Moreover, AMPs are highly available in natural sources and have already been used in the livestock farming and food industries. Photosynthetic marine organisms can survive under all kinds of environmental conditions and under extremely competitive environments thanks to their flexible metabolism. For this reason, these organisms represent a powerful source of bioactive molecules as nutraceuticals and pharmaceuticals, including AMPs. Therefore, in this study we reviewed the present knowledge about AMPs from photosynthetic marine organism sources and analyzed whether they could be suitable for use in aquaculture.

1. Introduction

Aquaculture is one of the most economically important food sectors worldwide. Its production is at a record level, and the sector will play a crucial role in supplying food in the coming years, estimated to increase by another 14% by 2030 [1]. However, aquaculture is affected by infectious diseases produced by viruses, bacteria, protists, and metazoans, which are common in the ocean but seem more problematic at fish farms, where the high stocking density and stressful conditions are perfect for opportunistic infections. Therefore, marine diseases represent a major cost for aquaculture, causing losses of billions of dollars each year [2]. They can affect the economic value of cultivated species by causing chronic stress, decreasing growth, reducing immunity, and increasing the mortality of fish [2,3,4]. In order to avoid or control disease outbreaks, fish farms must invest in methods to prevent and treat infections, which often involve a high cost. Immunostimulants and vaccines against viruses and bacteria are the only allowable options due to the negative effects of antibiotics on fish and the environment [2]. In addition, adverse drug reactions can occur in humans after consuming aquatic products with antibiotic residues [5,6,7]. Within this framework, antimicrobial peptides (AMPs) have attracted attention as promising candidates to replace antibiotics in order to combat the increasing number of multidrug-resistant pathogenic bacteria while avoiding the negative effects on aquaculture [8].
AMPs are small peptides that are generally formed by fewer than 50 amino acids [9,10], weigh less than 10 kDa [11,12], and have a wide range of antimicrobial activities [10,13]. AMPs are phylogenetically ancient and highly conserved molecules that have a crucial role in the immune system of living organisms as the first line of defense against a broad variety of pathogens such as Gram− and Gram+ bacteria, viruses, fungi, and parasites [7,9,10,11,12,13,14]. Their characteristics and structure allow them to have a wide variety of mechanisms of action to prevent the development of antimicrobial resistance [7,9,10,12,15]. In contrast to antibiotics, AMPs can target the entire surface of cell membranes [12], are less likely to be targeted by proteases of microorganisms as they have unique protease-binding epitopes, and are active at quite low minimum inhibitory concentrations (MICs) [10]. That is why AMPs have already been used in the livestock farming and food industries, as they can improve animal immunity and increase production performance, and they can also be used as food preservatives in the production and storage of dairy products, meat products, and canned food as they inhibit the growth of many microorganisms [7]. In fact, as food preservatives, AMPs are well digested and hydrolyzed, have no toxic side effects, have good solubility, are active under acidic conditions, and are safer than most preservatives [7]. So, although certain aspects have to be studied before AMPs can be used in aquaculture, they are a promising option to achieve the Blue Transformation initiative proposed by the Food and Agriculture Organization (FAO) that aims for economically and environmentally sustainable aquaculture and better food security [1].
Regarding the literature, the effects of algae as additives in fish diets [16,17] and the biological activity of algal AMPs [15,18] have been reviewed. In this study, we carried out a combined analysis of the biological activities of different AMPs from photosynthetic marine organisms with the potential for use in aquaculture. A selection of approximately 200 articles published between 1996 and 2022 retrieved through PubMed® searches, including the terms “algae” or “antimicrobial peptides” or “biological activities” or “aquaculture”, were examined for the purpose of this review.

2. Classification of Antimicrobial Peptides

Generally, AMPs are small, positively charged, amphipathic molecules that have both hydrophilic and hydrophobic surfaces [11]. AMPs are classified based on multiple features due to their huge diversity (for review, see [19] and the Antimicrobial Peptide Database (APD), https://aps.unmc.edu/ accessed on 17 March 2023). In general, the main classifications are based on source, activity, or structural characteristics [19]. AMPs are produced by bacteria, fungi, plants, and animals, including invertebrates, amphibians, fish, birds, and mammals [7,19]. The APD uses 25 biological activities to classify around 3569 AMPs from all life kingdoms [20]. Zhang et al. [7] classified them according to their structural features, based on length, hydrophobic amino acid content, charge, and secondary structure. In terms of length, approximately 90% of AMPs present fewer than 50 amino acids, and most functional peptides have fewer than 30 amino acids. Regarding hydrophobicity, most AMPs have a hydrophobic amino acid content of 50%. Hydrophobicity is crucial in their antimicrobial activity, as it allows them to interact with the cell membranes of pathogens. As to their charge, almost 90% of AMPs are cationic, with a net positive charge of +1 to +13 due to arginine and lysine residues, enabling them to bind to negatively charged bacterial cell membranes [7]. Finally, according to their secondary structure, AMPs are classified as linear or cyclic, containing α-helical, hairpin-like β-sheet, or mixed α-helical/β-sheet structures stabilized by two, three, or four disulfide bonds between cysteine residues. Moreover, AMPs present an abundance of amino acids such as proline, tryptophan, histidine, and glycine [7,9,11,21].

3. Mode of Action of Antimicrobial Peptides

Understanding the main differences between prokaryotic and eukaryotic cell membrane structures, including the absence of cholesterol and a greater presence of anionic lipids in prokaryotic membranes [9], is key to understanding the preferential activity of AMPs against bacteria and their low toxicity against eukaryotic cells [9,11]. Regarding the mode of action, great diversity and specificity among particular AMP–bacteria couplings have been described [9]. First of all, there is electrostatic binding between the positively charged AMPs and the negatively charged lipids present in the membranes of microorganisms. Secondly, the secondary and amphiphilic structure of AMPs helps them to insert into or cross through the cell membrane. Thus, the α-helix domains of AMPs are related to their linkage with the phospholipid bilayer, while the β-folded domains are important for stability and crossing the cell membrane [7]. Afterwards, the antimicrobial activity of AMPs may or may not involve membrane damage [7,9,11,12]. Regarding their activity in membrane damage, different models of action have been postulated [7,9,11,12]. In the aggregation model, AMPs create irreversible membrane pores or ion channels, but in the carpet and agglutination models they can also induce membrane disruption and cytoplasm efflux, which in turn results in osmotic lysis of the cell [7,9,11,12]. On the other hand, AMPs that are able to cross the bacterial phospholipid bilayer subsequently inhibit bacterial growth and metabolism by disrupting cellular processes when binding intracellular components [7,9,10,11,12] or block the energy production and transfer pathway, triggering cell death [12].
In contrast to the bactericidal activity of AMPs, little knowledge is available about the molecular mechanism of their antiviral activity, and much less is available about their parasitic activity [22]. AMPs may have stage-specific action on different viruses at extracellular or intracellular stages of the viral cycle [23]. Regarding their action at extracellular stages, some AMPs can block or reduce the infectivity of viruses [24] directly, by disrupting the viral envelope [25,26,27,28], causing disintegration of the viral capsid or agglutination of viral particles [25,26,27,28,29], or indirectly, by competing for protein link sites in host cell membranes [25,30]. In any case, they prevent the penetration of viruses into host cells and subsequent replication [27,28]. The AMPs that act intracellularly can also selectively inhibit viral protein synthesis or the release of viral particles by interfering with the intracellular transport of capsid proteins to the cell surface and preventing the insertion of virions into the cell membrane [31].
Regarding the antiparasitic mode of action of AMPs, it seems to be based on their capability to distinguish the lipid composition of plasma membranes [32]. The plasma membranes of lower eukaryotes (parasites), compared to vertebrates (hosts), have anionic phospholipids at their outer leaflet, as well as different levels of sterols and plasma membrane potential, which allow mechanisms of action based on disrupting membranes, as previously described for AMPs (for review, see [32]).

4. Antimicrobial Peptides from Marine versus Terrestrial Sources

In addition to the abiotic condition of the oceans, including pressure, temperature range, light penetration, oxygen and salt concentration, light radiation exposure, and a wide range of microbes (bacteria and viruses), marine organisms naturally produce chemically diverse bioactive compounds that are considered essential for the discovery and development of new pharmaceutical drugs [9,11,12,33,34,35,36,37]. Marine AMPs have a different structure than terrestrial AMPs because they have had to adapt to higher concentrations of free ions in the marine environment as a result of the high salt concentration [9]. Therefore, marine AMPs present various post-translational modifications, which are required for their stability and at the same time allow them to interact with target surfaces [9]. Among these post-translational modifications are bromination, chlorination, C-terminal amidation, a high content of certain amino acids (such as phenylalanine and arginine), the modification of single amino acids (such as 3-methylisoleucine), and the presence of D-amino acids [9]. Due to these modifications, marine AMPs have a different isoelectric point (pI), secondary structure, hydrophobicity, and amphipathicity than AMPs from terrestrial sources [9]. All of these features have attracted the interest of the pharmaceutical sector, and some marine peptides have already been approved by the United States Food and Drug Administration (FDA) as pharmaceuticals for human medicine [15,21]. However, the huge biodiversity in the oceans leads to the supposition that the majority of marine AMPs are still unknown.

