Crystal Structures of Pyrophosphatase from Acinetobacter baumannii: Snapshots of Pyrophosphate Binding and Identification of a Phosphorylated Enzyme Intermediate
Abstract
:1. Introduction
2. Results
2.1. Structures of AbPPase
2.2. Variable PPi Binding Snapshots in WT AbPPase Catalytic Center
2.3. Enzyme Assay
2.4. AbPPase Lys30 is Phosphorylated during PPi Hydrolysis
3. Discussion
4. Materials and Methods
4.1. Cloning, Protein Expression, and Purification
4.2. Site-Directed Mutagenesis
4.3. Enzyme Assay
4.4. Gel Filtration Chromatography
4.5. Crystallization, Data Collection, and Structure Determination
4.6. Mass Spectroscopy
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
Abbreviations
PPi | Pyrophophate |
PPase | pyrophosphatase |
AbPPase | Acinetobacter baumannii pyrophosphatase |
W | Water molecule |
M | Metal magnesium ion |
WT AbPPase | Wild-type of Acinetobacter baumannii pyrophosphatase |
MS | Mass spectrometry |
References
- Nelson, D.; Cox, M. Lehninger Principles of Biochemistry, 3rd ed.; Worth Publishers: New York, NY, USA, 2000; p. 937. [Google Scholar]
- Reginald, H.; Charles, M. Grisham Biochemistry, 4th ed.; Cengage Learning, Brooks/Cole: Belmont, CA, USA, 2010. [Google Scholar]
- Carman, G.M.; Han, G.S. Roles of phosphatidate phosphatase enzymes in lipid metabolism. Trends Biochem. Sci. 2006, 31, 694–699. [Google Scholar] [CrossRef] [Green Version]
- Van Wazer, J.R.; Griffith, E.J.; Mccullough, J.F. Structure and Properties of the Condensed Phosphates. VII. Hydrolytic Degradation of Pyro- and Tripolyphosphate. J. Am. Chem. Soc. 1955, 77, 287–291. [Google Scholar] [CrossRef]
- Sivula, T.; Salminen, A.; Parfenyev, A.N.; Pohjanjoki, P.; Goldman, A.; Cooperman, B.S.; Baykov, A.A.; Lahti, R. Evolutionary aspects of inorganic pyrophosphatase. FEBS Lett. 1999, 454, 75–80. [Google Scholar] [CrossRef]
- Lahti, R. Microbial inorganic pyrophosphatases. Microbiol. Rev. 1983, 47, 169–178. [Google Scholar]
- Chen, J.; Brevet, A.; Fromant, M.; Leveque, F.; Schmitter, J.M.; Blanquet, S.; Plateau, P. Pyrophosphatase is essential for growth of Escherichia coli. J. Bacteriol. 1990, 172, 5686–5689. [Google Scholar] [CrossRef] [Green Version]
- Baykov, A.A.; Anashkin, V.A.; Salminen, A.; Lahti, R. Inorganic pyrophosphatases of Family II-two decades after their discovery. FEBS Lett. 2017, 591, 3225–3234. [Google Scholar] [CrossRef] [Green Version]
- Heppel, L.A.; Hilmoe, R.J. Purification of yeast inorganic pyrophosphatase. J. Biol. Chem. 1951, 192, 87–94. [Google Scholar]
- Josse, J. Constitutive inorganic pyrophosphatase of Escherichia coli. 1. Purification and catalytic properties. J. Biol. Chem. 1966, 241, 1938–1947. [Google Scholar]
- Hachimori, A.; Takeda, A.; Kaibuchi, M.; Ohkawara, N.; Samejima, T. Purification and characterization of inorganic pyrophosphatase from Bacillus stearothermophilus. J. Biochem. 1975, 77, 1177–1183. [Google Scholar]
- Kunitz, M. Crystalline inorganic pyrophosphatase isolated from baker’s yeast. J. Gen. Physiol. 1952, 35, 423–450. [Google Scholar] [CrossRef]
