Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L.
Abstract
1. Introduction
2. Results
2.1. Identification and Classification of CNGC Genes in L. cylindrica
2.2. Chromosome Mapping and Replication of L. cylindrica CNGC Genes
2.3. Analysis of L. cylindrica CNGC Promoter Sequences and Gene Structures
2.4. Phylogenetic Analysis of L. cylindrica CNGC Genes and Their Encoded CNGC Domains
2.5. Analysis of CNGC Gene Transcript Profiles in L. cylindrica
2.5.1. Tissue-Specific Gene Transcript Profiles
2.5.2. Changes in CNGC Transcript Levels in L. cylindrica Exposed to Cold Stress
2.6. Subcellular Localization of Luffa CNGC Proteins
3. Discussion
3.1. Characterization of the LcCNGC Gene Family in L. cylindrica
3.2. Phylogenetic Relationships and Evolution of LcCNGC Genes in L. cylindrica
3.3. Analysis of L. cylindrica CNGC Gene Promoters
3.4. Transcript Profiles of LcCNGC Genes in L. cylindrica and Changes Induced by Low-Temperature Stress
4. Materials and Methods
4.1. Plant Materials, Treatments, RNA Extraction, and RNA Sequencing
4.2. Identification of CNGC Gene Family Members in L. cylindrica
4.3. Bioinformatics Analysis of the LcCNGC Gene Family
4.4. Analysis of CNGC Gene Transcript Profiles in L. cylindrica Tissues
4.5. Analysis and Validation of CNGC Gene Transcript Profiles in L. cylindrica Under Low-Temperature Stress
4.6. Subcellular Localization of LcCGNC Proteins
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Zhang, Z.; Wen, Y.; Yuan, L.; Zhang, Y.; Liu, J.; Zhou, F.; Wang, Q.; Hu, X. Genome-Wide Identification, Characterization, and Expression Analysis Related to Low-Temperature Stress of the CmGLP Gene Family in Cucumis melo L. Int. J. Mol. Sci. 2022, 23, 8190. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Zhao, Y.; Xu, S.; Zhang, Z.; Xu, Y.; Zhang, J.; Chong, K. OsMADS57 together with OsTB1 coordinates transcription of its target OsWRKY94 and D14 to switch its organogenesis to defense for cold adaptation in rice. New Phytol. 2018, 218, 219–231. [Google Scholar] [CrossRef] [PubMed]
- Duszyn, M.; Świeżawska, B.; Szmidt-Jaworska, A.; Jaworski, K. Cyclic nucleotide gated channels (CNGCs) in plant signalling—Current knowledge and perspectives. J. Plant Physiol. 2019, 241, 153035. [Google Scholar] [CrossRef] [PubMed]
- Zhao, J.; Peng, S.; Cui, H.; Li, P.; Li, T.; Liu, L.; Zhang, H.; Tian, Z.; Shang, H.; Xu, R. Dynamic Expression, Differential Regulation and Functional Diversity of the CNGC Family Genes in Cotton. Int. J. Mol. Sci. 2022, 23, 2041. [Google Scholar] [CrossRef]
- Tian, W.; Hou, C.; Ren, Z.; Wang, C.; Zhao, F.; Dahlbeck, D.; Hu, S.; Zhang, L.; Niu, Q.; Li, L.; et al. A calmodulin-gated calcium channel links pathogen patterns to plant immunity. Nature 2019, 572, 131–135. [Google Scholar] [CrossRef]