5. Antimicrobial Peptides from Photosynthetic Organisms

Photosynthetic marine organisms include algae (micro- and macroalgae) and bacteria (cyanobacteria). Cyanobacteria, or blue-green algae, are a diverse group of prokaryotes that can produce huge numbers of AMPs through either ribosomal or non-ribosomal biosynthesis [15,38,39]. Non-ribosomal peptide (NRP) synthesis is carried out by NRP synthetases (NRPSs), which are organized in an array of modules constituting a separate functional entity that adds new building blocks to the polypeptide chain. In addition, each module can add modifications to the monomer [39,40,41,42]. Together with monomer modifications carried out by the additional domains from some NRPS modules, the incorporation of polyketide moieties by polyketide synthases (PKSs) increases the number of modifications, which in turn increases the variability of peptides [15,33,39,40,41,42,43].
These post-translational modifications are well documented in reviews by Rivas and Rojas [39] and Ribeiro et al. [40]. According to these reviews, cyclization between the amino and carboxylic terminals through an amide bond results in the formation of head-to-tail, chemically stable lactone, ether, thioether, and disulfide bonds, among others. This cyclization confers resistance to exopeptidase degradation, extends the half-life, and improves passive diffusion of the peptide across biological membranes. Moreover, cyclic AMPs can incorporate polyketide moieties or heterocycles. Peptides can also incorporate carbohydrates and lipids. Among the lipids, saturated and unsaturated fatty acids (lipo- and depsi-peptides) [9], cholesterol, phospholipids, and glucolipids are incorporated through an amide, thioether, or ester bond [30,40]. This lipidation contributes to the acquisition of the biologically active conformation of the peptide, increases its overall hydrophobicity, and provides the capability of anchoring to the target cell membrane and subsequent disruption of the phospholipid bilayer. The hydrophobicity of the peptides is also increased by N-methylation, which also confers rigidity to cyclic AMPs [39]. The presence on AMPs of D-amino acids instead of L-amino acids (stereoisomerism) makes peptides resistant to proteolysis and helps in the acquisition of an optimal conformation for their biological function. Finally, heterocyclation, which is the cyclation of serine, threonine, or cysteine residues, gives rise to oxazole (Ozl), methyl-oxazole (mOzl), thiazole (Tzl), methyloxazoline (mOzn), and thiazoline (Tzn) rings and provides greater rigidity to the peptide scaffold, which might be important in redox reactions [39].
Although the identification and characterization of the biological activity of discrete peptides is a quite novel field of study, a huge number of cyanobacterial AMPs with many interesting biological activities and post-translational modifications have been discovered (for review, see [38,39,40,41,42,43,44,45]). Due to the great variability of cyanobacterial AMPs, in this study we only included AMPs that display biological activities that could be important in aquaculture, such as antimicrobial, antioxidant, and immunoregulatory activities. Peptides with antitumor, anticoagulant, antihypertensive, antidiabetic, antiobesity, or antifatigue activities, among others, were not considered. Moreover, as the main aim of this review was to gain an overall view of AMPs suitable for nutraceutical and pharmaceutical use in aquaculture, and taking into account that simplicity is an important feature of high industrial production of nutraceuticals, we focused on AMPs with slight post-translational modifications, such as cyclic peptides and peptides with Tzl and Ozl groups. Table 1 summarizes the cyanobacterial peptides that are suitable for use in disease control in aquaculture, and their most relevant activities.
Contrary to cyanobacteria, which present ribosomal and non-ribosomal biosynthesis, eukaryotic algae only have ribosomal peptide (RP) biosynthesis capability. Peptides from micro- and macroalgae are encoded by genes and synthetized by the ribosomal machinery. Therefore, they present the 20 proteinogenic amino acids with few post-translational modifications [15,39,43]. As in the case of cyanobacterial AMPs, only those that have activities relevant to aquaculture were considered. Table 2 and Table 3 summarize the most interesting peptides from microalgae and macroalgae, respectively, for use in aquaculture.

6. The Use of Antimicrobial Peptides in Fish Aquaculture

Infectious diseases caused by viruses, bacteria, protists, and metazoans are among the main problems of modern aquaculture. The high population density and stressful conditions at fish farms are perfect for opportunistic infections [2]. Due to the negative effects of antibiotics on fish and the environment [2,5,6,7], immunostimulants are the best alternatives to these compounds [2]. In this sense, AMPs are promising candidates to replace antibiotics for combating infectious diseases and mitigating their negative effects in aquaculture [8]. AMPs play a crucial role in the immune system of living organisms as part of the first line of defense against a wide range of pathogens, including bacteria, viruses, fungi, and parasites [7,9,10,11,12,13,14]. AMPs have already been used in the animal husbandry and food industries, and it has been shown that they can enhance animal immunity and increase production performance [7]. For their part, algae play a key role as primary producers and as the basis of the marine food chain [98], and they are a valuable source of these compounds. For these reasons, AMPs from micro- and macroalgae can be valuable resources to prevent or treat infectious diseases that can be generated in fish farms without any negative effects on fish or the environment, and they can be good candidates as ingredients for functional fish diets.
Although AMPs are a promising alternative to antibiotics, there are certain aspects that have to be considered when using them as pharmaceuticals. Natural AMPs often lack efficacy compared with conventional antibiotics [9], as their activity and stability under certain conditions are sometimes suboptimal and difficult to regulate [7,9,40]. Moreover, due to their heterogeneous structure, isolating or chemically synthesizing them is difficult and expensive [9,11,40].
However, although AMPs present some disadvantages, it is possible to enhance their efficacy, activity, and stability by applying chemical modifications [9,40]. Given their amphipathic nature, modifications that allow reduced hydrophobicity while maintaining sufficient positive charge are essential to decrease interactions between AMPs and mammalian cells and increase the targeting of bacterial cells [9]. On the other hand, cyclization of linear peptides has been considered one of the most promising methods to enhance the pharmacological activity of AMPs. A cyclic structure provides a more rigid secondary structure and stability against hydrolyzation by exopeptidases in comparison to linear peptides [40]. Regarding the cost of synthesis, AMP genes can be cloned into vectors that allow efficient expression, increasing production yield and reducing costs [7]. Considering the disadvantages of using AMPs and the possible solutions, AMPs are good candidates for use in aquaculture, although further research on their synthesis and application is necessary.
Regarding the possible use of AMPs in aquaculture, it is important to note that besides their antibacterial, antifungal, antiviral, and antiparasitic activity, AMPs also present antioxidant [12] and immune modulatory activity, linking innate and adaptive immunity and triggering effective elimination of pathogens [10,11,12,13,14,33,99]. As we can see summarized in the tables, AMPs present powerful antioxidant activity through radical scavenging activity and increasing the activity of antioxidant enzymes, which is crucial for the stressful situations that can occur at fish farms. Moreover, AMPs can regulate the differentiation and activation of relevant immune cells such as macrophages, monocytes, dendritic cells, lymphocytes, cluster of differentiation (CD)4+ and CD8+ T cells and B cells, and natural killer (NK) cells [12,14] and have a role in cytokine and chemokine production and release, antigen presentation, inflammatory responses [9,10], endotoxin neutralization [11], and wound healing [11,14,99]. These molecules may also present pro-inflammatory [14,99] and anti-inflammatory [10,11,12] activity, as they can activate the inflammatory process through a wide range of molecular mechanisms, such as activation of the nuclear factor kappa B (NF-kB) and mitogen-activated protein kinase (MAPK)-dependent pathways [14], but they can also avoid an excessive inflammatory response by regulating cytokine release from macrophages and monocytes [12].

7. Algae as a Vehicle for Treating Fish with Antimicrobial Peptides

In general, in aquaculture, feeding strategies are considered that are the most suitable for treating aquatic animals. Apart from their nutritional value and based on their features, as previously reviewed, algae as a potential functional additive in aquafeed is attracting increasing interest [100,101]. To date, a large number of alga species have been identified [36,102], representing a huge source of AMPs with different biological activities [10,13,14,33,34,35,36,37,40,99,102]; this means they also have great potential for the development of functional feeds [34,98,103,104,105,106,107]. One of the easier approaches is to include them as an ingredient in aquaculture feeds. However, several disadvantages have to be taken into consideration. First, the variability in nutrient composition is a major limiting factor for any practical mass utilization of algae in aquafeed and is mainly influenced by culture conditions [97,108]. Culture conditions determine the rate of secondary metabolite production, including AMPs [101], and their optimization could be a good way to enrich algae on AMPs for further biotechnological applications. Second, the cell wall composition and structure of AMPs influence their digestibility [109], which influences their release in the gut and biological activity. Although several strategies for increasing the digestibility of microalgae have been studied [110,111], a simple, economical, and cost-effective method has not yet been developed. The presence of anti-nutritive compounds in some algae species also needs to be taken into account when using them as feed additives [109]. Despite these disadvantages, the benefits in terms of the growth, welfare, and immune activity of several species of marine fish fed with aquafeed containing different amounts of microalgae have been described [112,113,114,115]. Other studies have tested the antimicrobial activity of several algae extracts [116,117,118,119]. However, as far as we know, no studies have identified the molecules involved or covered the effects of algal AMPs on immune responses in fish.
Furthermore, the use of algae as an ingredient in functional feeds would also be important in the implementation of the bioeconomic strategy of the European Union based on the growth and sustainable development of bio-sectors and value-added products of interest [29,120]. Thus, it will be necessary to determine the optimal industrial protocol for normal or AMP-enriched algae production and marine AMP isolation and characterization in order to design further biotechnological applications to cope with the actual challenges faced by the aquaculture sector, mainly the availability of raw materials, biosecurity and disease control, food quality and security, and environmental sustainability.