- Teplyakov, A.; Obmolova, G.; Wilson, K.S.; Ishii, K.; Kaji, H.; Samejima, T.; Kuranova, I. Crystal structure of inorganic pyrophosphatase from Thermus thermophilus. Protein Sci. 1994, 3, 1098–1107. [Google Scholar] [CrossRef]
- Bloch-Frankenthal, L. The role of magnesium in the hydrolysis of sodium pyrophosphate by inorganic pyrophosphatase. Biochem. J. 1954, 57, 87–92. [Google Scholar] [CrossRef] [Green Version]
- Josse, J. Constitutive inorganic pyrophosphatase of Escherichia coli. II. Nature and binding of active substrate and the role of magnesium. J. Biol. Chem. 1966, 241, 1948–1955. [Google Scholar]
- Ware, D.A.; Postgate, J.R. Physiological and chemical properties of a reductant-activated inorganic pyrophosphatase from Desulfovibrio desulfuricans. J. Gen. Microbiol. 1971, 67, 145–160. [Google Scholar] [CrossRef]
- Knight, W.B.; Fitts, S.W.; Dunaway-Mariano, D. Investigation of the catalytic mechanism of yeast inorganic pyrophosphatase. Biochemistry 1981, 20, 4079–4086. [Google Scholar] [CrossRef]
- Moe, O.A.; Butler, L.G. Yeast inorganic pyrophosphatase. 3. Kinetics of Ca2+ inhibition. J. Biol. Chem. 1972, 247, 7315–7319. [Google Scholar]
- Burton, P.M.; Josse, J. Constitutive inorganic pyrophosphatase of Escherichia coli. VI. Inactivation by chemical modification of lysine residues. J. Biol. Chem. 1970, 245, 4358–4364. [Google Scholar]
- Samejima, T.; Tamagawa, Y.; Kondo, Y.; Hachimori, A.; Kaji, H.; Takeda, A.; Shiroya, Y. Chemical modifications of histidyl and tyrosyl residues of inorganic pyrophosphatase from Escherichia coli. J. Biochem. 1988, 103, 766–772. [Google Scholar] [CrossRef]
- Kaneko, S.; Ichiba, T.; Hirano, N.; Hachimori, A. Modification of a single tryptophan of the inorganic pyrophosphatase from thermophilic bacterium PS-3: Possible involvement in its substrate binding. Biochimica Biophysica Acta 1991, 1077, 281–284. [Google Scholar] [CrossRef]
- Heikinheimo, P.; Tuominen, V.; Ahonen, A.K.; Teplyakov, A.; Cooperman, B.S.; Baykov, A.A.; Lahti, R.; Goldman, A. Toward a quantum-mechanical description of metal-assisted phosphoryl transfer in pyrophosphatase. Proc. Natl. Acad. Sci. USA 2001, 98, 3121–3126. [Google Scholar] [CrossRef] [Green Version]
- Samygina, V.R.; Popov, A.N.; Rodina, E.V.; Vorobyeva, N.N.; Lamzin, V.S.; Polyakov, K.M.; Kurilova, S.A.; Nazarova, T.I.; Avaeva, S.M. The structures of Escherichia coli inorganic pyrophosphatase complexed with Ca(2+) or CaPP(i) at atomic resolution and their mechanistic implications. J. Mol. Biol. 2001, 314, 633–645. [Google Scholar] [CrossRef]
- Butler, L.G.; Sperow, J.W. Multiple roles of metal ions in the reaction catalyzed by yeast inorganic pyrophosphatase. Bioinorg. Chem. 1977, 7, 141–150. [Google Scholar] [CrossRef]
- Knight, W.B.; Dunaway-Mariano, D.; Ransom, S.C.; Villafranca, J.J. Investigations of the metal ion-binding sites of yeast inorganic pyrophosphatase. J. Biol. Chem. 1984, 259, 2886–2895. [Google Scholar]
- Cohn, M. Phosphate-water exchange reaction catalyzed by inorganic pyrophosphatase of yeast. J. Biol. Chem. 1958, 230, 369–379. [Google Scholar]