- Moon, J.Y.; Belloeil, C.; Ianna, M.L.; Shin, R. Arabidopsis CNGC Family Members Contribute to Heavy Metal Ion Uptake in Plants. Int. J. Mol. Sci. 2019, 20, 413. [Google Scholar] [CrossRef]
- Schuurink, R.C.; Shartzer, S.F.; Fath, A.; Jones, R.L. Characterization of a calmodulin-binding transporter from the plasma membrane of barley aleurone. Proc. Natl. Acad. Sci. USA 1998, 95, 1944–1949. [Google Scholar] [CrossRef]
- Hao, L.; Qiao, X. Genome-wide identification and analysis of the CNGC gene family in maize. PeerJ 2018, 6, e5816. [Google Scholar] [CrossRef]
- Wang, L.; Li, M.; Liu, Z.; Dai, L.; Zhang, M.; Wang, L.; Zhao, J.; Liu, M. Genome-wide identification of CNGC genes in Chinese jujube (Ziziphus jujuba Mill.) and ZjCNGC2 mediated signalling cascades in response to cold stress. BMC Genom. 2020, 21, 191. [Google Scholar] [CrossRef]
- Guo, J.; Islam, A.; Lin, H.; Ji, C.; Duan, Y.; Liu, P.; Zeng, Q.; Day, B.; Kang, Z.; Guo, J. Genome-Wide Identification of Cyclic Nucleotide-Gated Ion Channel Gene Family in Wheat and Functional Analyses of TaCNGC14 and TaCNGC16. Front. Plant Sci. 2018, 9, 18. [Google Scholar] [CrossRef]
- Gong, J.; Shi, T.; Li, Y.; Wang, H.; Li, F. Genome-Wide Identification and Characterization of Calcium Metabolism Related Gene Families in Arabidopsis thaliana and Their Regulation by Bacillus amyloliquefaciens Under High Calcium Stress. Front. Plant Sci. 2021, 12, 707496. [Google Scholar] [CrossRef] [PubMed]
- Lee, S.-K.; Lee, S.-M.; Kim, M.-H.; Park, S.-K.; Jung, K.-H. Genome-Wide Analysis of Cyclic Nucleotide-Gated Channel Genes Related to Pollen Development in Rice. Plants 2022, 11, 3145. [Google Scholar] [CrossRef] [PubMed]
- Kakar, K.U.; Nawaz, Z.; Kakar, K.; Ali, E.; Almoneafy, A.A.; Ullah, R.; Ren, X.-L.; Shu, Q.-Y. Comprehensive genomic analysis of the CNGC gene family in Brassica oleracea: Novel insights into synteny, structures, and transcript profiles. BMC Genom. 2017, 18, 869. [Google Scholar] [CrossRef] [PubMed]
- Jiang, Z.; Du, L.; Shen, L.; He, J.; Xia, X.; Zhang, L.; Yang, X. Genome-Wide Exploration and Expression Analysis of the CNGC Gene Family in Eggplant (Solanum melongena L.) under Cold Stress, with Functional Characterization of SmCNGC1a. Int. J. Mol. Sci. 2023, 24, 13049. [Google Scholar] [CrossRef]
- Li, Q.; Yang, S.; Ren, J.; Ye, X.; Jiang, X.; Liu, Z. Genome-wide identification and functional analysis of the cyclic nucleotide-gated channel gene family in Chinese cabbage. 3 Biotech 2019, 9, 114. [Google Scholar] [CrossRef]