8. Conclusions and Future Perspectives

AMPs are interesting candidates for use in aquaculture as substitutes for antibiotics but also for antiviral, antifungal, or antiparasitic therapy to control infectious diseases. In addition, their immunostimulant effect and antioxidant activity and the lack of negative effects on fish and the environment make them even more powerful tools in aquaculture. Among the marine organisms that are rich sources of AMPs are algae, including cyanobacteria, microalgae, and macroalgae. Some species are currently being produced on an industrial scale and were previously used in the development of functional diets for some fish species in aquaculture. However, taking into account the wide variety of algae, culture species, and pathogens, further investigations are needed to identify and characterize algal AMPs and their application as an ingredient in functional diets or their isolation and subsequent use as pharmaceuticals.

Author Contributions

All authors contributed at different levels to this review. J.M.G.-B. and E.C.-P. carried out the literature review and wrote the original draft of the manuscript. J.M.G.-B. handled the optimal visualization. M.A. and E.C.-P. provided financial resources. All authors have read and agreed to the published version of the manuscript.

Funding

This work was financed by the European Union NextGenerationEU/PRTR, MCIN/AEI 10.13039/501100011033 and Fundación Séneca (ThinkInAzul programme), the MCIN/AEI 10.13039/501100011033 and “EDRF a way of making Europe” (PID2021-122287OB-C22), and by the Ministry of Universities through subsidies to public universities for the requalification of the Spanish university system, Margarita Salas Grants, managed by the University of Murcia.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data sharing not applicable.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. FAO. The State of World Fisheries and Aquaculture; FAO: Rome, Italy, 2022. [Google Scholar]
  2. Lafferty, K.D.; Harvell, C.D.; Conrad, J.M.; Friedman, C.S.; Kent, M.L.; Kuris, A.M.; Powell, E.N.; Rondeau, D.; Saksida, S.M. Infectious diseases affect marine fisheries and aquaculture economics. Ann. Rev. Mar. Sci. 2015, 7, 471–496. [Google Scholar] [CrossRef]
  3. Long, L.; Zhang, H.; Ni, Q.; Liu, H.; Wu, F.; Wang, X. Effects of stocking density on growth, stress, and immune responses of juvenile Chinese sturgeon (Acipenser sinensis) in a recirculating aquaculture system. Comp. Bio. Phys. Part C Toxic. Pharm. 2019, 219, 25–34. [Google Scholar] [CrossRef] [PubMed]
  4. Onxayvieng, K.; Piria, M.; Fuka, M.M.; Gavrilović, A.; Liang, X.; Liu, L.; Tang, R.; Li, L.; Li, D. High stocking density alters growth performance, blood biochemical profiles, and hepatic antioxidative capacity in gibel carp (Carassius gibelio). Fish. Phys. Biochem. 2021, 47, 203–212. [Google Scholar] [CrossRef] [PubMed]
  5. Chen, J.; Sun, R.; Pan, C.; Sun, Y.; Mai, B.; Li, Q.X. Antibiotics and food safety in aquaculture. J. Agric. Food. Chem. 2020, 68, 11908–11919. [Google Scholar] [CrossRef] [PubMed]
  6. Hossain, A.; Habibullah-Al-Mamun, M.; Nagano, I.; Masunaga, S.; Kitazawa, D.; Matsuda, H. Antibiotics, antibiotic-resistant bacteria, and resistance genes in aquaculture: Risks, current concern, and future thinking. Env. Sci. Poll. Res. Int. 2022, 29, 11054–11075. [Google Scholar] [CrossRef] [PubMed]
  7. Zhang, R.; Xu, L.; Dong, C. Antimicrobial peptides: An overview of their structure, function and mechanism of action. Prot. Pept. Lett. 2022, 29, 641–650. [Google Scholar] [CrossRef]
  8. Katzenback, B.A. Antimicrobial peptides as mediators of innate immunity in teleosts. Biology 2015, 4, 607–639. [Google Scholar] [CrossRef] [PubMed]
  9. Falanga, A.; Lombardi, L.; Franci, G.; Vitiello, M.; Iovene, M.R.; Morelli, G.; Galdiero, M.; Galdiero, S. Marine antimicrobial peptides: Nature provides templates for the design of novel compounds against pathogenic bacteria. Int. J. Mol. Sci. 2016, 17, 785. [Google Scholar] [CrossRef] [PubMed]
  10. De Mandal, S.; Panda, A.K.; Murugan, C.; Xu, X.; Kumar, N.S.; Jin, F. Antimicrobial peptides: Novel source and biological function with a special focus on entomopathogenic nematode/nacterium symbiotic complex. Front. Micro. 2021, 12, 555022. [Google Scholar] [CrossRef]
  11. Van, L.T.H.; Kim, S.W. Antimicrobial peptides from marine sources. Curr. Prot. Pept. Sci. 2013, 14, 205–211. [Google Scholar]
  12. Wu, R.; Patocka, J.; Nepovimova, E.; Oleksak, P.; Valis, M.; Wu, W.; Kuca, K. Marine invertebrate peptides: Antimicrobial peptides. Front. Microbiol. 2021, 12, 785085. [Google Scholar] [CrossRef] [PubMed]
  13. Magrone, T.; Russo, M.A.; Jirillo, E. Antimicrobial peptides: Phylogenic sources and biological activities. First of two parts. Curr. Pharm. Des. 2018, 24, 1043–1053. [Google Scholar] [CrossRef] [PubMed]
  14. Kang, H.K.; Lee, H.H.; Seo, C.H.; Park, Y. Antimicrobial and immunomodulatory properties and applications of marine-derived proteins and peptides. Mar. Drugs 2019, 17, 350. [Google Scholar] [CrossRef] [PubMed]
  15. Rojas, V.; Rivas, L.; Cárdenas, C.; Guzmán, F. Cyanobacteria and eukaryotic microalgae as emerging sources of antibacterial peptides. Molecules 2020, 25, 5804. [Google Scholar] [CrossRef] [PubMed]
  16. Aragão, C.; Gonçalves, A.T.; Costas, B.; Azeredo, R.; Xavier, M.J.; Engrola, S. Alternative proteins for fish diets: Implications beyond growth. Animals 2022, 12, 1211. [Google Scholar] [CrossRef]
  17. Ansari, F.A.; Guldhe, A.; Gupta, S.K.; Rawat, I.; Bux, F. Improving the feasibility of aquaculture feed by using microalgae. Environ. Sci. Pollut. Res. Int. 2021, 28, 43234–43257. [Google Scholar] [CrossRef]
  18. Ayswaria, R.; Vijayan, J.; Nathan, V.K. Antimicrobial peptides derived from microalgae for combating antibiotic resistance: Current status and prospects. Cell Biochem. Funct. 2023, 41, 142–151. [Google Scholar] [CrossRef]
  19. Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial peptides: Classification, design, application and research progress in multiple fields. Front. Microbiol. 2020, 11, 2559. [Google Scholar] [CrossRef]
  20. Wang, G.; Li, X.; Wang, Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef]
  21. Giordano, D.; Costantini, M.; Coppola, D.; Lauritano, C.; Pons, L.N.; Ruocco, N.; di Prisco, G.; Ianora, A.; Verde, C. Biotechnological applications of bioactive peptides from marine sources. Adv. Micro. Phys. 2018, 73, 171–220. [Google Scholar]
  22. Vizioli, J.; Salzet, M. Antimicrobial peptides versus parasitic infections? Trends Parasitol. 2022, 18, 475–476. [Google Scholar] [CrossRef] [PubMed]
  23. Boas, L.C.P.V.; Campos, M.L.; Berlanda, R.L.A.; Neves, N.d.C.; Franco, O.L. Antiviral peptides as promising therapeutic drugs. Cell. Mol. Life Sci. 2019, 76, 3525–3542. [Google Scholar] [CrossRef] [PubMed]
  24. Mohan, K.V.K.; Rao, S.S.; Atreya, C.D. Antiviral activity of selected antimicrobial peptides against vaccinia virus. Anti. Res. 2010, 86, 306–311. [Google Scholar] [CrossRef] [PubMed]