- Sperow, J.W.; Moe, O.A.; Ridlington, J.W.; Butler, L.G. Yeast inorganic pyrophosphatase. VI. Studies on specificity and mechanism. J. Biol. Chem. 1973, 248, 2062–2065. [Google Scholar]
- Baykov, A.A.; Bakuleva, N.P.; Nazarova, T.I.; Avaeva, S.M. Fluoride inhibition of inorganic pyrophosphatase. II. Isolation and characterization of a covalent intermediate between enzyme and entire substrate molecule. Biochimica Biophysica Acta 1977, 481, 184–194. [Google Scholar] [CrossRef]
- Heikinheimo, P.; Lehtonen, J.; Baykov, A.; Lahti, R.; Cooperman, B.S.; Goldman, A. The structural basis for pyrophosphatase catalysis. Structure 1996, 4, 1491–1508. [Google Scholar] [CrossRef] [Green Version]
- Heikinheimo, P.; Pohjanjoki, P.; Helminen, A.; Tasanen, M.; Cooperman, B.S.; Goldman, A.; Baykov, A.; Lahti, R. A site-directed mutagenesis study of Saccharomyces cerevisiae pyrophosphatase. Functional conservation of the active site of soluble inorganic pyrophosphatases. Eur. J. Biochem. 1996, 239, 138–143. [Google Scholar] [CrossRef]
- Hackney, D.D.; Boyer, P.D. Evaluation of the partitioning of bound inorganic phosphate during medium and intermediate phosphate in equilibrium water oxygen exchange reactions of yeast inorganic pyrophosphatase. Proc. Natl. Acad. Sci. USA 1978, 75, 3133–3137. [Google Scholar] [CrossRef]
- Grigor’eva, O.V.; Mit’kevich, V.A.; Skliankina, V.A.; Avaeva, S.M. Inhibition of inorganic pyrophosphatase from Escherichia coli with inorganic phosphate. Bioorganicheskaia Khimiia 2001, 27, 32–39. [Google Scholar]
- Towner, K.J. Acinetobacter: An old friend, but a new enemy. J. Hosp. Infect. 2009, 73, 355–363. [Google Scholar] [CrossRef]
- Nordqvist, H.; Nilsson, L.E.; Claesson, C. Mutant prevention concentration of colistin alone and in combination with rifampicin for multidrug-resistant Acinetobacter baumannii. Eur. J. Clin. Microbiol. Infect. Dis. 2016, 35, 1845–1850. [Google Scholar] [CrossRef] [Green Version]
- Touchon, M.; Cury, J.; Yoon, E.J.; Krizova, L.; Cerqueira, G.C.; Murphy, C.; Feldgarden, M.; Wortman, J.; Clermont, D.; Lambert, T.; et al. The genomic diversification of the whole Acinetobacter genus: Origins, mechanisms, and consequences. Genome Biol. Evolut. 2014, 6, 2866–2882. [Google Scholar] [CrossRef]
- Almasaudi, S.B. Acinetobacter spp. as nosocomial pathogens: Epidemiology and resistance features. Saudi J. Biol. Sci. 2018, 25, 586–596. [Google Scholar] [CrossRef]
- Chusri, S.; Chongsuvivatwong, V.; Rivera, J.I.; Silpapojakul, K.; Singkhamanan, K.; McNeil, E.; Doi, Y. Molecular epidemiology and spatiotemporal analysis of hospital-acquired Acinetobacter baumannii infection in a tertiary care hospital in southern Thailand. J. Hosp. Infect. 2017, 95, 53–58. [Google Scholar] [CrossRef]
- Tran, D.N.; Tran, H.H.; Matsui, M.; Suzuki, M.; Suzuki, S.; Shibayama, K.; Pham, T.D.; Van Phuong, T.T.; Dang, D.A.; Trinh, H.S.; et al. Emergence of New Delhi metallo-beta-lactamase 1 and other carbapenemase-producing Acinetobacter calcoaceticus-baumannii complex among patients in hospitals in Ha Noi, Viet Nam. Eur. J. Clin. Microbiol. Infect. Dis. 2017, 36, 219–225. [Google Scholar] [CrossRef]