- Mao, X.; Wang, C.; Lv, Q.; Tian, Y.; Wang, D.; Chen, B.; Mao, J.; Li, W.; Chu, M.; Zuo, C. Cyclic nucleotide gated channel genes (CNGCs) in Rosaceae: Genome-wide annotation, evolution and the roles on Valsa canker resistance. Plant Cell Rep. 2021, 40, 2369–2382. [Google Scholar] [CrossRef]
- Nawaz, Z.; Kakar, K.U.; Ullah, R.; Yu, S.; Zhang, J.; Shu, Q.-Y.; Ren, X.-L. Genome-wide identification, evolution and expression analysis of cyclic nucleotide-gated channels in tobacco (Nicotiana tabacum L.). Genomics 2019, 111, 142–158. [Google Scholar] [CrossRef]
- Zhang, L.; Cui, Y.; An, L.; Li, J.; Yao, Y.; Bai, Y.; Li, X.; Yao, X.; Wu, K. Genome-wide identification of the CNGC gene family and negative regulation of drought tolerance by HvCNGC3 and HvCNGC16 in transgenic Arabidopsis thaliana. Plant Physiol. Biochem. 2024, 210, 108593. [Google Scholar] [CrossRef]
- Zhang, N.; Lin, H.; Zeng, Q.; Fu, D.; Gao, X.; Wu, J.; Feng, X.; Wang, Q.; Ling, Q.; Wu, Z. Genome-wide identification and expression analysis of the cyclic nucleotide-gated ion channel (CNGC) gene family in Saccharum spontaneum. BMC Genom. 2023, 24, 281. [Google Scholar] [CrossRef]
- Zhang, Y.; Li, Y.; Yang, J.; Yang, X.; Chen, S.; Xie, Z.; Zhang, M.; Huang, Y.; Zhang, J.; Huang, X. Genome-Wide Analysis and Expression of Cyclic Nucleotide–Gated Ion Channel (CNGC) Family Genes under Cold Stress in Mango (Mangifera indica). Plants 2023, 12, 592. [Google Scholar] [CrossRef]
- Nawaz, Z.; Kakar, K.U.; Saand, M.A.; Shu, Q.-Y. Cyclic nucleotide-gated ion channel gene family in rice, identification, characterization and experimental analysis of expression response to plant hormones, biotic and abiotic stresses. BMC Genom. 2014, 15, 853. [Google Scholar] [CrossRef] [PubMed]
- Baloch, A.A.; Kakar, K.U.; Nawaz, Z.; Mushtaq, M.; Abro, A.; Khan, S.; Latif, A. Comparative genomics and evolutionary analysis of plant CNGCs. Biol. Methods Protoc. 2022, 7, bpac018. [Google Scholar] [CrossRef] [PubMed]
- Baloch, A.A.; Raza, A.M.; Rana, S.S.A.; Ullah, S.; Khan, S.; Nisa, Z.U.; Zahid, H.; Malghani, G.K.; Kakar, K.U. BrCNGC gene family in field mustard: Genome-wide identification, characterization, comparative synteny, evolution and expression profiling. Sci. Rep. 2021, 11, 24203. [Google Scholar] [CrossRef] [PubMed]
- Kidokoro, S.; Shinozaki, K.; Yamaguchi-Shinozaki, K. Transcriptional regulatory network of plant cold-stress responses. Trends Plant Sci. 2022, 27, 922–935. [Google Scholar] [CrossRef] [PubMed]
- Peng, Y.; Ming, Y.; Jiang, B.; Zhang, X.; Fu, D.; Lin, Q.; Zhang, X.; Wang, Y.; Shi, Y.; Gong, Z.; et al. Differential phosphorylation of Ca2+-permeable channel CYCLIC NUCLEOTIDE–GATED CHANNEL20 modulates calcium-mediated freezing tolerance in Arabidopsis. Plant Cell 2024, 36, 4356–4371. [Google Scholar] [CrossRef]