  25. Valero, Y.; Saraiva-Fraga, M.; Costas, B.; Guardiola, F.A. Antimicrobial peptides from fish: Beyond the fight against pathogens. Rev. Aquac. 2018, 12, 224–253. [Google Scholar] [CrossRef]
  26. Wang, Y.D.; Kung, C.W.; Chen, J.Y. Antiviral activity by fish antimicrobial peptides of epinecidin-1 and hepcidin 1–5 against nervous necrosis virus in medaka. Peptides 2010, 31, 1026–1033. [Google Scholar] [CrossRef] [PubMed]
  27. Chiou, P.P.; Lin, C.M.; Perez, L.; Chen, T.T. Effect of cecropin B and a synthetic analogue on propagation of fish viruses in vitro. Mar. Biotechnol. 2002, 4, 294–302. [Google Scholar] [CrossRef]
  28. Gordon, Y.J.; Romanowski, E.G.; Shanks, R.M.Q.; Yates, K.A.; Hinsley, H.; Pereira, H.A. CAP37-derived antimicrobial peptides have in vitro antiviral activity against adenovirus and herpes simplex virus type 1. Curr. Eye. Res. 2009, 34, 241–249. [Google Scholar] [CrossRef]
  29. Chia, T.J.; Wu, Y.C.; Chen, J.Y.; Chi, S.C. Antimicrobial peptides (AMP) with antiviral activity against fish nodavirus. Fish Shell. Immunol. 2010, 28, 434–439. [Google Scholar] [CrossRef]
  30. Dugan, A.S.; Maginnis, M.S.; Jordan, J.A.; Gasparovic, M.L.; Manley, K.; Page, R. Human alpha-defensins inhibit BK virus infection by aggregating virions and blocking binding to host cells. J. Biol. Chem. 2008, 283, 31125–31132. [Google Scholar] [CrossRef]
  31. Matanic, V.C.A.; Castilla, V. Antiviral activity of antimicrobial cationic peptides against Junin virus and herpes simplex virus. Int. J. Anti. Agents 2004, 23, 382–389. [Google Scholar] [CrossRef]
  32. Rivas, L.; Luque-Ortega, J.R.; Andreu, D. Amphibian antimicrobial peptides and Protozoa: Lessons from parasites. Biochim. Biophys. Acta Biomembr. 2008, 1788, 1570–1581. [Google Scholar] [CrossRef]
  33. Anjum, K.; Abbas, S.Q.; Akhter, N.; Shagufta, B.I.; Shah, S.A.A.; ul Hassan, S.S. Emerging biopharmaceuticals from bioactive peptides derived from marine organisms. Chem. Biol. Drugs Des. 2017, 90, 12–30. [Google Scholar] [CrossRef] [PubMed]
  34. Kim, S.K.; Wijesekara, I. Development and biological activities of marine-derived bioactive peptides: A review. J. Funct. Foods 2010, 2, 1–9. [Google Scholar] [CrossRef]
  35. Ruiz-Ruiz, F.; Mancera-Andrade, E.I.; Iqbal, H.M. Marine-derived bioactive peptides for biomedical sectors: A review. Prot. Pept. Lett. 2017, 24, 109–117. [Google Scholar] [CrossRef] [PubMed]
  36. Caprani, M.C.; Healy, J.; Slattery, O.; O’Keeffe, J. Using an ensemble to identify and classify macroalgae antimicrobial peptides. Int. Sci. 2021, 13, 321–333. [Google Scholar] [CrossRef] [PubMed]
  37. Xing, L.; Wang, Z.; Hao, Y.; Zhang, W. Marine products as a promising resource of bioactive peptides: Update of extraction strategies and their physiological regulatory effects. J. Agric. Food Chem. 2022, 70, 3081–3095. [Google Scholar] [CrossRef]
  38. Fidor, A.; Konkel, R.; Mazur-Marzec, H. Bioactive peptides produced by cyanobacteria of the genus Nostoc: A review. Mar. Drugs 2019, 17, 561. [Google Scholar] [CrossRef]
  39. Rivas, L.; Rojas, V. Cyanobacterial peptides as a tour de force in the chemical space of antiparasitic agents. Arch. Biochem. Biophys. 2019, 664, 24–39. [Google Scholar] [CrossRef] [PubMed]
  40. Ribeiro, R.; Pinto, E.; Fernandes, C.; Sousa, E. Marine cyclic peptides: Antimicrobial activity and synthetic strategies. Mar. Drugs 2022, 20, 397. [Google Scholar] [CrossRef]
  41. Silva-Stenico, M.E.; Silva, C.S.P.; Lorenzi, A.S.; Shishidoa, T.K.; Etchegaray, A.; Lira, S.P.; Moraes, L.A.B.; Fiore, M.F. Non-ribosomal peptides produced by Brazilian cyanobacterial isolates with antimicrobial activity. Micro. Res. 2011, 166, 161–175. [Google Scholar] [CrossRef] [PubMed]
  42. Srivastava, R.; Prajapati, R.; Kanda, T.; Yadav, S.; Singh, N.; Yadav, S.; Mishra, R.; Atri, N. Phycochemistry and bioactivity of cyanobacterial secondary metabolites. Mol. Biol. Rep. 2022, 49, 11149–11167. [Google Scholar] [CrossRef]
  43. Raja, R.; Hemaiswarya, S.; Ganesan, V.; Carvalho, I.S. Recent developments in therapeutic applications of cyanobacteria. Crit. Rev. Micro. 2016, 42, 394–405. [Google Scholar] [CrossRef] [PubMed]
  44. Hájek, J.; Bieringer, S.; Voráčová, K.; Macho, M.; Saurav, K.; Delawská, K.; Divoká, P.; Fišer, R.; Mikušvá, G.; Cheel, J.; et al. Semi-synthetic puwainaphycin/minutissamide cyclic lipopeptides with improved antifungal activity and limited cytotoxicity. RSC Adv. 2021, 11, 30873–30886. [Google Scholar] [CrossRef] [PubMed]
  45. Moore, R.E. Cyclic peptides and depsipeptides from cyanobacteria: A review. J. Ind. Microbiol. 1996, 16, 134–143. [Google Scholar] [CrossRef] [PubMed]
  46. Ali, D.M.; Saalis, J.M.; Sathya, R.; Irfan, N.; Kim, J.W. An evidence of microalgal peptides to target spike protein of COVID-19: In silico approach. Micro. Path. 2021, 160, 105189. [Google Scholar]
  47. Sathya, R.; Ali, D.M.; Nousheen, M.G.M.; Vasimalai, N.; Thajuddin, N.; Kim, J.W. An investigation of pepsin hydrolysate of short antibacterial peptides derived from Limnospira sp. Appl. Biochem. Biotech. 2022, 194, 5580–5593. [Google Scholar]
  48. Ishida, K.; Matsuda, H.; Murakami, M.; Yamaguchi, K. Kawaguchipeptin B, an antibacterial cyclic undecapeptide from the cyanobacterium Microcystis aeruginosa. J. Nat. Prod. 1997, 60, 724–726. [Google Scholar] [CrossRef]
  49. Banker, R.; Carmeli, S. Tenuecyclamides A–D, cyclic hexapeptides from the cyanobacterium Nostoc spongiaeforme var. tenue. J. Nat. Prod. 1998, 61, 1248–1251. [Google Scholar] [CrossRef]
  50. Jaki, B.; Zerbe, O.; Heilmann, J.; Sticher, O. Two novel cyclic peptides with antifungal activity from the cyanobacterium Tolypothrix byssoidea (EAWAG 195). J. Nat. Prod. 2001, 64, 154–158. [Google Scholar] [CrossRef]
  51. Linington, R.G.; González, J.; Urena, L.D.; Romero, L.I.; Ortega-Barría, E.; Gerwick, W.H. Venturamides A and B: Antimalarial constituents of the panamanian marine cyanobacterium Oscillatoria sp. J. Nat. Prod. 2007, 70, 397–401. [Google Scholar] [CrossRef]
  52. Portmann, C.; Blom, J.F.; Gademann, K.; Jüttner, F. Aerucyclamides A and B: Isolation and synthesis of toxic ribosomal heterocyclic peptides from the cyanobacterium Microcystis aeruginosa PCC 7806. J. Nat. Prod. 2008, 71, 1193–1196. [Google Scholar] [CrossRef] [PubMed]
  53. Portmann, C.; Blom, J.F.; Kaiser, M.; Brun, R.; Jüttner, F.; Gademann, K. Isolation of aerucyclamides C and D and structure revision of microcyclamide 7806A: Heterocyclic ribosomal peptides from Microcystis aeruginosa PCC7806 and their antiparasite evaluation. J. Nat. Prod. 2008, 71, 1891–1896. [Google Scholar] [CrossRef] [PubMed]
  54. Yoon, Y.; Lee, C. Partial purification and characterization of a novel antifungal compound against Aspergillus spp. from Synechocystis sp. PCC 6803. Biotech. Bioproc. Eng. 2009, 14, 383–390. [Google Scholar] [CrossRef]
  55. Raveh, A.; Carmeli, S. Aeruginazole A, a novel thiazole-containing cyclopeptide from the cyanobacterium Microcystis sp. Org. Lett. 2010, 12, 3536–3539. [Google Scholar] [CrossRef]