- Poirel, L.; Bonnin, R.A.; Nordmann, P. Genetic basis of antibiotic resistance in pathogenic Acinetobacter species. IUBMB Life 2011, 63, 1061–1067. [Google Scholar] [CrossRef]
- Benini, S.; Wilson, K. Structure of the Mycobacterium tuberculosis soluble inorganic pyrophosphatase Rv3628 at pH 7.0. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2011, 67, 866–870. [Google Scholar] [CrossRef]
- Baykov, A.A.; Dudarenkov, V.Y.; Kapyla, J.; Salminen, T.; Hyytia, T.; Kasho, V.N.; Husgafvel, S.; Cooperman, B.S.; Goldman, A.; Lahti, R. Dissociation of hexameric Escherichia coli inorganic pyrophosphatase into trimers on His-136-->Gln or His-140-->Gln substitution and its effect on enzyme catalytic properties. J. Biol. Chem. 1995, 270, 30804–30812. [Google Scholar] [CrossRef]
- Avaeva, S.; Grigorjeva, O.; Mitkevich, V.; Sklyankina, V.; Varfolomeyev, S. Interaction of Escherichia coli inorganic pyrophosphatase active sites. FEBS Lett. 1999, 464, 169–173. [Google Scholar] [CrossRef]
- Schlesinger, M.J.; Coon, M.J. Hydrolysis of nucleoside diand triphosphates by crystalline preparations of yeast inorganic pyrophosphatase. Biochimica Biophysica Acta 1960, 41, 30–36. [Google Scholar] [CrossRef]
- Chao, T.C.; Huang, H.; Tsai, J.Y.; Huang, C.Y.; Sun, Y.J. Kinetic and structural properties of inorganic pyrophosphatase from the pathogenic bacterium Helicobacter pylori. Proteins 2006, 65, 670–680. [Google Scholar] [CrossRef]
- Hosfield, D.J.; Frank, G.; Weng, Y.; Tainer, J.A.; Shen, B. Newly discovered archaebacterial flap endonucleases show a structure-specific mechanism for DNA substrate binding and catalysis resembling human flap endonuclease-1. J. Biol. Chem. 1998, 273, 27154–27161. [Google Scholar] [CrossRef]
- Gan, J.H.; Tropea, J.E.; Austin, B.P.; Court, D.L.; Waugh, D.S.; Ji, X.H. Structural insight into the mechanism of double-stranded RNA processing by ribonuclease III. Cell 2006, 124, 355–366. [Google Scholar] [CrossRef]
- Su, J.Y.; Forchhammer, K. Determinants for substrate specificity of the bacterial PP2C protein phosphatase tPphA from Thermosynechococcus elongatus. FEBS J. 2013, 280, 694–707. [Google Scholar] [CrossRef]
- Salminen, T.; Kapyla, J.; Heikinheimo, P.; Kankare, J.; Goldman, A.; Heinonen, J.; Baykov, A.A.; Cooperman, B.S.; Lahti, R. Structure and function analysis of Escherichia coli inorganic pyrophosphatase: Is a hydroxide ion the key to catalysis? Biochemistry-Us 1995, 34, 782–791. [Google Scholar] [CrossRef]
- Si, Y.L.; Yuan, Y.; Wang, Y.; Gao, J.; Hu, Y.B.; Feng, S.Q.; Su, J.Y. Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition. Catalysts 2016, 6. [Google Scholar] [CrossRef]
- Qin, J.; Chai, G.; Brewer, J.M.; Lovelace, L.L.; Lebioda, L. Fluoride inhibition of enolase: Crystal structure and thermodynamics. Biochemistry-Us 2006, 45, 793–800. [Google Scholar] [CrossRef]
- Smirnova, I.N.; Baikov, A.A. Two-stage mechanism of the fluoride inhibition of inorganic pyrophosphatase using the fluoride ion. Biokhimiia 1983, 48, 1643–1653. [Google Scholar]