- Wang, J.; Ren, Y.; Luo, S.; Zhang, X.; Liu, X.; Lin, Q.; Zhu, S.; Wan, H.; Yang, Y.; Zhang, Y.; et al. Transcriptional activation and phosphorylation of OsCNGC9 confer enhanced chilling tolerance in rice. Mol. Plant 2020, 14, 315–329. [Google Scholar] [CrossRef]
- Cui, Y.; Lu, S.; Li, Z.; Cheng, J.; Hu, P.; Zhu, T.; Wang, X.; Jin, M.; Wang, X.; Li, L.; et al. Cyclic Nucleotide-Gated Ion Channels 14 and 16 Promote Tolerance to Heat and Chilling in Rice. Plant Physiol. 2020, 183, 1794–1808. [Google Scholar] [CrossRef]
- Liu, J.; Peng, L.; Cao, C.; Bai, C.; Wang, Y.; Li, Z.; Zhu, H.; Wen, Q.; He, S. Identification of WRKY Family Members and Characterization of the Low-Temperature-Stress-Responsive WRKY Genes in Luffa (Luffa cylindrica L.). Plants 2024, 13, 676. [Google Scholar] [CrossRef]
- Wang, J.; Wang, Y.; Wu, X.; Wang, B.; Lu, Z.; Zhong, L.; Li, G.; Wu, X. Insight into the bZIP gene family in Lagenaria siceraria: Genome and transcriptome analysis to understand gene diversification in Cucurbitaceae and the roles of LsbZIP gene expression and function under cold stress. Front. Plant Sci. 2023, 13, 1128007. [Google Scholar] [CrossRef]
- Meng, D.; Li, S.; Feng, X.; Di, Q.; Zhou, M.; Yu, X.; He, C.; Yan, Y.; Wang, J.; Sun, M.; et al. CsBPC2 is essential for cucumber survival under cold stress. BMC Plant Biol. 2023, 23, 566. [Google Scholar] [CrossRef]
- Cheng, X.; Qin, M.; Chen, R.; Jia, Y.; Zhu, Q.; Chen, G.; Wang, A.; Ling, B.; Rong, W. Citrullus colocynthis (L.) Schrad.: A Promising Pharmaceutical Resource for Multiple Diseases. Molecules 2023, 28, 6221. [Google Scholar] [CrossRef] [PubMed]
- Tang, L.; He, Y.; Liu, B.; Xu, Y.; Zhao, G. Genome-Wide Identification and Characterization Analysis of WUSCHEL-Related Homeobox Family in Melon (Cucumis melo L.). Int. J. Mol. Sci. 2023, 24, 12326. [Google Scholar] [CrossRef] [PubMed]
- Li, H.; Kong, F.; Tang, T.; Luo, Y.; Gao, H.; Xu, J.; Xing, G.; Li, L. Physiological and Transcriptomic Analyses Revealed That Humic Acids Improve Low-Temperature Stress Tolerance in Zucchini (Cucurbita pepo L.) Seedlings. Plants 2023, 12, 548. [Google Scholar] [CrossRef] [PubMed]
- Abdel-Hamid, H.; Chin, K.; Moeder, W.; Yoshioka, K. High throughput chemical screening supports the involvement of Ca2+ in cyclic nucleotide-gated ion channel-mediated programmed cell death in Arabidopsis. Plant Signal. Behav. 2011, 6, 1817–1819. [Google Scholar] [CrossRef]
- Chen, L.; Wang, W.; He, H.; Yang, P.; Sun, X.; Zhang, Z. Genome-Wide Identification, Characterization and Experimental Expression Analysis of CNGC Gene Family in Gossypium. Int. J. Mol. Sci. 2023, 24, 4617. [Google Scholar] [CrossRef]