  56. Adiv, S.; Ahronov-Nadborny, R.; Carmeli, S. New aeruginazoles, a group of thiazole-containing cyclic peptides from Microcystis aeruginosa blooms. Tetrahedron 2012, 68, 1376–1383. [Google Scholar] [CrossRef]
  57. Vo, T.S.; Ryu, B.M.; Kim, S.K. Purification of novel anti-inflammatory peptides from enzymatic hydrolysate of the edible microalgal Spirulina maxima. J. Funct. Foods 2013, 5, 1336–1346. [Google Scholar] [CrossRef]
  58. Vo, T.S.; Ngo, D.H.; Kang, K.H.; Park, S.J.; Kim, S.K. The role of peptides derived from Spirulina maxima in downregulation of Fcepsilon RI-mediated allergic responses. Mol. Nutr. Food Res. 2014, 58, 2226–2234. [Google Scholar] [CrossRef]
  59. Kim, N.H.; Jung, S.H.; Kim, J.; Kim, S.H.; Ahn, H.J.; Song, K.B. Purification of an iron-chelating peptide from spirulina protein hydrolysates. J. Appl. Biol. Chem. 2014, 57, 91–95. [Google Scholar] [CrossRef]
  60. Portmann, C.; Sieber, S.; Wirthensohn, S.; Blom, J.F.; da Silva, L.; Baudat, E.; Kaiser, M.; Brun, R.; Gademann, K. Balgacyclamides, antiplasmodial heterocyclic peptides from Microcystis aeruguinosa EAWAG 251. J. Nat. Prod. 2014, 77, 557–562. [Google Scholar] [CrossRef]
  61. Sun, Y.; Chang, R.; Li, O.; Li, B. Isolation and characterization of an antibacterial peptide from protein hydrolysates of Spirulina platensis. Eur. Food. Res. Technol. 2016, 242, 685–692. [Google Scholar] [CrossRef]
  62. Yu, J.; Hu, Y.; Xue, M.; Dun, Y.; Li, S.; Peng, N.; Liang, Y.; Zhao, S. Purification and identification of antioxidant peptides from enzymatic hydrolysate of Spirulina platensis. J. Microbiol. Biotechnol. 2016, 26, 1216–1223. [Google Scholar] [CrossRef] [PubMed]
  63. Safitri, N.M.; Herawati, E.Y.; Hsu, J.L. Antioxidant activity of purified active peptide derived from Spirulina platensis enzymatic hydrolysates. Res. J. Life Sci. 2017, 4, 119–128. [Google Scholar] [CrossRef]
  64. Sannasimuthu, A.; Kumaresan, V.; Pasupuleti, M.; Paray, B.A.; Al-Sadoon, M.K.; Arockiaraj, J. Radical scavenging property of a novel peptide derived from C-terminal SOD domain of superoxide dismutase enzyme in Arthrospira platensis. Alg. Res. 2018, 35, 519–529. [Google Scholar] [CrossRef]
  65. Zeng, Q.H.; Fan, X.D.; Zheng, Q.P.; Wang, J.J.; Zhang, X.W. Anti-oxidant, hemolysis inhibition, and collagen-stimulating activities of a new hexapeptide derived from Arthrospira (Spirulina) platensis. J. Appl. Phycol. 2018, 30, 1655–1665. [Google Scholar] [CrossRef]
  66. Sannasimuthu, A.; Arockiaraj, J. Intracellular free radical scavenging activity and protective role of mammalian cells by antioxidant peptide from thioredoxin disulfide reductase of Arthrospira platensis. J. Funct. Foods 2019, 61, 103513. [Google Scholar] [CrossRef]
  67. Sannasimuthu, A.; Kumaresan, V.; Anilkumar, S.; Pasupuleti, M.; Ganesh, M.R.; Mala, K.; Paray, B.A.; Al-Sadoon, M.K.; Albeshr, M.F.; Arockiaraj, J. Design and characterization of a novel Arthrospira platensis glutathione oxidoreductase-derived antioxidant peptide GM15 and its potent anti-cancer activity via caspase-9 mediated apoptosis in oral cancer cells. Free Radic. Biol. Med. 2019, 135, 198–209. [Google Scholar] [CrossRef] [PubMed]
  68. Sarkar, P.; Stef, R.V.; Pasupuleti, M.; Paray, B.A.; Al-Sadoon, M.K.; Arockiaraj, J. Antioxidant molecular mechanism of adenosyl homocysteinase from cyanobacteria and its wound healing process in fbroblast cells. Mol. Biol. Rep. 2020, 47, 1821–1834. [Google Scholar] [CrossRef]
  69. Wang, K.; Luo, Q.; Hong, H.; Liu, H.; Luo, Y. Novel antioxidant and ACE inhibitory peptide identified from Arthrospira platensis protein and stability against thermal/pH treatments and simulated gastrointestinal digestion. Int. Food. Res. 2020, 139, 109908. [Google Scholar] [CrossRef]
  70. Zeng, Q.H.; Wang, J.J.; Zhang, Y.H.; Song, Y.Q.; Liang, J.L.; Zhang, X.W. Recovery and identification bioactive peptides from protein isolate of Spirulina platensis and their in vitro effectiveness against oxidative stress-induced erythrocyte hemolysis. J. Sci. Food. Agric. 2020, 100, 3776–3782. [Google Scholar] [CrossRef]
  71. Velayutham, M.; Ojha, B.; Issac, P.K.; Lite, C.; Guru, A.; Pasupuleti, M.; Arasu, M.V.; Al-Dhabi, N.A.; Arockiaraj, J. NV14 from serine O-acetyltransferase of cyanobacteria influences the antioxidant enzymes in vitro cells, gene expression against H2O2 and other responses in vivo zebrafish larval model. Cell Biol. Int. 2021, 45, 2331. [Google Scholar] [CrossRef]
  72. Guzmán, F.; Wong, G.; Román, T.; Cárdenas, C.; Alvárez, C.; Schmitt, P.; Albericio, F.; Rojas, V. Identification of antimicrobial peptides from the microalgae Tetraselmis suecica (Kylin) butcher and bactericidal activity improvement. Mar. Drugs 2019, 17, 453. [Google Scholar] [CrossRef] [PubMed]
  73. Sheih, I.C.; Wu, T.K.; Fang, T.J. Antioxidant properties of a new antioxidative peptide from algae protein waste hydrolysate in different oxidation systems. Bioresour. Technol. 2009, 100, 3419–3425. [Google Scholar] [CrossRef] [PubMed]
  74. Sheih, I.C.; Fang, T.J.; Wu, T.K.; Lin, P.H. Anticancer and antioxidant activities of the peptide fraction from algae protein in waste. J. Agric. Food Chem. 2010, 58, 1202–1207. [Google Scholar] [CrossRef]
  75. Cherng, J.Y.; Liu, C.C.; Shen, C.R.; Lin, H.H.; Shih, M.F. Beneficial effects of chlorella-11 peptide on blocking LPS-induced macrophage activation and alleviating thermal injury-induced inflammation in rats. Int. J. Immunopath. Pharm. 2010, 23, 811–820. [Google Scholar] [CrossRef]
  76. Shih, M.F.; Chen, L.C.; Cherng, J.Y. Chlorella 11-peptide inhibits the production of macrophage-induced adhesion molecules and reduces endothelin-1 expression and endothelial permeability. Mar. Drugs 2013, 11, 3861–3874. [Google Scholar] [CrossRef]
  77. Chen, C.L.; Liou, S.F.; Chen, S.J.; Shih, M.F. Protective effects of chlorella-derived peptide on UVB-induced production of MMP-1 and degradation of procollagen genes in human skin fibroblasts. Reg. Toxic. Pharm. 2011, 60, 112–119. [Google Scholar] [CrossRef] [PubMed]
  78. Shih, M.F.; Cherng, J.Y. Protective effects of chlorella-derived peptide against UVC-induced cytotoxicity through inhibition of caspase-3 activity and reduction of the expression of phosphorylated FADD and cleaved PARP-1 in skin fibroblasts. Molecules 2012, 17, 9116–9128. [Google Scholar] [CrossRef]
  79. Ryu, B.M. A Peptide Derived from Microalga, Pavlova lutheri, Fermented by Candida rugopelliculosa Induces Myofibroblasts Differentiation in Human Dermal Fibroblasts. Ph.D. Thesis, Department of Chemistry, Pukyoung National University, Busan, Republic of Korea, 2011. [Google Scholar]
  80. Ko, S.C.; Kim, D.; Jeon, Y.J. Protective effect of a novel antioxidative peptide purified from a marine Chlorella ellipsoidea protein against free radical-induced oxidative stress. Food Chem. Toxic. 2012, 50, 2294–2302. [Google Scholar] [CrossRef]
  81. Kang, K.H.; Qian, Z.J.; Ryu, B.; Karadeni, F.; Daekyunge, K.; Kim, S.W. Antioxidant peptides from protein hydrolysate of microalgae Navicula incerta and their protective effects in Hepg2/CYP2E1 cells induced by ethanol. Phytother. Res. 2012, 26, 1555–1563. [Google Scholar] [CrossRef] [PubMed]