- Samygina, V.R.; Moiseev, V.M.; Rodina, E.V.; Vorobyeva, N.N.; Popov, A.N.; Kurilova, S.A.; Nazarova, T.I.; Avaeva, S.M.; Bartunik, H.D. Reversible inhibition of Escherichia coli inorganic pyrophosphatase by fluoride: Trapped catalytic intermediates in cryo-crystallographic studies. J. Mol. Biol. 2007, 366, 1305–1317. [Google Scholar] [CrossRef]
- Fredric, M.M. Nucleophilicity and Distance. Nucleophilicity 1987, 215, 209–218. [Google Scholar]
- Bergmeyer, H.; Gawehn, K.; Grassl, M. Methods of Enzymatic Analysis, 2nd ed.; Academic Press: New York, NY, USA, 1974; Volume I, p. 508. [Google Scholar]
- Kabsch, W. XDS. Acta Crystallogr. D Biol. Crystallogr. 2010, 66, 125–132. [Google Scholar] [CrossRef]
- Potterton, E.; Briggs, P.; Turkenburg, M.; Dodson, E. A graphical user interface to the CCP4 program suite. Acta Crystallogr. D Biol. Crystallogr. 2003, 59, 1131–1137. [Google Scholar] [CrossRef]
- McCoy, A.J.; Grosse-Kunstleve, R.W.; Adams, P.D.; Winn, M.D.; Storoni, L.C.; Read, R.J. Phaser crystallographic software. J. Appl. Crystallogr. 2007, 40, 658–674. [Google Scholar] [CrossRef]
- Adams, P.D.; Afonine, P.V.; Bunkoczi, G.; Chen, V.B.; Davis, I.W.; Echols, N.; Headd, J.J.; Hung, L.W.; Kapral, G.J.; Grosse-Kunstleve, R.W. PHENIX: A comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr. D Biol. Crystallogr. 2010, 66, 213–221. [Google Scholar] [CrossRef]
- Emsley, P.; Lohkamp, B.; Scott, W.G.; Cowtan, K. Features and development of Coot. Acta Crystallogr. D Biol. Crystallogr. 2010, 66, 486–501. [Google Scholar] [CrossRef]
- Davis, I.W.; Leaver-Fay, A.; Chen, V.B.; Block, J.N.; Kapral, G.J.; Wang, X.; Murray, L.W.; Arendall, W.B.; Snoeyink, J.; Richardson, J.S.; et al. MolProbity: All-atom contacts and structure validation for proteins and nucleic acids. Nucleic Acids Res. 2007, 35, W375–W383. [Google Scholar] [CrossRef]
- The PyMOL Molecular Graphics System, Version 1.7.2. Schrödinger LLC, 2015. Available online: http://www.pymol.org (accessed on 25 April 2016).
- Zhang, Z.; Zheng, Y.; Wang, H.; Zhou, Y.; Tai, G. CD146 interacts with galectin-3 to mediate endothelial cell migration. FEBS Lett. 2018, 592, 1817–1828. [Google Scholar] [CrossRef]
Structure 1 | Structure 2 | Structure 3 | Structure 4 | |
---|---|---|---|---|
WT | WT | K30R | K149R | |
PDB Code | 6K21 | 6K27 | 6KI7 | 6KI8 |
Resolution (Å) | 19.90–2.00 (2.05–2.00) | 19.76–1.86 (1.89–1.86) | 19.96–2.75 (2.88-2.75) | 19.99–1.79 (1.83–1.79) |
Space group | P6322 | H3 | H32 | P41212 |
Unit cell parameters (a, b, c) (Å), (α, β, γ) (°) | (102.81, 102.81, 100.78), (90.0, 90.0, 120.0) | (110.29, 110.29, 302.49), (90.0, 90.0, 120.0) | (113.01, 113.07, 551.80), (89.71, 90.00, 119.98) | (116.75, 116.75, 109.70), (90.00, 90.00, 90.00) |
No. of measured reflections | 212121 (15591) | 572102 (29913) | 350097 (44349) | 837007 (49037) |
No. of unique reflections | 21726 (1576) | 114729 (5740) | 35879 (4703) | 71750 (4208) |
Completeness (%) | 99.8 (100.0) | 99.5 (100.0) | 99.6 (100.0) | 99.9 (100.0) |