- Saand, M.A.; Xu, Y.-P.; Munyampundu, J.-P.; Li, W.; Zhang, X.-R.; Cai, X.-Z. Phylogeny and evolution of plant cyclic nucleotide-gated ion channel (CNGC) gene family and functional analyses of tomatoCNGCs. DNA Res. 2015, 22, 471–483. [Google Scholar] [CrossRef]
- Xie, D.; Xu, Y.; Wang, J.; Liu, W.; Zhou, Q.; Luo, S.; Huang, W.; He, X.; Li, Q.; Peng, Q.; et al. The wax gourd genomes offer insights into the genetic diversity and ancestral cucurbit karyotype. Nat. Commun. 2019, 10, 5158. [Google Scholar] [CrossRef]
- Guo, S.; Zhang, J.; Sun, H.; Salse, J.; Lucas, W.J.; Zhang, H.; Zheng, Y.; Mao, L.; Ren, Y.; Wang, Z.; et al. The draft genome of watermelon (Citrullus lanatus) and resequencing of 20 diverse accessions. Nat. Genet. 2012, 45, 51–58. [Google Scholar] [CrossRef]
- Sun, H.; Wu, S.; Zhang, G.; Jiao, C.; Guo, S.; Ren, Y.; Zhang, J.; Zhang, H.; Gong, G.; Jia, Z.; et al. Karyotype Stability and Unbiased Fractionation in the Paleo-Allotetraploid Cucurbita Genomes. Mol. Plant 2017, 10, 1293–1306. [Google Scholar] [CrossRef]
- Garcia-Mas, J.; Benjak, A.; Sanseverino, W.; Bourgeois, M.; Mir, G.; González, V.M.; Hénaff, E.; Câmara, F.; Cozzuto, L.; Lowy, E.; et al. The genome of melon (Cucumis melo L.). Proc. Natl. Acad. Sci. USA 2012, 109, 11872–11877. [Google Scholar] [CrossRef]
- Montero-Pau, J.; Bao, K.; Reddy, U.K.; Bai, Y.; Hammar, S.A.; Jiao, C.; Wehner, T.C.; Ramírez-Madera, A.O.; Weng, Y.; Grumet, R.; et al. The USDA cucumber (Cucumis sativus L.) collection: Genetic diversity, population structure, genome-wide association studies, and core collection development. Hortic. Res. 2018, 5, 64. [Google Scholar] [CrossRef]
- Saensuk, C.; Ruangnam, S.; Pitaloka, M.K.; Dumhai, R.; Mahatheeranont, S.; de Hoop, S.J.; Balatero, C.; Riangwong, K.; Ruanjaichon, V.; Toojinda, T.; et al. A SNP of betaine aldehyde dehydrogenase (BADH) enhances an aroma (2-acetyl-1-pyrroline) in sponge gourd (Luffa cylindrica) and ridge gourd (Luffa acutangula). Sci. Rep. 2022, 12, 3718. [Google Scholar] [CrossRef] [PubMed]
- Wu, H.; Zhao, G.; Gong, H.; Li, J.; Luo, C.; He, X.; Luo, S.; Zheng, X.; Liu, X.; Guo, J.; et al. A high-quality sponge gourd (Luffa cylindrica) genome. Hortic. Res. 2020, 7, 128. [Google Scholar] [CrossRef] [PubMed]
- Holub, E.B. The arms race is ancient history in Arabidopsis, the wildflower. Nat. Rev. Genet. 2001, 2, 516–527. [Google Scholar] [CrossRef]
- Bao, F.; Ding, A.; Cheng, T.; Wang, J.; Zhang, Q. Genome-Wide Analysis of Members of the WRKY Gene Family and Their Cold Stress Response in Prunus mume. Genes 2019, 10, 911. [Google Scholar] [CrossRef]
- Chen, H.; Li, X.; Li, F.; Li, D.; Dong, Y.; Fan, Y. Bioinformatics Analysis of WRKY Family Genes in Erianthus fulvus Ness. Genes 2022, 13, 2102. [Google Scholar] [CrossRef]