  82. Kang, K.H.; Qian, Z.J.; Ryu, B.; Karadeniz, F.; Kim, D.; Kim, S.K. Hepatic fibrosis inhibitory effect of peptides isolated from Navicula incerta on TGF-β1 induced activation of LX-2 human hepatic stellate cells. Prev. Nutr. Food Sci. 2013, 18, 124–132. [Google Scholar] [CrossRef]
  83. Nguyen, M.H.T.; Qian, Z.J.; Nguyen, V.T.; Choi, I.W.; Heo, S.J.; Oh, C.H.; Kang, D.H.; Kim, G.H.; Jung, W.K. Tetrameric peptide purified from hydrolysates of biodiesel byproducts of Nannochloropsis oculata induces osteoblastic differentiation through MAPK and Smad pathway on MG-63 and D1 cells. Proc. Biochem. 2013, 48, 1387–1394. [Google Scholar] [CrossRef]
  84. Oh, G.W.; Ko, S.C.; Heo, S.Y.; Nguyen, V.T.; Kim, G.H.; Jang, C.H.; Park, W.S.; Choi, I.W.; Qian, Z.J.; Jung, W.K. A novel peptide purified from the fermented microalga Pavlova lutheri attenuates oxidative stress and melanogenesis in B16F10 melanoma cells. Proc. Biochem. 2015, 50, 1318–1326. [Google Scholar] [CrossRef]
  85. Montone, C.M.; Capriotti, A.L.; Cavaliere, C.; la Barbera, G.; Piovesana, S.; Chiozzi, R.Z.; Laganà, A. Peptidomic strategy for purification and identification of potential ACE-inhibitory and antioxidant peptides in Tetradesmus obliquus microalgae. Anal. Bioanal. Chem. 2018, 410, 3573–3586. [Google Scholar] [CrossRef]
  86. Xia, E.; Zhai, L.; Huang, Z.; Liang, H.; Yang, H.; Song, G.; Tang, H. Optimization and identification of antioxidant peptide from underutilized Dunaliella salina protein: Extraction, in vitro gastrointestinal digestion and fractionation. BioMed Res. Int. 2019, 6424651. [Google Scholar] [CrossRef]
  87. Duque-Salazar, G.; Mendez-Otalvaro, E.; Ceballos-Arroyo, A.M.; Orduz, S. Design of antimicrobial and cytolytic peptides by computational analysis of bacterial, algal, and invertebrate proteomes. Amino Acids 2020, 52, 1403–1412. [Google Scholar] [CrossRef]
  88. Ennamany, R.; Saboureau, D.; Mekideche, N.; Creppy, E.E. SECMA 1, a mitogenic hexapeptide from Ulva algeae modulates the production of proteoglycans and glycosaminoglycans in human foreskin fibroblast. Hum. Exp. Toxic. 1998, 17, 18–22. [Google Scholar] [CrossRef] [PubMed]
  89. Fitzgerald, C.; Gallagher, E.; O’Connor, P.; Prieto, J.; MoraSoler, L.; Grealy, M.; Hayes, M. Development of a seaweed derived platelet activating factor acetyl hydrolase (PAF-AH) inhibitory hydrolysate, synthesis of inhibitory peptides and assessment of their toxicity using the zebrafish larvae assay. Peptides 2013, 50, 119–124. [Google Scholar] [CrossRef]
  90. Beaulieu, L.; Bondu, S.; Doiron, K.; Rioux, L.; Turgeon, S.L. Characterization of antibacterial activity from protein hydrolysates of the macroalga Saccharina longicruris and identification of peptides implied in bioactivity. J. Funct. Foods 2015, 17, 685–697. [Google Scholar] [CrossRef]
  91. Lee, M.K.; Kim, I.H.; Choi, Y.H.; Choi, J.W.; Kim, Y.M.; Nam, T.J. The proliferative effects of Pyropia yezoensis peptide on IEC-6 cells are mediated through the epidermal growth factor receptor signaling pathway. Int. J. Mol. Med. 2015, 35, 909–914. [Google Scholar] [CrossRef]
  92. Lee, M.K.; Kim, I.H.; Choi, Y.H.; Nam, T.J. A peptide from Porphyra yezoensis stimulates the proliferation of IEC-6 cells by activating the insulin-like growth factor I receptor signaling pathway. Int. J. Mol. Med. 2015, 35, 533–538. [Google Scholar] [CrossRef]
  93. Lee, H.A.; Kim, I.H.; Nam, T.J. Bioactive peptide from Pyropia yezoensis and its anti-inflammatory activities. Int. J. Mol. Med. 2015, 36, 1701–1706. [Google Scholar] [CrossRef]
  94. Harnedy, P.A.; O’Keeffe, M.B.; FitzGerald, R.J. Fractionation and identification of antioxidant peptides from an enzymatically hydrolysed Palmaria palmata protein isolate. Food Res. Int. 2017, 100, 416–422. [Google Scholar] [CrossRef]
  95. Kim, E.Y.; Choi, Y.H.; Nam, T.J. Identification and antioxidant activity of synthetic peptides from phycobiliproteins of Pyropia yezoensis. Int. J. Mol. Med. 2018, 42, 789–798. [Google Scholar] [CrossRef]
  96. Cermeño, M.; Stack, J.; Tobin, P.R.; O’Keeffe, M.B.; Harnedy, P.A.; Stengel, D.B.; FitzGerald, R.J. Peptide identification from a Porphyra dioica protein hydrolysate with antioxidant, angiotensin converting enzyme and dipeptidyl peptidase IV inhibitory activities. Food Funct. 2019, 10, 3421–3429. [Google Scholar] [CrossRef] [PubMed]
  97. Zhang, X.; Cao, D.; Sun, X.; Sun, S.; Xu, N. Preparation and identification of antioxidant peptides from protein hydrolysate of marine alga Gracilariopsis lemaneiformis. J. Appl. Phycol. 2019, 31, 2585–2596. [Google Scholar] [CrossRef]
  98. Samarakoon, K.; Jeon, Y.J. Bio-functionalities of proteins derived from marine algae. A review. Food Res. Int. 2012, 48, 948–960. [Google Scholar] [CrossRef]
  99. Kang, H.K.; Seo, C.H.; Park, Y. Marine peptides and their anti-infective activities. Mar. Drugs 2015, 13, 618–654. [Google Scholar] [CrossRef]
  100. Brown, M.R.; Jeffrey, S.W.; Volkman, J.K.; Dunstan, G.A. Nutritional properties of microalgae for mariculture. Aquaculture 1997, 151, 315–331. [Google Scholar] [CrossRef]
  101. Camacho, F.; Macedo, A.; Malcata, F. Potential Industrial Applications and Commercialization of Microalgae in the Functional Food and Feed Industries: A Short Review. Mar. Drugs 2019, 17, 312. [Google Scholar] [CrossRef]
  102. Silva, A.; Silva, S.A.; Carpena, M.; Garcia-Oliveira, P.; Gullón, P.; Barroso, M.F.; Prieto, M.A.; Simal-Gandara, J. Macroalgae as a source of valuable antimicrobial compounds: Extraction and applications. Antibiotics 2020, 9, 642. [Google Scholar] [CrossRef]
  103. Sathya, R.; Ali, D.M.; Saalis, J.M.; Kim, J.W. A systemic review on microalgal peptides: Bioprocess and sustainable applications. Sustainability 2021, 13, 3262. [Google Scholar] [CrossRef]
  104. Harnedy, P.A.; FitzGerald, R.J. Bioactive proteins, peptides, and amino acids from macroalgae. J. Phycol. 2011, 47, 218–232. [Google Scholar] [CrossRef]
  105. Talero, E.; García-Mauriño, S.; Ávila-Román, J.; Rodríguez-Luna, A.; Alcaide, A.; Motilva, V. Bioactive compounds isolated from microalgae in chronic inflammation and cancer. Mar. Drugs 2015, 13, 6152–6209. [Google Scholar] [CrossRef] [PubMed]
  106. Echave, J.; Fraga-Corral, M.; Garcia-Perez, P.; Popovic-Djordjevic, J.; Avdovic, E.H.; Radulovic, M.; Xiao, J.; Prieto, M.A.; Simal-Gandara, J. Seaweed protein hydrolysates and bioactive peptides: Extraction, purification, and applications. Mar. Drugs 2021, 19, 500. [Google Scholar] [CrossRef]
  107. Echave, J.; Otero, P.; Garcia-Oliveira, P.; Munekata, P.E.S.; Pateiro, M.; Lorenzo, J.M.; Simal-Gandara, J.; Prieto, M.A. Seaweed-derived proteins and peptides: Promising marine bioactives. Antioxidants 2022, 11, 176. [Google Scholar] [CrossRef]
  108. Joubert, Y.; Fleurence, J. Simultaneous extraction of proteins and DNA by an enzymatic treatment of the cell wall of Palmaria palmata (Rhodophyta). J. Appl. Phycol. 2008, 20, 55–61. [Google Scholar] [CrossRef]