Multiplicity | 9.8 (9.9) | 5.0 (5.2) | 9.8 (9.4) | 11.7 (11.7) |
Rmerge (%) | 17.0 (42.0) | 9.0 (95.3) | 12.00 (95.4) | 4.9 (56.5) |
<I/δ(I)> | 9.0 (4.7) | 8.4 (1.7) | 7.6 (2.1) | 29.2 (4.5) |
Rmodel (%) | 18.0 | 23.20 | 29.15 | 15.85 |
Rfree (%) | 21.6 | 25.80 | 32.44 | 18.23 |
Rmsd bond lengths (Å) | 0.009 | 0.01 | 0.004 | 0.007 |
Rmsd bond angles (°) | 0.908 | 0.85 | 0.71 | 0.852 |
Ramachandran plotf residues in favored regions (%) | 98.25 | 98.39 | 92.76 | 98.84 |
Substrate/Ligand | Mg2+/Na+ | PPi/Mg2+ | - | PPi/Mg2+ |
Sequence | Modification |
---|---|
DVLVVTPY | |
SEDGDPLDVL | |
SEDGDPLDVLVVTPY | |
SHYKDLEPGKW | |
SPLYKDVKEY | |
TDLPQLL | |
VDRFMGTAMF | |
VDRFMGTAMF | 1 × Oxidation [M] |
VDRFMGTAMF | 2 × Oxidation [M5; M9] |
PVAAGSVIRCRPVGKL | 1 × Carbamidomethyl [C10] |
VDRFMGTAMFY | |
VKISGWEGADVAKAEVIKAIEAAK | |
VIIEIPANAAPIKY | 1 × Phospho [K13] |
VIIEIPANAAPIKYEIDKDSDALF | |
VPNTLSEDGDPL | |
VPNTLSEDGDPLDVL | |
VVTPYPVAAGSVIRCRPVGKL | 1 × Carbamidomethyl [C15] |
VVTPYPVAAGSVIRCRPVGKLNMEDDGGIDAKL | 1 × Carbamidomethyl [C15] |
VDRFMGTAMFY | 1×Oxidation [M9] |
NNIPAGKDAPNDIYVIIEIPANAAPIKY | |
NNIPAGKDAPNDIY | |
NMEDDGGIDAKLIAVPHEKLSPL | 1 × Oxidation [M2] |
EGADVAKAEVIKAIEAAK | |
EIDKDSDALF | |
EIDKDSDALFVDRF | |
FVDRFMGTAMF | |
FVDRFMGTAMF | 1 × Oxidation [M] |
GYVPNTLSEDGDPL | |
IAVPHEKL | |
IAVPHEKLSPL | |
IAVPHEKLSPLY | |
LINQVEHF | |
LINQVEHFF | |
INQVEHFFSHY | |
MGTAMFYPANY | |
MGTAMFYPANY | 1 × Oxidation [M] |
NMEDDGGIDAKL | |
NMEDDGGIDAKL | 1 × Oxidation [M2] |
NMEDDGGIDAKLIAVPHEKL | |
VVTPYPVAAGSVIRCRPVGKLNMEDDGGIDAKL | 1 × Carbamidomethyl [C15]; 1 × Oxidation [M23] |
YKDVKEY |
© 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Si, Y.; Wang, X.; Yang, G.; Yang, T.; Li, Y.; Ayala, G.J.; Li, X.; Wang, H.; Su, J. Crystal Structures of Pyrophosphatase from Acinetobacter baumannii: Snapshots of Pyrophosphate Binding and Identification of a Phosphorylated Enzyme Intermediate. Int. J. Mol. Sci. 2019, 20, 4394. https://doi.org/10.3390/ijms20184394
Si Y, Wang X, Yang G, Yang T, Li Y, Ayala GJ, Li X, Wang H, Su J. Crystal Structures of Pyrophosphatase from Acinetobacter baumannii: Snapshots of Pyrophosphate Binding and Identification of a Phosphorylated Enzyme Intermediate. International Journal of Molecular Sciences. 2019; 20(18):4394. https://doi.org/10.3390/ijms20184394
Chicago/Turabian StyleSi, Yunlong, Xing Wang, Guosong Yang, Tong Yang, Yuying Li, Gabriela Jaramillo Ayala, Xumin Li, Hao Wang, and Jiyong Su. 2019. "Crystal Structures of Pyrophosphatase from Acinetobacter baumannii: Snapshots of Pyrophosphate Binding and Identification of a Phosphorylated Enzyme Intermediate" International Journal of Molecular Sciences 20, no. 18: 4394. https://doi.org/10.3390/ijms20184394
APA StyleSi, Y., Wang, X., Yang, G., Yang, T., Li, Y., Ayala, G. J., Li, X., Wang, H., & Su, J. (2019). Crystal Structures of Pyrophosphatase from Acinetobacter baumannii: Snapshots of Pyrophosphate Binding and Identification of a Phosphorylated Enzyme Intermediate. International Journal of Molecular Sciences, 20(18), 4394. https://doi.org/10.3390/ijms20184394