- Cui, J.; Cheng, J.; Nong, D.; Peng, J.; Hu, Y.; He, W.; Zhou, Q.; Dhillon, N.P.S.; Hu, K. Genome-Wide Analysis of Simple Sequence Repeats in Bitter Gourd (Momordica charantia). Front. Plant Sci. 2017, 8, 1103. [Google Scholar] [CrossRef]
- DiFrancesco, D.; Tortora, P. Direct activation of cardiac pacemaker channels by intracellular cyclic AMP. Nature 1991, 351, 145–147. [Google Scholar] [CrossRef]
- Saand, M.A.; Xu, Y.-P.; Li, W.; Wang, J.-P.; Cai, X.-Z. Cyclic nucleotide gated channel gene family in tomato: Genome-wide identification and functional analyses in disease resistance. Front. Plant Sci. 2015, 6, 303. [Google Scholar] [CrossRef]
- Guan, K.; Yang, Z.; Zhan, M.; Zheng, M.; You, J.; Meng, X.; Li, H.; Gao, J. Two Sweet Sorghum (Sorghum bicolor L.) WRKY Transcription Factors Promote Aluminum Tolerance via the Reduction in Callose Deposition. Int. J. Mol. Sci. 2023, 24, 10288. [Google Scholar] [CrossRef]
- Wang, X.; Liu, H.; Yu, Z.; Zhu, W.; Zhang, L.; Wang, B. Correction to: Characterization of wheat Wrab18 gene promoter and expression analysis under abiotic stress. Mol. Biol. Rep. 2023, 50, 10681–10685. [Google Scholar] [CrossRef] [PubMed]
- Mahiwal, S.; Pahuja, S.; Pandey, G.K. Review: Structural-functional relationship of WRKY transcription factors: Unfolding the role of WRKY in plants. Int. J. Biol. Macromol. 2024, 257, 128769. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Niu, Y.; Zheng, Y. Multiple Functions of MYB Transcription Factors in Abiotic Stress Responses. Int. J. Mol. Sci. 2021, 22, 6125. [Google Scholar] [CrossRef]
- Zhang, L.; Fu, J.; Dong, T.; Zhang, M.; Wu, J.; Liu, C. Promoter cloning and activities analysis of JmLFY, a key gene for flowering in Juglans mandshurica. Front. Plant Sci. 2023, 14, 1243030. [Google Scholar] [CrossRef]
- Liu, J.; Wang, B.; Li, Y.; Huang, L.; Zhang, Q.; Zhu, H.; Wen, Q. RNA sequencing analysis of low temperature and low light intensity-responsive transcriptomes of zucchini (Cucurbita pepo L.). Sci. Hortic. 2020, 265, 109263. [Google Scholar] [CrossRef]
- Zou, Z.; Yang, J. Genomic analysis of Dof transcription factors in Hevea brasiliensis, a rubber-producing tree. Ind. Crops Prod. 2019, 134, 271–283. [Google Scholar] [CrossRef]
- Langdon, W.B. Performance of genetic programming optimised Bowtie2 on genome comparison and analytic testing (GCAT) benchmarks. BioData Min. 2015, 8, 1. [Google Scholar] [CrossRef]
- Liu, J.; Wang, Y.; Ye, X.; Zhang, Q.; Li, Y.; Chen, M.; Wang, B.; Bai, C.; Li, Z.; Wen, Q.; et al. Genome-wide identification and expression analysis of the WRKY gene family in response to low-temperature and drought stresses in Cucurbita pepo L. Sci. Hortic. 2024, 330, 113048. [Google Scholar] [CrossRef]