  109. Vizcaíno, A.J.; Galafat, A.; Sáez, M.I.; Martínez, T.F.; Alarcón, F.J. Partial characterization of protease inhibitors of Ulva ohnoi and their effect on digestive proteases of marine fish. Mar. Drugs 2020, 18, 319. [Google Scholar] [CrossRef] [PubMed]
  110. Teuling, E.; Wierenga, P.A.; Agboola, J.O.; Gruppen, H.; Schrama, J.W. Cell wall disruption increases bioavailability of Nannochloropsis gaditana nutrients for juvenile Nile tilapia (Oreochromis niloticus). Aquaculture 2019, 499, 269–282. [Google Scholar] [CrossRef]
  111. Tibbetts, S.M.; Mann, J.; Dumas, A. Apparent digestibility of nutrients, energy, essential amino acids and fatty acids of juvenile Atlantic salmon (Salmo salar L.) diets containing whole-cell or cell-ruptured Chlorella vulgaris meals at five dietary inclusion levels. Aquaculture 2017, 481, 25–39. [Google Scholar] [CrossRef]
  112. Ayala, M.D.; Galián, C.; Fernández, V.; Chaves-Pozo, E.; García de la Serrana, D.; Sáez, M.I.; Galafaz Díaz, A.; Alarcón, F.J.; Martínez, T.F.; Arizcun, M. Influence of Low Dietary Inclusion of the Microalga Nannochloropsis gaditana (Lubián 1982) on Performance, Fish Morphology, and Muscle Growth in Juvenile Gilthead Seabream (Sparus aurata). Animals 2020, 10, 2270. [Google Scholar] [CrossRef]
  113. Galafat, A.; Vizcaíno, A.J.; Sáez, M.I.; Martínez, T.F.; Arizcun, M.; Chaves-Pozo, E.; Alarcón, F.J. Assessment of dietary inclusion of crude or hydrolysed Arthrospira platensis biomass in starter diets for gilthead seabream (Sparus aurata). Aquaculture 2022, 548, 737680–737692. [Google Scholar] [CrossRef]
  114. Sáez, M.I.; Galafat, A.; Vizcaíno, A.J.; Chaves-Pozo, E.; Ayala, M.D.; Arizcun, M.; Alarcón, F.J.; Suárez, M.D.; Martínez, T.F. Evaluation of Nannochloropsis gaditana raw and hydrolysed biomass at low inclusion level as dietary functional additive for gilthead seabream (Sparus aurata) juveniles. Aquaculture 2022, 556, 738288–738301. [Google Scholar] [CrossRef]
  115. Villar-Navarro, E.; Ruiz, J.; Garrido-Pérez, C.; Perales, J.A. Microalgae biotechnology for simultaneous water treatment and feed ingredient production in aquaculture. J. Water Process Eng. 2022, 49, 103115–103126. [Google Scholar] [CrossRef]
  116. Falaise, C.; François, C.; Travers, M.A.; Morga, B.; Haure, J.; Tremblay, R.; Turcotte, F.; Pasetto, P.; Gastineau, R.; Hardivillier, Y.; et al. Antimicrobial Compounds from Eukaryotic Microalgae against Human Pathogens and Diseases in Aquaculture. Mar. Drugs 2016, 14, 159. [Google Scholar] [CrossRef]
  117. Yaakob, Z.; Ali, E.; Zainal, A.; Mohamad, M.; Takriff, M.S. An overview: Biomolecules from microalgae for animal feed and aquaculture. J. Biol. Res. 2014, 21, 6. [Google Scholar] [CrossRef]
  118. Cakmak, Y.S.; Kaya, M.; Asan-Ozusaglam, M. Biochemical composition and bioactivity screening of various extracts from Dunaliella salina, a green microalga. EXCLI J. 2014, 13, 679–690. [Google Scholar]
  119. Vallejos-Vidal, E.; Reyes-López, F.; Teles, M.; Mackenzie, S. The response of fish to immunostimulant diets. Fish Shellfish Immunol. 2016, 56, 34–69. [Google Scholar] [CrossRef]
  120. De Araujo, R.D.S.F.; Calderon, F.V.; Lopez, J.S.; Azevedo, I.; Bruhn, A.; Fluch, S.; Tasende, M.G.; Ghaderiardakani, F.; Ilmjarv, T.; Laurans, M.; et al. Current status of the algae production industry in Europe: An emerging sector of the Blue Bioeconomy. Front. Mar. Sci. 2021, 7, 626389. [Google Scholar] [CrossRef]
Table
Table 1. Cyanobacterial peptides with potential for use in aquaculture.
Table 1. Cyanobacterial peptides with potential for use in aquaculture.
PeptidesSequencesSpeciesActivityReferences
NDLDAVNR
MMLDF		Arthrospira
maxima		Antiviral activity against COVID-19 by binding spike protein[46]
NALKCCHSCPA
GVPMPNK
IGP		Arthrospira
platensis
NDKLENCNYAVELGKLimnospira maximaAntibacterial activity against Gram− Escherichia coli and Gram+ Staphylococcus aureus[47]
Kawaguchipeptin A,B
Cyclic peptides		WLNGDNNWSTP
Kawaguchipeptin A: two prenylated tryptophans		Microcystis aeruginosa
(NIES-88)		Antibacterial activity against Gram+ Staphylococcus aureus[48]
Tenuecyclamide
A–D
Cyclic peptides		Tzl and mOzl rings
Tenuecyclamide D: sulfoxide group		Nostoc spongiaeforme
var. tenue		Antibacterial activity against Gram+ Bacillus subtilis and Staphylococcus aureus[49]
Tolybyssidin
A,B
Cyclic peptides		FdhhaVT (acetate moiety) TVVPRLT
VTITVVVFVdhhaRY		Tolypothrix byssoidea (EAWAG 195)Antifungal activity against Candida albicans[50]
Venturamide
A,B
Cyclic peptides		V(Tzl)A(Tzl)A(mOzl)
T(Tzl)V(Tzl)A(mOzl)		Oscillatoria sp.Antiparasitic activity against Plasmodium falciparum, Trypanosoma cruzi, and Leishmania donovani
Weak toxicity against Vero cells		[51]
Aerucyclamide
A-D
Cyclic peptides		I(Tzl)T(mOzn)GCI(Tzn)C
I(Tzl)T(mOzn)GCI(Tzl)C
A(mOzn)TV(Ozl)SI(Tzl)C
F(mOzn)TG(Tzn)CM(Tzl)C		Microcystis aeruginosa
(PCC 7806)		Antiparasitic activity against Plasmodium falciparum and Trypanosoma brucei rhodesiense[52,53]
AK-3
Cyclic peptide		IIEFAGGGKVMMY
Most probable sequence: YGCMIFE		Synechocystis sp. (PCC 6803)Antifungal activity against Aspergillus niger, A. flavus, and A. fumigatus[54]
Aeruginazole
A
Cyclic peptide		N(Tzl)YL(Tzl)V(Tzl)FVGGGMicrocystis sp. (IL-323)Antibacterial activity against Gram+ Bacillus subtilis
No activity against Gram− Escherichia coli or Gram+ Staphylococcus albus
Antifungal activity against Saccharomyces cerevisiae
Cytotoxicity against human peripheral blood lymphocytes		[55]
Aeruginazole
DA1497
Cyclic peptide		F(Tzl)GAIA(Tzl)SV(Tzl)PGVL(Tzl)PGMicrocystis aeruginosaAntibacterial activity against Gram+ Staphylococcus aureus[56]
NDLDAVNR
MMLDF		Arthrospira
maxima		Anti-inflammatory activity by decreasing histamine release or producing reactive oxygen species (ROS) or modulating cytokine production depending on target cell type[57,58]
NDTDP(I or L)AAC(I or L)Arthrospira sp.Antibacterial and iron-chelating activity[59]
Balgacyclamide
A-B
Cyclic peptides		V(mOzn)A(mOzn)I(Tzl)
V(mOzn)TAI(Tzl)		Microcystis aeruguinosa (EAWAG 251)Antiparasitic activity against Plasmodium falciparum, Trypanosoma brucei rhodesiense, and Leishmania donovani[60]
SP-1KLVDASHRLATGDVAVRAArthrospira
platensis		Antibacterial activity against Gram− Escherichia coli and Gram+ Staphylococcus aureus[61]
NDPNNArthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, and 1,1′-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging activity[62]
FY11FSESSAPEQHY
Imidazole (intermediate biosynthesis) in histidine and pyrrolidine (secondary amine) ring in proline		Arthrospira
platensis		Antioxidant activity through DPPH radical scavenging activity[63]
LL12LGLDVWEHAYYLArthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, DPPH, and 2,2′-azinobis-3-ethylbenzothiazoline-6-sulfonic acid (ABTS) or trolox equivalent antioxidant capacity (TEAC) radical scavenging activity and decreasing intracellular ROS upon induction of oxidative stress[64]
NDGMCCSRArthrospira
platensis		Antioxidant activity through DPPH and ABTS radical scavenging activity, ferric reducing ability of plasma (FRAP), and protection against induced oxidative stress, proliferation activity, and collagen production[65]