- Chen, J.; Yin, H.; Gu, J.; Li, L.; Liu, Z.; Jiang, X.; Zhou, H.; Wei, S.; Zhang, S.; Wu, J. Genomic characterization, phylogenetic comparison and differential expression of the cyclic nucleotide-gated channels gene family in pear (Pyrus bretchneideri Rehd.). Genomics 2015, 105, 39–52. [Google Scholar] [CrossRef]
- Wang, D.; Zhang, Y.; Zhang, Z.; Zhu, J.; Yu, J. KaKs_Calculator 2.0: A Toolkit Incorporating Gamma-Series Methods and Sliding Window Strategies. Genom. Proteom. Bioinform. 2010, 8, 77–80. [Google Scholar] [CrossRef]
Gene Name | Gene ID | Position | Coding Sequence Length/bp | Protein Length/aa | Conserved Domains’ Location | Relative Molecular Weight/kDa | Theoretical Isoelectric Point (pI) | Group | Subcellular Localization |
---|---|---|---|---|---|---|---|---|---|
LcCNGC1 | Lcy02g001140 | Chr02: 1,532,606–1,539,547 (+) | 2310 | 770 | 539–670 | 88.68 | 9.41 | IV-a | Plasma membrane |
LcCNGC2 | Lcy03g014490 | Chr03: 48,631,670–48,635,414 (−) | 2079 | 693 | 438–569 | 79.51 | 9.09 | Ⅲ | Plasma membrane |
LcCNGC3 | Lcy03g018610 | Chr03: 52,325,676–52,332,121 (−) | 1392 | 464 | 226–357 | 53.47 | 9.58 | Ⅲ | Chloroplast |
LcCNGC4 | Lcy04g010980 | Chr04: 42,360,506–42,365,299 (−) | 1962 | 654 | 85–460 | 75.05 | 8.53 | Ⅲ | Plasma membrane |
LcCNGC5 | Lcy06g000140 | Chr06: 250,105–272,944 (−) | 2610 | 870 | 698–816 | 99.48 | 8.89 | Ⅰ | Plasma membrane |
LcCNGC6 | Lcy07g016590 | Chr07: 45,284,867–45,293,470 (−) | 2235 | 745 | 524–655 | 84.89 | 9.32 | Ⅲ | Plasma membrane |
LcCNGC7 | Lcy08g013840 | Chr08: 43,879,866–43,903,445 (+) | 2196 | 732 | 156–554 | 83.93 | 9.27 | Ⅱ-a | Plasma membrane |
LcCNGC8 | Lcy09g003450 | Chr09: 2,996,960–3,002,381 (+) | 2133 | 711 | 523–630 | 81.60 | 9.62 | Ⅰ | Plasma membrane |
LcCNGC9 | Lcy09g018640 | Chr09: 41,407,813–41,413,401 (−) | 2292 | 764 | 539–670 | 87.60 | 9.51 | Ⅱ-a | Plasma membrane |
LcCNGC10 | Lcy09g019220 | Chr09: 43,242,303–43,247,104 (+) | 2133 | 711 | 458–589 | 81.32 | 8.82 | Ⅲ | Plasma membrane |
LcCNGC11 | Lcy10g017690 | Chr10: 45,735,353–45,746,103 (+) | 2052 | 684 | 101–522 | 78.84 | 9.31 | IV-a | Plasma membrane |
LcCNGC12 | Lcy11g000780 | Chr11: 777,524–780,531 (−) | 2094 | 698 | 473–587 | 80.00 | 9.36 | IV-b | Plasma membrane |
LcCNGC13 | Lcy11g000810 | Chr11: 799,059–802,200 (−) | 2058 | 686 | 465–581 | 78.38 | 9.43 | IV-b | Plasma membrane |
LcCNGC14 | Lcy11g000830 | Chr11: 807,730–812,348 (−) | 1995 | 665 | 463–579 | 76.41 | 9.45 | IV-b | Plasma membrane |
LcCNGC15 | Lcy11g000840 | Chr11: 817,566–823,121 (−) | 2010 | 670 | 443–562 | 77.05 | 9.32 | IV-a | Plasma membrane |
LcCNGC16 | Lcy11g003110 | Chr11: 2,989,382–2,993,545 (−) | 1902 | 634 | 450–533 | 73.12 | 9.36 | Ⅰ | Plasma membrane |
LcCNGC17 | Lcy11g012000 | Chr11: 15,061,686–15,069,510 (+) | 1974 | 658 | 466–566 | 76.02 | 9.28 | Ⅰ | Plasma membrane |
LcCNGC18 | Lcy12g016140 | Chr12: 44,065,281–44,067,927 (−) | 1593 | 531 | 290–421 | 61.30 | 8.21 | Ⅲ | Plasma membrane |
LcCNGC19 | Lcy13g014940 | Chr13: 34,786,898–34,793,306 (−) | 1230 | 410 | 346–407 | 47.27 | 9.02 | IV-b | Plasma membrane |
LcCNGC20 | Lcy13g015690 | Chr13: 42,524,448–42,526,976 (−) | 1410 | 470 | 397–468 | 53.91 | 9.07 | IV-b | Plasma membrane |
Motif | E-Value | Sites | Width | Best Possible Match |
---|---|---|---|---|
Motif1 | 2.8 × 10−1949 | 57 | 50 | IGNMQTYLQSTTVRLEEMRLKRRDTEZWMRHRQLPZDLRERVRRYEQYKW |
Motif2 | 5.9 × 10−1478 | 56 | 41 | MDEQLLDAICERLKPVLYTEGTYIVREGDPVBEMLFIIRGK |
Motif3 | 1.4 × 10−1298 | 56 | 36 | ETAWAGAAYNLLLYMLASHVVGAFWYLLSIERQASC |
Motif4 | 5.2 × 10−1075 | 47 | 32 | LHSKQLQHTFRFYSHQWRTWAACFIQAAWRRY |
Motif5 | 4.1 × 10−1031 | 56 | 29 | TRGVDEENJLQNLPKDLRRDIKRHLCLDL |
Motif6 | 1.2 × 10−831 | 52 | 28 | SSTRTVRALTEVEAFALRAEDLKFVASQ |
Motif7 | 1.3 × 10−716 | 56 | 21 | KYFYCLWWGLQNLSSLGQNLE |
Motif8 | 4.9 × 10−689 | 42 | 31 | FFNSITLKPGDFCGEELLTWALDPKSSSNLP |
Motif9 | 9.6 × 10−738 | 53 | 29 | PQDKFLQRWNKIFVJSCVIALFVDPLFFY |
Motif10 | 3.1 × 10−632 | 42 | 29 | SSRVFGRGELVIDPKAIAKRYLRSYFJID |
Motif11 | 3.2 × 10−677 | 53 | 29 | IVVTVLRTFIDVFYLJHIVLQFRTAYVAP |
Motif12 | 9.3 × 10−553 | 57 | 21 | IGEVLFAILIAISGLVLFALL |
Motif13 | 3.6 × 10−372 | 53 | 15 | AVLPLPQIVIWLVIP |
Motif14 | 4.1 × 10−351 | 55 | 15 | VLFQYIPRLYRIYPL |
Motif15 | 3.2 × 10−359 | 56 | 21 | BNTPFBFGIFLDALTSGVVSS |
Motif16 | 2.9 × 10−332 | 37 | 29 | AKTSGSSPSLGATJLASRFAANALRGVRR |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Liu, J.; Wang, Y.; Peng, L.; Chen, M.; Ye, X.; Li, Y.; Li, Z.; Wen, Q.; Zhu, H. Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L. Int. J. Mol. Sci. 2024, 25, 11330. https://doi.org/10.3390/ijms252011330
Liu J, Wang Y, Peng L, Chen M, Ye X, Li Y, Li Z, Wen Q, Zhu H. Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L. International Journal of Molecular Sciences. 2024; 25(20):11330. https://doi.org/10.3390/ijms252011330
Chicago/Turabian StyleLiu, Jianting, Yuqian Wang, Lijuan Peng, Mindong Chen, Xinru Ye, Yongping Li, Zuliang Li, Qingfang Wen, and Haisheng Zhu. 2024. "Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L." International Journal of Molecular Sciences 25, no. 20: 11330. https://doi.org/10.3390/ijms252011330
APA StyleLiu, J., Wang, Y., Peng, L., Chen, M., Ye, X., Li, Y., Li, Z., Wen, Q., & Zhu, H. (2024). Genome-Wide Identification of the Cyclic Nucleotide-Gated Ion Channel Gene Family and Expression Profiles Under Low-Temperature Stress in Luffa cylindrica L. International Journal of Molecular Sciences, 25(20), 11330. https://doi.org/10.3390/ijms252011330