VH12VKYVSPTCGPCH
Imidazole in histidine and dithiol (-SH) active site in cysteine		Arthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, DPPH, and ABTS radical scavenging activity and decreasing ROS upon induction of oxidative stress[66]
GM15GGTCVIRGCVPKKLM
Dithiol active site		Arthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, DPPH, and ABTS radical scavenging activity and decreasing ROS upon induction of oxidative stress
Immunomodulatory activity by increasing granulocyte population		[67]
NL13NPLSTQDDVAASLArthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, nitric oxide (NO), DPPH, and ABTS radical scavenging activity and decreasing ROS upon induction of oxidative stress
Stimulation of cell migration and wound healing		[68]
NDLAQELGSNR
LGGEEVQEVLQQ
ITGNASTIVSNAAR
APYDESEIAFH
APLDESEMAFH
VTAGLVGGGAGK		Arthrospira
platensis		Antioxidant activity through hydroxyl and ABTS radical scavenging activity
Antibacterial and iron-chelating activity		[69]
NDFFEFF
EYFDALA
VTAPAASVAL		Arthrospira
platensis		Antioxidant activity through DPPH and ABTS radical scavenging activity, decreasing hemolysis and malondialdehyde (MDA), and increasing antioxidant enzyme activity upon induction of oxidative stress[70]
NV-14NVRIGAGSVVLRDVArthrospira
platensis		Antioxidant activity through hydroxyl, superoxide, hydrogen peroxide (H2O2), NO, DPPH, and ABTS radical scavenging activity and protecting against induced oxidative stress[71]
ND, not defined.
Table
Table 2. Microalgal peptides with potential for use in aquaculture.
Table 2. Microalgal peptides with potential for use in aquaculture.
PeptidesSequencesSpeciesActivityReferences
AQ-1766
H		LWFYTMWTetraselmis
suecica		Antibacterial activity against Gram− Escherichia coli, Salmonella typhimurium, and Pseudomonas aeruginosa and Gram+ Bacillus cereus, methicillin-resistant Staphylococcus aureus, Micrococcus luteus, and Listeria monocytogenes[72]
Alanine and lysine synthetic analogs of AQ-1766AWFYTMWH LWFATMWH
LWFYAMWH
LWFYTAWH KWFYTMWH
LWFKTMWH
LWFYKMWH
LWFYTKWH		Tetraselmis
suecica		Synthetic alanine and lysine synthetic enhances antibacterial activity of AQ-1766; lysine replacement causes a change of beta turn tendency to helical trend[72]
APWPVECYGPNRPQFChlorella
vulgaris		Antioxidant activity through hydroxyl, superoxide, DPPH, ABTS, and peroxyl radical scavenging activity and anti-inflammatory activity through decreasing levels of adhesion molecules and chemokines[73,74,75,76]
CDP
(Chlorella-derived peptide)		NDChlorella sp.Anti-UVB and UVC irradiation damage through regulating specific gene expression[77]
Chlorella
pyrenoidosa		[78]
NDMPGPLSPLPavlova
lutheri		Involved in myofibroblast differentiation[79]
NDLNGDVWChlorella
ellipsoidea		Antioxidant activity through hydroxyl, peroxyl, and DPPH radical scavenging activity
Enhanced cell viability against induced cytotoxicity by decreasing sub-G1 hypodiploid cells and apoptotic body formation		[80]
NIPP-1
NIPP-2		PGWNQWFL
VEVLPPAEL		Navicula
incerta		Protection against ethanol-induced cytotoxicity and hepatic fibrosis
Antioxidant activity by increasing glutathione (GSH) levels and decreasing gamma-glutamyltransferase (GGT) activity
Anti-inflammatory activity by regulating cytokine levels		[81,82]
NDMPDWNannochloropsis
oculata		Promotion of osteoblast differentiation[83]
NDMGRYPavlova
lutheri		Antioxidant activity through hydroxyl, H2O2, and DPPH radical scavenging activity and decreasing ROS production
Modulation of inflammatory response by activating some elements of extracellular signal kinase pathways		[84]
NDWPRGYFL
SDWDRF		Tetradesmus
obliquus		Antioxidant activity through DPPH and ABTS radical scavenging activity[85]
NDILTKAAIEGK
IIYFQGK
NDPSTVK
TVRPPQG		Dunaliella
salina		Antioxidant activity through DPPH radical scavenging activity[86]
Coco1
Coco2
Coco3		FTILKKLKSFIK
KLVKKLLKKYITF
LARFVLRILKYGFK		Coccomyxa
subellipsoidea
(C-169)		Antibacterial activity against Gram− Pseudomonas aeruginosa (coco1 and coco2),
Escherichia coli, Acinetobacter baumannii, Pseudomonas aeruginosa, and Klebsiella pneumoniae and Gram+ Staphylococcus aureus (coco3)		[87]
ND, not defined.
Table
Table 3. Macroalgal peptides with potential for use in aquaculture.
Table 3. Macroalgal peptides with potential for use in aquaculture.
PeptidesSequencesSpeciesActivityReferences
SECMA1EDRLKPUlva sp.Increase production of proteoglycans and glycosaminoglycans[88]
NDIRLIIVLMPILMA
PAIA
FPAI
ILMA
VFPAIAM
AQILP
NIGK		Palmaria
palmata		Anti-inflammatory activity[89]
NDTITLDVEPSDTIDGVK
ISGLIYEETR
MALSSLPR
ILVLQSNQIR
ISAILPSR
IGNGGELPR
LPDAALNR
EAESSLTGGNGCAK
QVHPDTGISK		Saccharina
longicruris		Antibacterial activity against Gram+ Staphylococcus aureus[90]
PYP1
/
PY-PE		ALEGGKSSGGGEATRDPEPTPyropia
yezoensis		Proliferation activity and stimulation of cell growth
Immunomodulatory activity by regulating protein kinase signaling pathways and cellular cycle		[91,92]
PPY1KAQADPyropia
yezoensis		Antioxidant activity by inhibiting release of ROS and NO intermediate in activated macrophages and anti-inflammatory activity by regulating cytokine and protein kinase signaling pathways[93]
NDFITDGNK
NAATIIK
ANAATIIK
SDITRPGGQM
DNIQGTKPA
LITGA
LITGAA
LITGAAQA LGLSGK
LTIAPK
ITLAPK
ITIAPK
VVPT
QARGAAQA		Palmaria
palmata		Antioxidant activity through FRAP and oxygen radical absorbance capacity (ORAC)[94]
PBP1
PBP2
PBP3
PBP4
PBP5
PBP6
PBP7
PBP8
PBP9
PBP10
PBP11
PBP12
PBP13		KAAAVAFITNTASQRK
RYVSYALLAGDPSVLEDRC
MQDAITSVINAADVQGKY
RAAATIAANAATIIKE
RYATYGMLAGDPSILEERV
RLVTYGIVAGDVTPIEEIGLVGVKE
RFPSSSDLESVQGNIQRA
KSVITTTISAADAAGRFPSSSDLESVQGNIQRA
RTLNLPTSAYVASFAFARD
RFLSNGELQAINGRY
RLITGAAQSVYTKF
KTPITEAIASADSQGRF
KFPYVTQMPGPTYASSAIGKA		Pyropia
yezoensis		Antioxidant activity against induced oxidative stress in human cells, decreasing ROS and increasing antioxidant enzyme activity and expression[95]
NDDYYLR
AGFY
YLVA
AFIT
MKTPITE
TYIA
LDLW		Porphyra
dioica		Antioxidant activity through enhanced ORAC upon gastrointestinal digestion[96]
NDELWKTFGracilariopsis
lemaneiformis		Antioxidant activity through DPPH radical scavenging activity[97]
ND, not defined.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

García-Beltrán, J.M.; Arizcun, M.; Chaves-Pozo, E. Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture. Mar. Drugs 2023, 21, 290. https://doi.org/10.3390/md21050290

AMA Style

García-Beltrán JM, Arizcun M, Chaves-Pozo E. Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture. Marine Drugs. 2023; 21(5):290. https://doi.org/10.3390/md21050290

Chicago/Turabian Style

García-Beltrán, José María, Marta Arizcun, and Elena Chaves-Pozo. 2023. "Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture" Marine Drugs 21, no. 5: 290. https://doi.org/10.3390/md21050290

APA Style

García-Beltrán, J. M., Arizcun, M., & Chaves-Pozo, E. (2023). Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture. Marine Drugs, 21(5), 290. https://doi.org/10.3390/md21050290

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop